BB933779 ( RCC06308 )

[UP]


[1][TOP]
>UniRef100_Q84QK1 Putative arabinagalactan protein n=1 Tax=Lotus japonicus
           RepID=Q84QK1_LOTJA
          Length = 149

 Score =  166 bits (421), Expect = 8e-40
 Identities = 92/151 (60%), Positives = 106/151 (70%), Gaps = 10/151 (6%)
 Frame = -3

Query: 482 SAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV 303
           S AV++FLILGLLATSC+AQAP AAPT+ PT TP P   PPAAA  P   PP   PPAA 
Sbjct: 3   SIAVKLFLILGLLATSCVAQAPGAAPTQAPTTTPPP---PPAAAPAP---PPATPPPAAT 56

Query: 302 PAPATPAPASSPA--TSPPAPTPASTPSTAPTPSTAGSPPAPTPD--------SLGPGPS 153
           PAP T  PA++PA   SPPAPTP ++P+ APTPS A SPPAP P         + GPGP+
Sbjct: 57  PAPTTTPPAATPAPSASPPAPTPTASPTGAPTPS-ASSPPAPIPSGPASGPGPAAGPGPN 115

Query: 152 GADTPPSPSAAFSYSKPIIAATALSAALFAI 60
            ADTPP PSAAFS ++PIIA TAL A  FA+
Sbjct: 116 SADTPPPPSAAFSLNQPIIAGTALVATFFAM 146

[2][TOP]
>UniRef100_Q9ZT16 Classical arabinogalactan protein 4 n=1 Tax=Arabidopsis thaliana
           RepID=AGP4_ARATH
          Length = 135

 Score =  121 bits (303), Expect = 4e-26
 Identities = 72/142 (50%), Positives = 88/142 (61%), Gaps = 2/142 (1%)
 Frame = -3

Query: 482 SAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV 303
           S  VQ+FL+L L ATS LAQAP  APT  PTATP P   PP A  PP ATPP    PAA 
Sbjct: 3   SKIVQVFLMLALFATSALAQAP--APT--PTATPPPATPPPVATPPPVATPP----PAAT 54

Query: 302 PAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPPSP 129
           PAPATP PA++PA +   P+ A +P+  PT     SPPAP   ++ P   P  +D  P+P
Sbjct: 55  PAPATPPPAATPAPATTPPSVAPSPADVPT----ASPPAPEGPTVSPSSAPGPSDASPAP 110

Query: 128 SAAFSYSKPIIAATALSAALFA 63
           SAAFS +K   A TA +A ++A
Sbjct: 111 SAAFS-NKAFFAGTAFAAIMYA 131

[3][TOP]
>UniRef100_Q40786 Arabinogalactan-protein n=1 Tax=Pyrus communis RepID=Q40786_PYRCO
          Length = 145

 Score =  115 bits (289), Expect = 2e-24
 Identities = 71/151 (47%), Positives = 89/151 (58%), Gaps = 11/151 (7%)
 Frame = -3

Query: 479 AAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP 300
           A  Q+ ++LGLLATSC+AQAP AAPT          A PP A +P TATPPTATPP+AVP
Sbjct: 6   AGFQVLMVLGLLATSCIAQAPGAAPT----------ASPPTAKSP-TATPPTATPPSAVP 54

Query: 299 APATPAPASSPATSP-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA------DT 141
            P+   P+ +P  SP P+P  A TPS +P  ST  S PA TP +  P  S A      ++
Sbjct: 55  VPS---PSKTPTASPTPSPVTAPTPSASPPSSTPASTPASTPAAKSPSSSAAPSGSSPNS 111

Query: 140 PPS----PSAAFSYSKPIIAATALSAALFAI 60
           PP+    PS   + S+  IA TAL+   FAI
Sbjct: 112 PPADAIPPSGTSAISRVAIAGTALAGVFFAI 142

[4][TOP]
>UniRef100_B9T6V5 Early nodulin 20, putative n=1 Tax=Ricinus communis
           RepID=B9T6V5_RICCO
          Length = 143

 Score =  110 bits (276), Expect = 5e-23
 Identities = 65/147 (44%), Positives = 86/147 (58%), Gaps = 6/147 (4%)
 Frame = -3

Query: 485 SSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAA 306
           S + +++FL+LG+LATSC+AQAP A+PT  P A P P+   P A   PT TP  +T P  
Sbjct: 4   SISMLKVFLVLGVLATSCMAQAPGASPTPSPKAAPTPS---PTAPPTPTPTPSPSTTP-- 58

Query: 305 VPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD---TPP 135
                TPAPA +P T+ P+P+P   PS  P  S A SPPAPTPD+     S +    TPP
Sbjct: 59  -----TPAPAPAPTTASPSPSPVPPPSEGPA-SPAPSPPAPTPDTASTPSSDSPAPATPP 112

Query: 134 SPS---AAFSYSKPIIAATALSAALFA 63
            PS   AA  + + I+A T L+ +  A
Sbjct: 113 PPSDNFAAARFDRVILAGTVLAGSFLA 139

[5][TOP]
>UniRef100_B9H6Z4 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H6Z4_POPTR
          Length = 161

 Score =  107 bits (266), Expect = 8e-22
 Identities = 63/136 (46%), Positives = 79/136 (58%), Gaps = 5/136 (3%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA 282
           ++L LLA S LAQAP AAPT  PT +P+P    PAA        PT  PPA  PAP+ PA
Sbjct: 10  MLLALLAGSALAQAPGAAPTAQPTKSPSPA---PAA--------PTTPPPAPTPAPSVPA 58

Query: 281 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG-----PSGADTPPSPSAAF 117
           P  +PA S PAPTPA+ PST+P+ S A SPP+P     G G     PS   +PPSPS A 
Sbjct: 59  P--TPAPSVPAPTPATAPSTSPSSSPASSPPSPLAPGTGGGSIATPPSDTASPPSPSNAD 116

Query: 116 SYSKPIIAATALSAAL 69
             ++  +A   +  A+
Sbjct: 117 GLNRATMAGALIGVAV 132

[6][TOP]
>UniRef100_Q9SJY7 Classical arabinogalactan protein 2 n=1 Tax=Arabidopsis thaliana
           RepID=AGP2_ARATH
          Length = 131

 Score =  106 bits (264), Expect = 1e-21
 Identities = 69/142 (48%), Positives = 87/142 (61%)
 Frame = -3

Query: 485 SSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAA 306
           +S A+Q  + LG LATSCLAQAP  APT   T TP PTA PP  A  P+   P A+PP  
Sbjct: 2   NSKAMQALIFLGFLATSCLAQAPAPAPT---TVTPPPTALPPVTAETPS---PIASPPVP 55

Query: 305 VPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           V  P TPAP +SP TSP A +P  T + AP PS AG  P  +P    PGP GA    +PS
Sbjct: 56  VNEP-TPAPTTSPTTSPVA-SPPQTDAPAPGPS-AGLTPTSSP---APGPDGA--ADAPS 107

Query: 125 AAFSYSKPIIAATALSAALFAI 60
           AA++ +K  +  TA++ AL+A+
Sbjct: 108 AAWA-NKAFLVGTAVAGALYAV 128

[7][TOP]
>UniRef100_C6T4Y7 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6T4Y7_SOYBN
          Length = 160

 Score =  105 bits (261), Expect = 3e-21
 Identities = 73/150 (48%), Positives = 77/150 (51%), Gaps = 21/150 (14%)
 Frame = +1

Query: 97  MMGLL*ENAAEGEGGVSAPLGPGPRESGVGAGGEPAVEGVGAVDGVEAGVGAGGEVAGEE 276
           M  LL ENAAEG GG + P GPG      G GG     G+G    V  G G GGE AGEE
Sbjct: 1   MKALLAENAAEGGGGSALPEGPGE-----GPGGVLGEVGLG----VTVGEGEGGEAAGEE 51

Query: 277 AGAG--VAGAGTAAGGVAVGGVAVGGVAAAGG*AVGAGVA-------------------V 393
           AG G  V GAG   G  A GGVA GG  AAGG   G GVA                   V
Sbjct: 52  AGVGAAVGGAGAGVGVAAGGGVAAGGGVAAGGGVAGGGVAGVVGAGAGADLGGGGDGVVV 111

Query: 394 GGFVGAAVGACAKQEVAKRPKMRKICTAAE 483
           GG  GAA GA AK E+AK PK+R  CTA E
Sbjct: 112 GGCDGAAPGAWAKHELAKSPKIRNSCTAPE 141

[8][TOP]
>UniRef100_B8BCN6 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8BCN6_ORYSI
          Length = 141

 Score =  102 bits (255), Expect = 1e-20
 Identities = 63/140 (45%), Positives = 75/140 (53%), Gaps = 2/140 (1%)
 Frame = -3

Query: 467 IFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAA--TPPTATPPTATPPAAVPAP 294
           + L + +L  +  AQAP A PT  P A+P P   PP  A  + P A  P   PPA  PAP
Sbjct: 7   VALAMAMLFAAASAQAPAATPTPAPKASPPPATPPPTPAPVSAPPAQAPATPPPAPAPAP 66

Query: 293 ATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
              APA +P  S PAP PA+    APTP  + SPPAP+P  L P P+   TPP PSAA  
Sbjct: 67  KASAPAPAPKASAPAPVPAAA---APTPEIS-SPPAPSPAGLAPSPTAEVTPP-PSAAAV 121

Query: 113 YSKPIIAATALSAALFAIAF 54
            S P  A  A +A   A AF
Sbjct: 122 VS-PAAAWVAAAAVAAAAAF 140

[9][TOP]
>UniRef100_Q6K4A5 Putative uncharacterized protein OJ1595_D08.12-1 n=1 Tax=Oryza
           sativa Japonica Group RepID=Q6K4A5_ORYSJ
          Length = 131

 Score =  102 bits (253), Expect = 2e-20
 Identities = 62/136 (45%), Positives = 73/136 (53%), Gaps = 2/136 (1%)
 Frame = -3

Query: 455 LGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAA--TPPTATPPTATPPAAVPAPATPA 282
           + +L  +  AQAP A PT  P A+P P   PP  A  + P A  P   PPA  PAP   A
Sbjct: 1   MAMLFAAASAQAPAATPTPAPKASPPPATPPPTPAPVSAPPAQAPATPPPAPAPAPKASA 60

Query: 281 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           PA +P  S PAP PA+    APTP  + SPPAP+P  L P P+   TPP PSAA   S P
Sbjct: 61  PAPAPKASAPAPVPAAA---APTPEIS-SPPAPSPAGLAPSPTAEVTPP-PSAAAGVS-P 114

Query: 101 IIAATALSAALFAIAF 54
             A  A +A   A AF
Sbjct: 115 AAAWVAAAAVAAAAAF 130

[10][TOP]
>UniRef100_Q41071 Arabinogalactan-like protein n=1 Tax=Pinus taeda RepID=Q41071_PINTA
          Length = 168

 Score =  100 bits (250), Expect = 6e-20
 Identities = 74/171 (43%), Positives = 96/171 (56%), Gaps = 25/171 (14%)
 Frame = -3

Query: 491 MASSAAVQ--IFLILGLLATSCLAQAPTAAPTKPPTATPAP--TAQPPAAATPP--TATP 330
           MA S A+   +FL+ G L +S +AQ+P+A+PTK PT TPAP  TA P   A PP  TATP
Sbjct: 1   MARSTAMTMVLFLLAGFLVSS-MAQSPSASPTKSPT-TPAPTTTAAPTTTAAPPTITATP 58

Query: 329 P--TATPPAAVPAP-------------ATPAPASSPATSPPA----PTPASTPSTAPTPS 207
           P  TATPP + P P             ATP P ++P  +PP+    P+PA+TP  A  P 
Sbjct: 59  PTTTATPPVSTPPPVSSPPPVTSPPPAATPPPVATPVATPPSPVLVPSPAATPPPAAVP- 117

Query: 206 TAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAALFAIAF 54
           TA  PPA +P +  P  S   +P S S A S +  +  A  L+AAL A+ F
Sbjct: 118 TATPPPAVSPTTASPATSPGVSPSSVSGA-SVTSNLEKAAILTAALAAVFF 167

[11][TOP]
>UniRef100_A3BZS2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A3BZS2_ORYSJ
          Length = 141

 Score =  100 bits (249), Expect = 7e-20
 Identities = 58/135 (42%), Positives = 74/135 (54%), Gaps = 3/135 (2%)
 Frame = -3

Query: 467 IFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAA--TPPTATPPTATPPAAVPAP 294
           + L + +L  +  AQAP A PT  P A+P P   PP  A  + P A  P   PPA  PAP
Sbjct: 7   VALAMAMLFAAASAQAPAATPTPAPKASPPPATPPPTPAPVSAPPAQAPATPPPAPAPAP 66

Query: 293 ATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSPSAAF 117
              APA +P  S PAP PA+    APTP  + SPPAP+P  L P P+   TP P  +A  
Sbjct: 67  KASAPAPAPKASAPAPVPAAA---APTPEIS-SPPAPSPAGLAPSPTAEVTPSPRDAAGV 122

Query: 116 SYSKPIIAATALSAA 72
           S +   +AA A++AA
Sbjct: 123 SPAAAWVAAAAVAAA 137

[12][TOP]
>UniRef100_B6UHB2 Transcriptional regulatory protein algP n=1 Tax=Zea mays
           RepID=B6UHB2_MAIZE
          Length = 138

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 62/135 (45%), Positives = 75/135 (55%), Gaps = 2/135 (1%)
 Frame = -3

Query: 455 LGLLATSCLAQAPTAAPTKPPTATPAPTAQPPA-AATPPTATPPTATPPAAVPAPATPAP 279
           + +L  +  AQAPTA PT  P A+P P   PP  A   P   PPT  PPA  PAP  PAP
Sbjct: 11  MAMLFAAAAAQAPTATPTPAPKASPPPATPPPTPAPVSPPVPPPTMPPPAPAPAPKAPAP 70

Query: 278 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS-GADTPPSPSAAFSYSKP 102
           A      P APTPA T + APTP  + SPP PT    GP P+  A+ PP+PSAA + + P
Sbjct: 71  A------PEAPTPAPT-AEAPTPDVS-SPPMPTE---GPAPTPSAEAPPAPSAAVAGASP 119

Query: 101 IIAATALSAALFAIA 57
                A +AA+ A A
Sbjct: 120 SAKWFAAAAAVAAAA 134

[13][TOP]
>UniRef100_UPI0001982E0B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982E0B
          Length = 222

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 56/129 (43%), Positives = 72/129 (55%), Gaps = 12/129 (9%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAA----ATPPTATPPTATPPAAVPAPATPAPAS-SPA 264
           A +P  A T PP ++P P + PP A    ATPP ATPP ATPP A P PATP PA+  PA
Sbjct: 41  AASPPTAVTSPPASSPPPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPA 100

Query: 263 TSPPA-PTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTP----PSPSAAFSYSK 105
           T PPA P PA+ P   P P+T    +PP  TP    P P+   +P    P+P+ +     
Sbjct: 101 TPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPAHLASPPAAVPAPAPSTKVKS 160

Query: 104 PIIAATALS 78
           P +A + L+
Sbjct: 161 PALAPSPLT 169

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 56/111 (50%), Positives = 62/111 (55%), Gaps = 13/111 (11%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAA---ATPPTATPPTATPPAAVPAPATPAPASSP---ATSP 255
           T  P  PP ATP P   PPA    ATPP ATPP ATPP A P PATP PA+ P     SP
Sbjct: 86  TPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPAHLASP 145

Query: 254 PAPTPASTPST-------APTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
           PA  PA  PST       AP+P T  SPPAP  ++  PGP      P+P+A
Sbjct: 146 PAAVPAPAPSTKVKSPALAPSPLT-NSPPAPPAEA--PGPISGGISPAPAA 193

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 53/108 (49%), Positives = 60/108 (55%), Gaps = 10/108 (9%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAA---ATPPTATPPTATPPAAVPAPATPAPAS-SPATSPPA 249
           T  P  PP ATP P   PPA    ATPP ATPP ATPP A P PATP PA+  PAT PPA
Sbjct: 71  TPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPA 130

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPD------SLGPGPSGADTPPSPSA 123
             P +TP  A   S   + PAP P       +L P P   ++PP+P A
Sbjct: 131 TPPPATPPPAHLASPPAAVPAPAPSTKVKSPALAPSPL-TNSPPAPPA 177

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 52/111 (46%), Positives = 59/111 (53%), Gaps = 5/111 (4%)
 Frame = -3

Query: 419 PTAAPTKPPTA-TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS-SPATSPPA- 249
           PT     PPTA T  P + PP  + PP ATPP ATPP A P PATP PA+  PAT PPA 
Sbjct: 37  PTTPAASPPTAVTSPPASSPPPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPAT 96

Query: 248 PTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           P PA+ P   P P+T    +PP  TP    P P     P +P  A   S P
Sbjct: 97  PPPATPPPATPPPATPPPATPPPATPPPATP-PPATPPPATPPPAHLASPP 146

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 53/107 (49%), Positives = 61/107 (57%), Gaps = 9/107 (8%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPA---PTA--QPPAAATPPTATPPTATPPAAVPAPATPAPASSP- 267
           A  PTA P  P   TPA   PTA   PPA++ PP + PP ATPP A P PATP PA+ P 
Sbjct: 25  AGGPTATPAPPTPTTPAASPPTAVTSPPASSPPPVSAPPPATPPPATPPPATPPPATPPP 84

Query: 266 ATSPPA-PTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPP 135
           AT PPA P PA+ P   P P+T    +PP  TP    P P+   TPP
Sbjct: 85  ATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPA---TPP 128

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 43/91 (47%), Positives = 50/91 (54%), Gaps = 8/91 (8%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAA---ATPPTATPP---TATPPAAVPAPATPAPASSPATSP 255
           T  P  PP ATP P   PPA    ATPP ATPP    A+PPAAVPAPA      SPA +P
Sbjct: 106 TPPPATPPPATPPPATPPPATPPPATPPPATPPPAHLASPPAAVPAPAPSTKVKSPALAP 165

Query: 254 PAPT--PASTPSTAPTPSTAGSPPAPTPDSL 168
              T  P + P+ AP P + G  PAP  + +
Sbjct: 166 SPLTNSPPAPPAEAPGPISGGISPAPAANDV 196

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 45/114 (39%), Positives = 53/114 (46%), Gaps = 5/114 (4%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA 282
           L+LGL+     A     AP   PTATPAP               PT T PAA P  A  +
Sbjct: 7   LVLGLVCI-VFAGVGGQAPAGGPTATPAP---------------PTPTTPAASPPTAVTS 50

Query: 281 PASSPATSPP---APTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPP 135
           P   PA+SPP   AP PA+ P   P P+T    +PP  TP    P P+   TPP
Sbjct: 51  P---PASSPPPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPA---TPP 98

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 39/99 (39%), Positives = 45/99 (45%), Gaps = 24/99 (24%)
 Frame = -3

Query: 359 AAATPPTATPPTAT--------------------PPAAVPAPATPAPAS-SPATSPPA-P 246
           A A  PTATP   T                    PP + P PATP PA+  PAT PPA P
Sbjct: 23  APAGGPTATPAPPTPTTPAASPPTAVTSPPASSPPPVSAPPPATPPPATPPPATPPPATP 82

Query: 245 TPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPP 135
            PA+ P   P P+T    +PP  TP    P P+   TPP
Sbjct: 83  PPATPPPATPPPATPPPATPPPATPPPATPPPA---TPP 118

[14][TOP]
>UniRef100_C0Z219 AT2G14890 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z219_ARATH
          Length = 171

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 58/147 (39%), Positives = 75/147 (51%), Gaps = 25/147 (17%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQAPTAAPTK----------PPTATPAPTAQPPAAATPP 342
           MA S A+ +  I+  L      QAPT+ PT           PP ATP P + PP  ++PP
Sbjct: 1   MARSFAIAVICIV--LIAGVTGQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVSSPP 58

Query: 341 TATPPTATPP--------AAVPAPATPAPASSPA----TSPPAPTPASTPST---APTPS 207
            A+PP ATPP         A P PATP P ++P      SPPA  PA  P+T   +P+PS
Sbjct: 59  PASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPS 118

Query: 206 TAGSPPAPTPDSLGPGPSGADTPPSPS 126
            + SPP P+ D+ GP        PSP+
Sbjct: 119 PSSSPPLPSSDAPGPSTDSISPAPSPT 145

[15][TOP]
>UniRef100_A7QW77 Chromosome chr3 scaffold_199, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7QW77_VITVI
          Length = 290

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 56/129 (43%), Positives = 72/129 (55%), Gaps = 12/129 (9%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAA----ATPPTATPPTATPPAAVPAPATPAPAS-SPA 264
           A +P  A T PP ++P P + PP A    ATPP ATPP ATPP A P PATP PA+  PA
Sbjct: 109 AASPPTAVTSPPASSPPPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPA 168

Query: 263 TSPPA-PTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTP----PSPSAAFSYSK 105
           T PPA P PA+ P   P P+T    +PP  TP    P P+   +P    P+P+ +     
Sbjct: 169 TPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPAHLASPPAAVPAPAPSTKVKS 228

Query: 104 PIIAATALS 78
           P +A + L+
Sbjct: 229 PALAPSPLT 237

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 56/111 (50%), Positives = 62/111 (55%), Gaps = 13/111 (11%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAA---ATPPTATPPTATPPAAVPAPATPAPASSP---ATSP 255
           T  P  PP ATP P   PPA    ATPP ATPP ATPP A P PATP PA+ P     SP
Sbjct: 154 TPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPAHLASP 213

Query: 254 PAPTPASTPST-------APTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
           PA  PA  PST       AP+P T  SPPAP  ++  PGP      P+P+A
Sbjct: 214 PAAVPAPAPSTKVKSPALAPSPLT-NSPPAPPAEA--PGPISGGISPAPAA 261

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 53/108 (49%), Positives = 60/108 (55%), Gaps = 10/108 (9%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAA---ATPPTATPPTATPPAAVPAPATPAPAS-SPATSPPA 249
           T  P  PP ATP P   PPA    ATPP ATPP ATPP A P PATP PA+  PAT PPA
Sbjct: 139 TPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPA 198

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPD------SLGPGPSGADTPPSPSA 123
             P +TP  A   S   + PAP P       +L P P   ++PP+P A
Sbjct: 199 TPPPATPPPAHLASPPAAVPAPAPSTKVKSPALAPSPL-TNSPPAPPA 245

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 52/111 (46%), Positives = 59/111 (53%), Gaps = 5/111 (4%)
 Frame = -3

Query: 419 PTAAPTKPPTA-TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS-SPATSPPA- 249
           PT     PPTA T  P + PP  + PP ATPP ATPP A P PATP PA+  PAT PPA 
Sbjct: 105 PTTPAASPPTAVTSPPASSPPPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPAT 164

Query: 248 PTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           P PA+ P   P P+T    +PP  TP    P P     P +P  A   S P
Sbjct: 165 PPPATPPPATPPPATPPPATPPPATPPPATP-PPATPPPATPPPAHLASPP 214

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 53/107 (49%), Positives = 61/107 (57%), Gaps = 9/107 (8%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPA---PTA--QPPAAATPPTATPPTATPPAAVPAPATPAPASSP- 267
           A  PTA P  P   TPA   PTA   PPA++ PP + PP ATPP A P PATP PA+ P 
Sbjct: 93  AGGPTATPAPPTPTTPAASPPTAVTSPPASSPPPVSAPPPATPPPATPPPATPPPATPPP 152

Query: 266 ATSPPA-PTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPP 135
           AT PPA P PA+ P   P P+T    +PP  TP    P P+   TPP
Sbjct: 153 ATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPA---TPP 196

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 43/91 (47%), Positives = 50/91 (54%), Gaps = 8/91 (8%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAA---ATPPTATPP---TATPPAAVPAPATPAPASSPATSP 255
           T  P  PP ATP P   PPA    ATPP ATPP    A+PPAAVPAPA      SPA +P
Sbjct: 174 TPPPATPPPATPPPATPPPATPPPATPPPATPPPAHLASPPAAVPAPAPSTKVKSPALAP 233

Query: 254 PAPT--PASTPSTAPTPSTAGSPPAPTPDSL 168
              T  P + P+ AP P + G  PAP  + +
Sbjct: 234 SPLTNSPPAPPAEAPGPISGGISPAPAANDV 264

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 45/114 (39%), Positives = 53/114 (46%), Gaps = 5/114 (4%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA 282
           L+LGL+     A     AP   PTATPAP               PT T PAA P  A  +
Sbjct: 75  LVLGLVCI-VFAGVGGQAPAGGPTATPAP---------------PTPTTPAASPPTAVTS 118

Query: 281 PASSPATSPP---APTPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPP 135
           P   PA+SPP   AP PA+ P   P P+T    +PP  TP    P P+   TPP
Sbjct: 119 P---PASSPPPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPA---TPP 166

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 39/99 (39%), Positives = 45/99 (45%), Gaps = 24/99 (24%)
 Frame = -3

Query: 359 AAATPPTATPPTAT--------------------PPAAVPAPATPAPAS-SPATSPPA-P 246
           A A  PTATP   T                    PP + P PATP PA+  PAT PPA P
Sbjct: 91  APAGGPTATPAPPTPTTPAASPPTAVTSPPASSPPPVSAPPPATPPPATPPPATPPPATP 150

Query: 245 TPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPP 135
            PA+ P   P P+T    +PP  TP    P P+   TPP
Sbjct: 151 PPATPPPATPPPATPPPATPPPATPPPATPPPA---TPP 186

[16][TOP]
>UniRef100_Q6Z232 Os08g0482300 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q6Z232_ORYSJ
          Length = 146

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 65/144 (45%), Positives = 80/144 (55%), Gaps = 7/144 (4%)
 Frame = -3

Query: 467 IFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTA--TPPAAVPAP 294
           +  +  L A + +AQ P+A+PT      PAP AQPP  ATPPT  P  A  +PPAA P  
Sbjct: 8   VVAMAALFAAAAVAQGPSASPT------PAPKAQPP-VATPPTRPPAVAPVSPPAAQPPV 60

Query: 293 ATPAPASSPATSPPAPTPASTPSTAPTPSTAG----SPPAPTPDSLGPGPSGADT-PPSP 129
            TP P S+PA   PAP+ A+TPS   +  TA     SPPAP P S+   P+ A T PP P
Sbjct: 61  TTPPPVSAPA-PVPAPSAAATPSPQASAPTAEPPVLSPPAPAPGSISQSPTEAPTSPPPP 119

Query: 128 SAAFSYSKPIIAATALSAALFAIA 57
           SAA   S    A  A  AA+ A+A
Sbjct: 120 SAASGVSPSAAAVVAAWAAVAAVA 143

[17][TOP]
>UniRef100_A7R0E9 Chromosome undetermined scaffold_306, whole genome shotgun sequence
           n=1 Tax=Vitis vinifera RepID=A7R0E9_VITVI
          Length = 177

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 62/148 (41%), Positives = 80/148 (54%), Gaps = 22/148 (14%)
 Frame = -3

Query: 479 AAVQIFLILGL---LATSCLAQAPTAAPTKPPTATPAPTAQPPAA-ATPPTATPPTATPP 312
           A V+  L+L L    A S LAQ+P+ +P  PP+    PTA PP   ATPP +    ATPP
Sbjct: 2   AVVRAMLVLALSLTFAASSLAQSPSTSPASPPSTATPPTATPPTTMATPPPSVATPATPP 61

Query: 311 AAV---------PAPAT---PAPASSPATSPPAPTPASTPSTAPTPS---TAGSPPAPTP 177
            ++         P+P T   P+P +SP +SPP   PA+TPS +P+P+   TA SPPAP P
Sbjct: 62  TSISPSPTTSISPSPTTSISPSPTTSPVSSPP---PAATPSMSPSPASSPTAISPPAPPP 118

Query: 176 DSLGPGPSGADTP---PSPSAAFSYSKP 102
               PGPS A  P   P P+     S P
Sbjct: 119 SEGSPGPSTASPPATSPPPAGGPGSSPP 146

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 36/89 (40%), Positives = 53/89 (59%), Gaps = 8/89 (8%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATP-----PTATPPTATPPAAVPAPATPAP- 279
           T+ ++ +PT + +  P+ T +P + PP AATP     P ++P   +PPA  P+  +P P 
Sbjct: 69  TTSISPSPTTSIS--PSPTTSPVSSPPPAATPSMSPSPASSPTAISPPAPPPSEGSPGPS 126

Query: 278 -ASSPATS-PPAPTPASTPSTAPTPSTAG 198
            AS PATS PPA  P S+P  +PTP  +G
Sbjct: 127 TASPPATSPPPAGGPGSSPPPSPTPPPSG 155

[18][TOP]
>UniRef100_Q1HH32 Putative uncharacterized protein n=1 Tax=Antheraea pernyi
           nucleopolyhedrovirus RepID=Q1HH32_NPVAP
          Length = 211

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 52/114 (45%), Positives = 63/114 (55%), Gaps = 4/114 (3%)
 Frame = -3

Query: 467 IFLILGLLAT-SCLAQAPTAAPTK-PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP 294
           IFL+L LLAT  C  + P   PT  PPT TP P+  P    TPPT TPP + PP+  P P
Sbjct: 14  IFLVLYLLATLKCAHKLPQPLPTPTPPTPTPPPSPPPSPTPTPPTPTPPPSPPPSPTPTP 73

Query: 293 ATPAPASSPAT-SPPAPTPAST-PSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 138
            TP P+ +P T +PP P+P  T P  +PTP T   PP+P P    P P     P
Sbjct: 74  PTPTPSPTPPTPTPPPPSPTPTPPPPSPTPPTPTPPPSPPPSPPPPNPEPLGEP 127

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 33/71 (46%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -3

Query: 329 PTATPPAAVPAPA---TPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG 159
           PT TPP   P P+   +P P     T PP+P P+ TP T PTP+ + +PP PTP    P 
Sbjct: 35  PTPTPPTPTPPPSPPPSPTPTPPTPTPPPSPPPSPTP-TPPTPTPSPTPPTPTP----PP 89

Query: 158 PSGADTPPSPS 126
           PS   TPP PS
Sbjct: 90  PSPTPTPPPPS 100

[19][TOP]
>UniRef100_C0Z3D3 AT2G14890 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z3D3_ARATH
          Length = 171

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 59/131 (45%), Positives = 72/131 (54%), Gaps = 8/131 (6%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPT-ATPPTATP 315
           MA S A+ +  I+  L      QAPT+ PT  P A P PT  PPAAA PP    PP ++P
Sbjct: 1   MARSFAIAVICIV--LIAGVTGQAPTSPPTATP-APPTPTTPPPAAAPPPANPPPPVSSP 57

Query: 314 PAAVPAPATPAPASSP----ATSPPA-PTPASTPSTAPTPSTAGSPPAPTPDSL--GPGP 156
           P A P PATP P +SP    A+ PPA P P +TP  AP  S     PAP P +    P P
Sbjct: 58  PPASPPPATPPPVASPPPPVASHPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSP 117

Query: 155 SGADTPPSPSA 123
           S + +PP PS+
Sbjct: 118 SPSSSPPLPSS 128

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 42/96 (43%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPP--AAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAS 234
           P  PP ATP P A PP   A+ PP   PP ATPP        PAP +SP    PAP P +
Sbjct: 59  PASPPPATPPPVASPPPPVASHPPATPPPVATPP--------PAPLASPPAQVPAPAPTT 110

Query: 233 TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P  +P+PS + SPP P+ D+ GP        PSP+
Sbjct: 111 KPD-SPSPSPSSSPPLPSSDAPGPSTDSISPAPSPT 145

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 44/105 (41%), Positives = 57/105 (54%), Gaps = 9/105 (8%)
 Frame = -3

Query: 431 LAQAPTAAP---TKPPTATPAPT------AQPPAAATPPTATPPTATPPAAVPAPATPAP 279
           ++  P A+P   T PP A+P P       A PP  ATPP A  P A+PPA VPAPA    
Sbjct: 54  VSSPPPASPPPATPPPVASPPPPVASHPPATPPPVATPPPA--PLASPPAQVPAPA---- 107

Query: 278 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
              P T P +P+P  +PS++P P  +   P P+ DS+ P PS  D
Sbjct: 108 ---PTTKPDSPSP--SPSSSP-PLPSSDAPGPSTDSISPAPSPTD 146

[20][TOP]
>UniRef100_Q8LG54 Classical arabinogalactan protein 7 n=1 Tax=Arabidopsis thaliana
           RepID=AGP7_ARATH
          Length = 130

 Score = 97.1 bits (240), Expect = 8e-19
 Identities = 62/143 (43%), Positives = 83/143 (58%), Gaps = 1/143 (0%)
 Frame = -3

Query: 485 SSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATP-PTATPPA 309
           +S  ++ F I+ L  TSCLAQAP  +PT   T TP     PP A  PP ATP PT TPP 
Sbjct: 2   NSKIIEAFFIVALFTTSCLAQAPAPSPTT--TVTP-----PPVATPPPAATPAPTTTPPP 54

Query: 308 AVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           AV    +PAP SSP +S  AP+P+S   TA  P+  G  P  +P  L P PS A  PP P
Sbjct: 55  AV----SPAPTSSPPSS--APSPSSDAPTASPPAPEG--PGVSPGELAPTPSDASAPP-P 105

Query: 128 SAAFSYSKPIIAATALSAALFAI 60
           +AA + +K  +  + ++A ++A+
Sbjct: 106 NAALT-NKAFVVGSLVAAIIYAV 127

[21][TOP]
>UniRef100_B9IJC8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IJC8_POPTR
          Length = 137

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 58/147 (39%), Positives = 82/147 (55%), Gaps = 4/147 (2%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTAT--PPTAT 318
           MA+S  + + +++ L  TS +AQ+PT++PT  PT +P P A  P +A PPTAT  PPT++
Sbjct: 1   MATSNILALVVLMVLFLTSTMAQSPTSSPTSSPTKSPVPPASTPTSAPPPTATSPPPTSS 60

Query: 317 PPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPT--PDSLGPGPSGAD 144
           PP + PAP   +P + P  SPP+PT  S+P           PPA +  P S+   PS A 
Sbjct: 61  PPVSPPAP-KKSPTTPPVASPPSPTTVSSP-----------PPASSIPPSSISNSPSDA- 107

Query: 143 TPPSPSAAFSYSKPIIAATALSAALFA 63
             P PSA  +    +    +L A LFA
Sbjct: 108 --PGPSANDAVLNRVTVGGSLLAGLFA 132

[22][TOP]
>UniRef100_Q9SPI6 Putative uncharacterized protein n=1 Tax=Picea rubens
           RepID=Q9SPI6_PICRU
          Length = 165

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 70/169 (41%), Positives = 92/169 (54%), Gaps = 23/169 (13%)
 Frame = -3

Query: 491 MASSAAVQ--IFLILGLLATSCLAQAPTAAPTKPPTATPAPT---AQPPAAATPP--TAT 333
           MA SAA+   +FL+ G L +S +AQAP+A+PTK PT TPAPT   A P   A PP  TAT
Sbjct: 1   MARSAAMTMVLFLLAGFLVSS-MAQAPSASPTKSPT-TPAPTTTAAPPTTTAAPPTTTAT 58

Query: 332 PPTATPP--AAVPAPATPAPASSPATSPPAPTPAST---PSTAPTPSTAGSPPAPTPDSL 168
           PP +TPP  A+ P  ATP P ++P   PP  TP +T   P+  P+P+ A  PPA TP   
Sbjct: 59  PPVSTPPPVASPPPVATPPPVATP---PPVATPVATPPSPALVPSPAVATPPPAATPIVT 115

Query: 167 GPGPSGADTP-----------PSPSAAFSYSKPIIAATALSAALFAIAF 54
               + A TP           PS ++  S +  +     L+AAL  + F
Sbjct: 116 PTASTPAVTPSAAPIASPAVSPSSTSGASVASTLEKTAILAAALAGVFF 164

[23][TOP]
>UniRef100_Q39789 Proline-rich cell wall protein n=1 Tax=Gossypium hirsutum
           RepID=Q39789_GOSHI
          Length = 214

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 50/97 (51%), Positives = 59/97 (60%), Gaps = 5/97 (5%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAA---ATPPTATPPTATPPAAVPAPAT--PAPASSPATSPP 252
           T  P  PP ATP P + PPA    A+PP ATPP ATPP A P PAT  PAP +SP  + P
Sbjct: 92  TPPPASPPPATPPPASPPPATPPPASPPPATPPPATPPPATPPPATPPPAPLASPPATVP 151

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 141
           A +P  TP T+P P+     PAPT  +  PGP+G DT
Sbjct: 152 AISPVQTPLTSP-PAPPTEAPAPTLGAATPGPAGTDT 187

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 52/107 (48%), Positives = 62/107 (57%), Gaps = 5/107 (4%)
 Frame = -3

Query: 419 PTAAP----TKPPTATPAP-TAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP 255
           PTA P    T PPT++P P TA PP  +TPP ++PP ATPP A P PATP PAS P  +P
Sbjct: 54  PTATPPPVSTPPPTSSPPPVTASPPPVSTPPPSSPPPATPPPASPPPATPPPASPPPATP 113

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
           P   PAS P   P P+T   PP  TP    P P+   +PP+   A S
Sbjct: 114 P---PASPPPATPPPAT---PPPATPPPATPPPAPLASPPATVPAIS 154

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/100 (49%), Positives = 62/100 (62%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPAS-SPATSPPA- 249
           P    + PP +TP P++ PPA  TPP A+PP ATP PA+ P PATP PAS  PAT PPA 
Sbjct: 71  PPVTASPPPVSTPPPSSPPPA--TPPPASPPPATPPPAS-PPPATPPPASPPPATPPPAT 127

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P PA+ P   P P+   SPPA  P ++ P  +   +PP+P
Sbjct: 128 PPPATPPPATPPPAPLASPPATVP-AISPVQTPLTSPPAP 166

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 37/78 (47%), Positives = 45/78 (57%)
 Frame = -3

Query: 359 AAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPT 180
           A + PPT+TP T TPPA+ P P T AP +  AT PP  TP   P+++P P TA  PP  T
Sbjct: 25  APSNPPTSTPATPTPPASTPPPTTQAPPTPTATPPPVSTP--PPTSSPPPVTASPPPVST 82

Query: 179 PDSLGPGPSGADTPPSPS 126
           P    P P+   TPP  S
Sbjct: 83  PPPSSPPPA---TPPPAS 97

[24][TOP]
>UniRef100_Q39763 Proline-rich cell wall protein n=1 Tax=Gossypium barbadense
           RepID=Q39763_GOSBA
          Length = 214

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 50/97 (51%), Positives = 59/97 (60%), Gaps = 5/97 (5%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAA---ATPPTATPPTATPPAAVPAPAT--PAPASSPATSPP 252
           T  P  PP ATP P + PPA    A+PP ATPP ATPP A P PAT  PAP +SP  + P
Sbjct: 92  TPPPASPPPATPPPASPPPATPPPASPPPATPPPATPPPATPPPATPPPAPLASPPATVP 151

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 141
           A +P  TP T+P P+     PAPT  +  PGP+G DT
Sbjct: 152 AISPVQTPLTSP-PAPPTEAPAPTLGAATPGPAGTDT 187

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 52/107 (48%), Positives = 62/107 (57%), Gaps = 5/107 (4%)
 Frame = -3

Query: 419 PTAAP----TKPPTATPAP-TAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP 255
           PTA P    T PPT++P P TA PP  +TPP ++PP ATPP A P PATP PAS P  +P
Sbjct: 54  PTATPPPVSTPPPTSSPPPVTASPPPVSTPPPSSPPPATPPPASPPPATPPPASPPPATP 113

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
           P   PAS P   P P+T   PP  TP    P P+   +PP+   A S
Sbjct: 114 P---PASPPPATPPPAT---PPPATPPPATPPPAPLASPPATVPAIS 154

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/100 (49%), Positives = 62/100 (62%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPAS-SPATSPPA- 249
           P    + PP +TP P++ PPA  TPP A+PP ATP PA+ P PATP PAS  PAT PPA 
Sbjct: 71  PPVTASPPPVSTPPPSSPPPA--TPPPASPPPATPPPAS-PPPATPPPASPPPATPPPAT 127

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P PA+ P   P P+   SPPA  P ++ P  +   +PP+P
Sbjct: 128 PPPATPPPATPPPAPLASPPATVP-AISPVQTPLTSPPAP 166

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 36/78 (46%), Positives = 44/78 (56%)
 Frame = -3

Query: 359 AAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPT 180
           A + PPT+TP   TPPA+ P P T AP +  AT PP  TP   P+++P P TA  PP  T
Sbjct: 25  APSNPPTSTPAPPTPPASTPPPTTQAPPTPTATPPPVSTP--PPTSSPPPVTASPPPVST 82

Query: 179 PDSLGPGPSGADTPPSPS 126
           P    P P+   TPP  S
Sbjct: 83  PPPSSPPPA---TPPPAS 97

[25][TOP]
>UniRef100_C5X321 Putative uncharacterized protein Sb02g027270 n=1 Tax=Sorghum
           bicolor RepID=C5X321_SORBI
          Length = 136

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 64/137 (46%), Positives = 74/137 (54%), Gaps = 4/137 (2%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTAAPTKPPTATPAPTAQP--PAAATPPTATPPTATPPAAVPAPAT 288
           L + +L  +  AQAP A PT  P A+P P   P  PA  + P   PPT  PPA  PAP  
Sbjct: 9   LAMAMLFAAAAAQAPAATPTPAPKASPPPAIPPPTPAPVSAPPVPPPTLPPPAMAPAPKA 68

Query: 287 PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS-GADTPPSPSAAFSY 111
           PAPA      P AP PA   + APTP  + SPP P   S GP PS  A+ PP+PSAA S 
Sbjct: 69  PAPA------PEAPAPA-PKADAPTPDVS-SPPMP---SEGPAPSPAAEAPPAPSAAASV 117

Query: 110 S-KPIIAATALSAALFA 63
           S K   AA A+ AA  A
Sbjct: 118 SPKWFAAAAAVGAAAAA 134

[26][TOP]
>UniRef100_UPI00015B61AF PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B61AF
          Length = 224

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 67/153 (43%), Positives = 85/153 (55%), Gaps = 17/153 (11%)
 Frame = -3

Query: 464 FLILGLLATSCLAQAPTAAPTKPPTA-TPAPTAQPPAAATPPT-------ATPPTATPPA 309
           FL +G++ ++  A A  A P  P TA TPA  A P  AATP T       ATP TA  PA
Sbjct: 12  FLAIGIVVSTVAAAATPATPATPATAATPATAATPATAATPATPATAATPATPATAATPA 71

Query: 308 AVPAPATPAPASSPATSPPAPTPAS-----TPSTAPTPSTAGSP-PAPTPDSLGPGPSGA 147
               PATPA A++PAT   A TPA+     TP+TA TP+TA +P  A TP +    P+ A
Sbjct: 72  TAATPATPATAATPATPATAATPATAATPATPATAATPATAATPATAATPAT----PATA 127

Query: 146 DTP---PSPSAAFSYSKPIIAATALSAALFAIA 57
            TP    +P+ A + + P  AAT  +AA  AIA
Sbjct: 128 ATPATAATPATAATPATPATAATPATAATPAIA 160

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 58/144 (40%), Positives = 72/144 (50%), Gaps = 15/144 (10%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPT----ATPPTATPPAAVPAPATPAPA 276
           AT   A  P    T    ATPA  A P  AATP T    ATP TA  PA    PATPA A
Sbjct: 68  ATPATAATPATPATAATPATPATAATPATAATPATPATAATPATAATPATAATPATPATA 127

Query: 275 SSPAT--------SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP---PSP 129
           ++PAT        +P  P  A+TP+TA TP+ A +P  P   +    P+ A TP    +P
Sbjct: 128 ATPATAATPATAATPATPATAATPATAATPAIAATPATPATAATPATPATAATPATAATP 187

Query: 128 SAAFSYSKPIIAATALSAALFAIA 57
           + A + + P  AAT  +AA  A A
Sbjct: 188 ATAATPATPATAATPATAATPATA 211

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 58/136 (42%), Positives = 73/136 (53%), Gaps = 7/136 (5%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTA-TPPTATPPAAVPAPATPAPASSP 267
           AT+     P  A T    ATPA  A     ATP TA TP TA  PA     ATPA A++P
Sbjct: 56  ATAATPATPATAATPATAATPATPATAATPATPATAATPATAATPATPATAATPATAATP 115

Query: 266 AT--SPPAPTPASTPSTAPTPSTAGSPPAP----TPDSLGPGPSGADTPPSPSAAFSYSK 105
           AT  +P  P  A+TP+TA TP+TA +P  P    TP +    P+ A TP +P+ A + + 
Sbjct: 116 ATAATPATPATAATPATAATPATAATPATPATAATP-ATAATPAIAATPATPATAATPAT 174

Query: 104 PIIAATALSAALFAIA 57
           P  AAT  +AA  A A
Sbjct: 175 PATAATPATAATPATA 190

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 59/134 (44%), Positives = 71/134 (52%), Gaps = 10/134 (7%)
 Frame = -3

Query: 443 ATSCLAQAPTAA--PTKPPTA-TPAPTAQPPAAATPPT----ATPPTATPPAAVPAPATP 285
           AT   A  P  A  P  P TA TPA  A P  AATP T    ATP TA  PA    PATP
Sbjct: 86  ATPATAATPATAATPATPATAATPATAATPATAATPATPATAATPATAATPATAATPATP 145

Query: 284 APASSPATSPP---APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
           A A++PAT+     A TPA TP+TA TP+T  +   P   +    P+ A TP +P+ A  
Sbjct: 146 ATAATPATAATPAIAATPA-TPATAATPATPATAATP---ATAATPATAATPATPATA-- 199

Query: 113 YSKPIIAATALSAA 72
            + P  AAT  +AA
Sbjct: 200 -ATPATAATPATAA 212

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 61/145 (42%), Positives = 77/145 (53%), Gaps = 13/145 (8%)
 Frame = -3

Query: 467 IFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTA-TPPT-ATP--PAAVP 300
           + L +  LA   +     AA      ATPA  A P  AATP TA TP T ATP  PA   
Sbjct: 6   LLLCIAFLAIGIVVSTVAAA------ATPATPATPATAATPATAATPATAATPATPATAA 59

Query: 299 APATPAPASSPATSPPAPTPA-----STPSTAPTPSTAGSPPAP----TPDSLGPGPSGA 147
            PATPA A++PAT+    TPA     +TP+TA TP+TA +P  P    TP +    P+ A
Sbjct: 60  TPATPATAATPATAATPATPATAATPATPATAATPATAATPATPATAATP-ATAATPATA 118

Query: 146 DTPPSPSAAFSYSKPIIAATALSAA 72
            TP +P+ A   + P  AAT  +AA
Sbjct: 119 ATPATPATA---ATPATAATPATAA 140

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 56/126 (44%), Positives = 68/126 (53%), Gaps = 5/126 (3%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-TPAPASSP 267
           AT   A  P  A T    ATPA  A P  AATP TA  P     AA PA A TPA A++P
Sbjct: 107 ATPATAATPATAATP---ATPATAATPATAATPATAATPATPATAATPATAATPAIAATP 163

Query: 266 ATSPPAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP---PSPSAAFSYSKPI 99
           AT   A TPA TP+TA TP+TA +P  A TP +    P+ A TP    +P+ A + + P+
Sbjct: 164 ATPATAATPA-TPATAATPATAATPATAATPAT----PATAATPATAATPATAATPATPV 218

Query: 98  IAATAL 81
             A  L
Sbjct: 219 SPAAGL 224

[27][TOP]
>UniRef100_C4J5K1 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C4J5K1_MAIZE
          Length = 231

 Score = 93.6 bits (231), Expect = 9e-18
 Identities = 55/121 (45%), Positives = 64/121 (52%), Gaps = 18/121 (14%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTA--TPPTATPPAAVPAPATP------APASSP 267
           APT  P  P T  PAPT  PPA  TPP A  TPP + P +  PAP TP      +P  +P
Sbjct: 71  APTTPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAP 130

Query: 266 ATSPPAPTPASTPSTAPTPSTAGSPPAPTP-DSLGPGPSGADTP---------PSPSAAF 117
           AT PP+P  A  P+T P P+T   P APTP  S+ P P    TP         PSP+AA 
Sbjct: 131 ATPPPSPPMAPPPATPPPPATPPPPAAPTPAPSVAPTPPPVATPAASPKSPKTPSPAAAT 190

Query: 116 S 114
           S
Sbjct: 191 S 191

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 63/149 (42%), Positives = 70/149 (46%), Gaps = 24/149 (16%)
 Frame = -3

Query: 461 LILGLLATSCLAQ------------APTA--APTKPPTATPAPTAQPPAAATPP---TAT 333
           L+L LL  SC AQ            AP A   P  PP   P P  Q P A  PP   TAT
Sbjct: 8   LVLVLLIASCAAQQSPPAQPPPTPNAPPANSPPQAPPAGNPPPAPQAPPAGNPPPAPTAT 67

Query: 332 PPTA--TPPAAV----PAPATPAPASSPATSPPAP-TPASTPSTAPTPSTAGSPPAPTPD 174
           PP A  TPP A     PAP TP PA  P T PPAP TP  +P  +P P+    PP+P   
Sbjct: 68  PPPAPTTPPPAPTTPPPAPTTPPPA--PTTPPPAPTTPPPSPPASPPPAPTTPPPSP--- 122

Query: 173 SLGPGPSGADTPPSPSAAFSYSKPIIAAT 87
              P P+ A  PPSP  A   + P   AT
Sbjct: 123 PASPPPAPATPPPSPPMAPPPATPPPPAT 151

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 47/107 (43%), Positives = 54/107 (50%), Gaps = 8/107 (7%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP--- 252
           APT  P  P T  P+P A PP A T P  +PP + PPA    P +P  A  PAT PP   
Sbjct: 92  APTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPPSPPMAPPPATPPPPAT 151

Query: 251 -----APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
                APTPA  PS APTP    +P A       P P+ A T P+PS
Sbjct: 152 PPPPAAPTPA--PSVAPTPPPVATPAASPKSPKTPSPAAA-TSPAPS 195

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 52/130 (40%), Positives = 63/130 (48%), Gaps = 16/130 (12%)
 Frame = -3

Query: 419 PTAAPTKPPTATP--APTAQPPAAAT--PPTATPPTATPPAAVPAPATPAPA------SS 270
           P  AP  PP   P  APTA PP A T  PP  T P   P    PAP TP PA      S 
Sbjct: 48  PPPAPQAPPAGNPPPAPTATPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSP 107

Query: 269 PATSPPAP-TPASTPSTAPTPSTAGSPPAP--TPDSLGPGPSGADTP---PSPSAAFSYS 108
           PA+ PPAP TP  +P  +P P+ A  PP+P   P    P P     P   P+P+ + + +
Sbjct: 108 PASPPPAPTTPPPSPPASPPPAPATPPPSPPMAPPPATPPPPATPPPPAAPTPAPSVAPT 167

Query: 107 KPIIAATALS 78
            P +A  A S
Sbjct: 168 PPPVATPAAS 177

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 46/124 (37%), Positives = 61/124 (49%), Gaps = 3/124 (2%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP---P 252
           +P  APT PP   P+P A PP A   P  +PP A PPA  P PATP P ++P  +P   P
Sbjct: 110 SPPPAPTTPP---PSPPASPPPAPATPPPSPPMAPPPATPPPPATPPPPAAPTPAPSVAP 166

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
            P P +TP+ +P      SP A T  +    P+G  T    S A + +       AL+ A
Sbjct: 167 TPPPVATPAASPKSPKTPSPAAATSPAPSLSPAGTPT-NEDSGASARAVGFATVVALAGA 225

Query: 71  LFAI 60
             A+
Sbjct: 226 GLAV 229

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 46/125 (36%), Positives = 61/125 (48%), Gaps = 8/125 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA-------T 261
           P + P  P T  P+P A PP A   P  +PP A PPA  P PATP P ++P        T
Sbjct: 108 PASPPPAPTTPPPSPPASPPPAPATPPPSPPMAPPPATPPPPATPPPPAAPTPAPSVAPT 167

Query: 260 SPPAPTPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATA 84
            PP  TPA++P +  TPS  A + PAP+    G  P+  D+  S  A    +   +A   
Sbjct: 168 PPPVATPAASPKSPKTPSPAAATSPAPSLSPAGT-PTNEDSGASARAVGFATVVALAGAG 226

Query: 83  LSAAL 69
           L+  L
Sbjct: 227 LAVLL 231

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 39/93 (41%), Positives = 48/93 (51%), Gaps = 1/93 (1%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           A  P + P  PP ATP P A PP         PP A  PA   AP TP P ++PA SP +
Sbjct: 131 ATPPPSPPMAPPPATPPPPATPP---------PPAAPTPAPSVAP-TPPPVATPAASPKS 180

Query: 248 P-TPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 153
           P TP+   +T+P PS +   PA TP +   G S
Sbjct: 181 PKTPSPAAATSPAPSLS---PAGTPTNEDSGAS 210

[28][TOP]
>UniRef100_C2BVJ8 Putative uncharacterized protein n=1 Tax=Mobiluncus curtisii ATCC
            43063 RepID=C2BVJ8_9ACTO
          Length = 1525

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 53/111 (47%), Positives = 58/111 (52%), Gaps = 4/111 (3%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQP---PAAATPPTATPPTATPPAAVPAPATP-APASSPATSP 255
            APT  PT PP  TP PT  P   P   TPP  TP   TPPA  P P TP APA  P T+P
Sbjct: 1331 APTPGPTTPPAPTPGPTTPPAPTPGPTTPPAPTPGPTTPPAPTPGPTTPPAPAPGP-TTP 1389

Query: 254  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            PAPTP   P+T P P+  G  P+ TP S  P      T P PS     S+P
Sbjct: 1390 PAPTPG--PTTPPAPTPGGGGPS-TPVSPAPNTPSTPTTPKPSQPSEPSQP 1437

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 49/123 (39%), Positives = 57/123 (46%), Gaps = 12/123 (9%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQP---PAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
            APT  PT PP  TP PT  P   P   TPP  TP   TPPA  P P TP   +   T+PP
Sbjct: 1341 APTPGPTTPPAPTPGPTTPPAPTPGPTTPPAPTPGPTTPPAPAPGPTTPPAPTPGPTTPP 1400

Query: 251  APTPAS---------TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
            APTP            P+T  TP+T   P  P+  S    PS  +TP  P +  +  KP 
Sbjct: 1401 APTPGGGGPSTPVSPAPNTPSTPTTP-KPSQPSEPSQPSEPSQPETPAPPRSPDNLGKPA 1459

Query: 98   IAA 90
              A
Sbjct: 1460 TPA 1462

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/105 (46%), Positives = 54/105 (51%), Gaps = 4/105 (3%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAA----ATPPTATPPTATPPAAVPAPATPAPASSPAT 261
            AQ    APT PP  TP PT  PPA      TPP  TP   TPPA  P P TP   +   T
Sbjct: 1320 AQFSAPAPT-PPAPTPGPTT-PPAPTPGPTTPPAPTPGPTTPPAPTPGPTTPPAPTPGPT 1377

Query: 260  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            +PPAP P  T   APTP    +PPAPTP   GP    +  P +PS
Sbjct: 1378 TPPAPAPGPTTPPAPTPGPT-TPPAPTPGGGGPSTPVSPAPNTPS 1421

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 52/144 (36%), Positives = 65/144 (45%), Gaps = 22/144 (15%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQP---PAAATPPTATPPTATPPAAVP------APATPAPASS 270
            APT  PT PP  TP PT  P   P   TPP  TP   TPPA  P       P +PAP + 
Sbjct: 1361 APTPGPTTPPAPTPGPTTPPAPAPGPTTPPAPTPGPTTPPAPTPGGGGPSTPVSPAPNTP 1420

Query: 269  PATSPPAPTPASTPSTAPTPSTAGSPPAP-TPDSLG-------PG----PSGADTPP-SP 129
               + P P+  S PS    PS   +P  P +PD+LG       PG    PS A + P SP
Sbjct: 1421 STPTTPKPSQPSEPSQPSEPSQPETPAPPRSPDNLGKPATPALPGRSLTPSQAPSAPISP 1480

Query: 128  SAAFSYSKPIIAATALSAALFAIA 57
                  +   + AT  ++ L+  A
Sbjct: 1481 DQLHKSNPANLPATGANSLLYLYA 1504

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 41/87 (47%), Positives = 50/87 (57%), Gaps = 4/87 (4%)
 Frame = -3

Query: 374  TAQPPAAA-TPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTA- 201
            TAQ  A A TPP  TP   TPPA  P P TP   +   T+PPAPTP   P+T P P+   
Sbjct: 1319 TAQFSAPAPTPPAPTPGPTTPPAPTPGPTTPPAPTPGPTTPPAPTPG--PTTPPAPTPGP 1376

Query: 200  GSPPAPTP-DSLGPGPS-GADTPPSPS 126
             +PPAP P  +  P P+ G  TPP+P+
Sbjct: 1377 TTPPAPAPGPTTPPAPTPGPTTPPAPT 1403

[29][TOP]
>UniRef100_B8AG26 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8AG26_ORYSI
          Length = 218

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 62/140 (44%), Positives = 71/140 (50%), Gaps = 15/140 (10%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTA----APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV--- 303
           L+L LL  S  AQ P      AP  PP+ TP PT  PP+  TPP A P   TPP A    
Sbjct: 6   LVLALLVASAAAQQPPTQSPPAPNAPPSNTPPPT--PPSPTTPPPAPPAPTTPPPAPTTP 63

Query: 302 -PAPATPAPA------SSPATSPPAPT-PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA 147
            PAP TP PA      S PAT PPAPT P  +P + P P+ A  PP+P      P P+ A
Sbjct: 64  PPAPTTPPPAPTTPPPSPPATPPPAPTTPPPSPPSQPPPAPATPPPSPPAT---PPPAPA 120

Query: 146 DTPPSPSAAFSYSKPIIAAT 87
             PPSP  A   + P   AT
Sbjct: 121 TPPPSPPLAPPPATPPPPAT 140

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 55/121 (45%), Positives = 62/121 (51%), Gaps = 4/121 (3%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAA-ATPPTA--TPPTATPPAAVPAPATPAPASSPATSPP 252
           APT  P  P T  PAPT  PP+  ATPP A  TPP + P    PAPATP P S PAT PP
Sbjct: 59  APTTPPPAPTTPPPAPTTPPPSPPATPPPAPTTPPPSPPSQPPPAPATP-PPSPPATPPP 117

Query: 251 AP-TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSA 75
           AP TP  +P  AP P+T   PPA  P +L P P+ +  P           PI   T    
Sbjct: 118 APATPPPSPPLAPPPATP-PPPATPPPALAPAPTPSTAPTVAPTTAPTVSPISPKTPAPT 176

Query: 74  A 72
           A
Sbjct: 177 A 177

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 52/124 (41%), Positives = 66/124 (53%), Gaps = 11/124 (8%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPA-PASSPATSPPA 249
           APT  P  P T  P+P A PP A T P  +PP+  PPA A P P+ PA P  +PAT PP+
Sbjct: 66  APTTPPPAPTTPPPSPPATPPPAPTTPPPSPPSQPPPAPATPPPSPPATPPPAPATPPPS 125

Query: 248 PTPASTPSTAPTPST--AGSPPAPTPDSLGP--GPSGADT-----PPSPSAAFSYSKPII 96
           P  A  P+T P P+T      PAPTP S  P   P+ A T     P +P+   +   P +
Sbjct: 126 PPLAPPPATPPPPATPPPALAPAPTP-STAPTVAPTTAPTVSPISPKTPAPTAATPSPSL 184

Query: 95  AATA 84
           + TA
Sbjct: 185 SPTA 188

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 48/125 (38%), Positives = 62/125 (49%), Gaps = 5/125 (4%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  P T  P+P A PP A   P  +PP A PPA  P PATP PA +     PAPTP
Sbjct: 97  PSQPPPAPATPPPSPPATPPPAPATPPPSPPLAPPPATPPPPATPPPALA-----PAPTP 151

Query: 239 ASTPSTAPTPSTAGSP-----PAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSA 75
           ++ P+ APT +   SP     PAPT  +  P  S   TP + ++  + +       AL A
Sbjct: 152 STAPTVAPTTAPTVSPISPKTPAPTAATPSPSLSPTATPTTDNSGATTTARAAGVAALVA 211

Query: 74  ALFAI 60
              AI
Sbjct: 212 LAGAI 216

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 54/127 (42%), Positives = 65/127 (51%), Gaps = 7/127 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P + P++PP A   P   PPA   P  ATPP + P A  P PATP P   PAT PPA  P
Sbjct: 93  PPSPPSQPPPAPATPPPSPPATPPPAPATPPPSPPLA--PPPATPPP---PATPPPALAP 147

Query: 239 ASTPSTAPT--PSTAG-----SPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATAL 81
           A TPSTAPT  P+TA      SP  P P +  P PS      SP+A  +        TA 
Sbjct: 148 APTPSTAPTVAPTTAPTVSPISPKTPAPTAATPSPS-----LSPTATPTTDNSGATTTAR 202

Query: 80  SAALFAI 60
           +A + A+
Sbjct: 203 AAGVAAL 209

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 42/95 (44%), Positives = 48/95 (50%), Gaps = 7/95 (7%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-----TPAPASSPA 264
           A  P + P  PP A   P   PP A  P T  PP   PPA  PAP      T AP ++P 
Sbjct: 105 ATPPPSPPATPPPAPATPPPSPPLAPPPATPPPPATPPPALAPAPTPSTAPTVAPTTAPT 164

Query: 263 TSPPAP-TPASTPSTAPTPSTAGSPPA-PTPDSLG 165
            SP +P TPA    TA TPS + SP A PT D+ G
Sbjct: 165 VSPISPKTPA---PTAATPSPSLSPTATPTTDNSG 196

[30][TOP]
>UniRef100_UPI00015538CB PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI00015538CB
          Length = 241

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 49/109 (44%), Positives = 57/109 (52%), Gaps = 1/109 (0%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           + S  A AP  AP   P   PAP   P  A  P  A P  A  PA  PAPA PAPA +PA
Sbjct: 39  SASASASAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAPAPAPPAPAPAPA 98

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSPSAA 120
              PAP PA  P+ AP P+ A   PAP P +  P P+ A  P P+P+ A
Sbjct: 99  PPAPAPAPAPAPAPAPAPAPA---PAPAPPAPAPAPAPAPAPAPAPAPA 144

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 52/112 (46%), Positives = 61/112 (54%), Gaps = 9/112 (8%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-P 252
           A AP  AP   P A PAP   PPA A  P   P  A  PA  PAPA PAPA +PA +P P
Sbjct: 79  APAPAPAPAPAPPA-PAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAPAP 137

Query: 251 APTPASTPSTAPTPSTAGSP-------PAPTPDSLGPGPSGADTP-PSPSAA 120
           AP PA  P+ AP P+ A +P       PAP P +  P P+ A  P P+P+ A
Sbjct: 138 APAPAPAPAPAPAPAPAPAPAPAPPPAPAPAPPAPAPAPAPAPAPAPAPAPA 189

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 51/112 (45%), Positives = 58/112 (51%), Gaps = 5/112 (4%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-----TPAPASSPA 264
           A AP  AP   P   PAP A  PA A  P   P  A  PA  PAPA      PAP  +PA
Sbjct: 107 APAPAPAPAPAPAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPPPAPA 166

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYS 108
            +PPAP PA  P+ AP P+ A + PAP P    P P+ A  P S SA+ S S
Sbjct: 167 PAPPAPAPAPAPAPAPAPAPAPA-PAPAP---APAPAPAPAPASASASASVS 214

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 52/124 (41%), Positives = 61/124 (49%), Gaps = 21/124 (16%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-- 255
           A AP  AP   P   PAP   PPA A  P   P  A PPA  PAPA PAPA +PA +P  
Sbjct: 54  APAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAPAPA-PPAPAPAPAPPAPAPAPAPAPAP 112

Query: 254 ------------------PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPS 132
                             PAP PA  P+ AP P+ A +P PAP P +  P P+ A  PP+
Sbjct: 113 APAPAPAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAP-APAPPPAPAPAPPA 171

Query: 131 PSAA 120
           P+ A
Sbjct: 172 PAPA 175

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 54/127 (42%), Positives = 63/127 (49%), Gaps = 2/127 (1%)
 Frame = -3

Query: 428 AQAPTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
           A AP  AP  P P   PAP   P  A  P  A P  A  PA  PAPA PAPA +PA + P
Sbjct: 92  APAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAPAPA-PAPAPAPAPA-P 149

Query: 251 APTPASTPSTAPTPSTAGSPPAPTP-DSLGPGPSGADTPPSPSAAFSYSKPIIAATALSA 75
           AP PA  P+ AP P+ A +PPAP P  +  P P+ A  P    A      P  A  + SA
Sbjct: 150 APAPAPAPAPAPPPAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPASASA 209

Query: 74  ALFAIAF 54
           +    AF
Sbjct: 210 SASVSAF 216

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 49/122 (40%), Positives = 58/122 (47%), Gaps = 1/122 (0%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAPT 243
           P  AP   P   PAP   P  A  PP   P  A  PA  PAPA PAPA +PA +P PAP 
Sbjct: 100 PAPAPAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAPAPAPAPA-PAPAPAPAPAPAPAPA 158

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAALFA 63
           PA  P+ AP P      PAP P +  P P+ A  P    A      P  A+ + S + F 
Sbjct: 159 PAPPPAPAPAPPAPAPAPAPAP-APAPAPAPAPAPAPAPAPAPAPAPASASASASVSAFH 217

Query: 62  IA 57
           +A
Sbjct: 218 LA 219

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 52/126 (41%), Positives = 67/126 (53%), Gaps = 5/126 (3%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-TPAPASSPATSP-PA 249
           AP  AP   P   PAP   P  A   P   P  A  PA  PAPA  PAPA +PA +P PA
Sbjct: 101 APAPAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPA 160

Query: 248 PTPASTPS-TAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAAFSYSKPIIAATALS 78
           P PA  P+  AP P+ A +P PAP P +  P P+ A  P P+P+ A + +   ++A  L+
Sbjct: 161 PPPAPAPAPPAPAPAPAPAPAPAPAP-APAPAPAPAPAPAPAPAPASASASASVSAFHLA 219

Query: 77  AALFAI 60
             + AI
Sbjct: 220 PGICAI 225

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 45/100 (45%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-P 252
           A AP  AP   P   PAP   P  A  PP A  P   PPA  PAPA PAPA +PA +P P
Sbjct: 134 APAPAPAPAPAPAPAPAPAPAPAPAPAPPPA--PAPAPPAPAPAPA-PAPAPAPAPAPAP 190

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
           AP PA  P+ AP P++A +  + +   L PG    D+ PS
Sbjct: 191 APAPAPAPAPAPAPASASASASVSAFHLAPGICAIDSVPS 230

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 44/118 (37%), Positives = 56/118 (47%), Gaps = 18/118 (15%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP----- 255
           P     +  +A+ +  A  PA A  P   P  A  PA  PAPA PAPA +PA +P     
Sbjct: 32  PRRWAVRSASASASAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPPAPAPAPAPAPAPAPP 91

Query: 254 ------------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSPSAA 120
                       PAP PA  P+ AP P+ A +PPAP P    P P+ A  P P+P+ A
Sbjct: 92  APAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPPAPAP---APAPAPAPAPAPAPAPA 146

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 49/138 (35%), Positives = 66/138 (47%), Gaps = 15/138 (10%)
 Frame = -3

Query: 488 ASSAAVQIFLILGLLATS--CLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP 315
           A +  V   L+  +L  S  C+       P +    + + +A  PA A  P   P  A  
Sbjct: 3   APAPTVTDLLLYAILKGSRWCVLVGSVNRPRRWAVRSASASASAPAPAPAPAPAPAPAPA 62

Query: 314 PAAVPAPA--------TPAPASSPATSPPAPTPA-STPSTAPTPSTAGSP---PAPTPDS 171
           PA  PAPA         PAPA +PA +PPAP PA + P+ AP P+ A +P   PAP P  
Sbjct: 63  PAPAPAPAPAPAPPAPAPAPAPAPAPAPPAPAPAPAPPAPAPAPAPAPAPAPAPAPAPAP 122

Query: 170 LGPGPSGADTP-PSPSAA 120
             P P+ A  P P+P+ A
Sbjct: 123 APPAPAPAPAPAPAPAPA 140

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 38/95 (40%), Positives = 50/95 (52%), Gaps = 1/95 (1%)
 Frame = -3

Query: 383 PAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPST 204
           P   A   A+A+     P  A  PA  PAPA PAPA +PA +P  P PA  P+ AP P+ 
Sbjct: 32  PRRWAVRSASASASAPAPAPAPAPAPAPAPA-PAPAPAPAPAPAPPAPAPAPAPAPAPAP 90

Query: 203 AGSPPAPTPDSLGPGPSGADTP-PSPSAAFSYSKP 102
               PAP P +  P P+ A  P P+P+ A + + P
Sbjct: 91  PAPAPAPAPPAPAPAPAPAPAPAPAPAPAPAPAPP 125

[31][TOP]
>UniRef100_C5Z861 Putative uncharacterized protein Sb10g027460 n=1 Tax=Sorghum
           bicolor RepID=C5Z861_SORBI
          Length = 278

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 59/151 (39%), Positives = 75/151 (49%), Gaps = 19/151 (12%)
 Frame = -3

Query: 488 ASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA 309
           AS  A +  +++ L   S     P A PT PPT  P+P + PPA AT P+++PP+ +  A
Sbjct: 116 ASCRANEKLIVVVLADRSGTRTPPAAPPTSPPTPLPSPPSSPPAPATSPSSSPPSGS-AA 174

Query: 308 AVPAP-ATPAPASSPATSPPAPTPAST--------------PSTAPTPSTAGSPPAPTPD 174
            VPAP ATP    SPA S PAP P +T              PST PTP    S   P+  
Sbjct: 175 PVPAPAATPTSPPSPAASAPAPAPTTTAPSSPPAPAAQTPSPSTTPTPGGGSSSSPPSGS 234

Query: 173 SLGPGPSGAD----TPPSPSAAFSYSKPIIA 93
           +  PG  G      TPP PSAA     P++A
Sbjct: 235 ASAPGGDGGSGSTTTPPPPSAA----APVVA 261

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 35/89 (39%), Positives = 49/89 (55%), Gaps = 2/89 (2%)
 Frame = -3

Query: 350 TPPTATPPTATPPAAVPAPAT--PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTP 177
           TPP A PPT+ PP  +P+P +  PAPA+SP++SPP+ + A  P+ A TP++  SP A  P
Sbjct: 137 TPPAA-PPTS-PPTPLPSPPSSPPAPATSPSSSPPSGSAAPVPAPAATPTSPPSPAASAP 194

Query: 176 DSLGPGPSGADTPPSPSAAFSYSKPIIAA 90
                        P+P+     S P  AA
Sbjct: 195 ------------APAPTTTAPSSPPAPAA 211

[32][TOP]
>UniRef100_B9T0L7 Nutrient reservoir, putative n=1 Tax=Ricinus communis
           RepID=B9T0L7_RICCO
          Length = 175

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 66/156 (42%), Positives = 85/156 (54%), Gaps = 18/156 (11%)
 Frame = -3

Query: 485 SSAAVQIFLILGLLATSCLAQAPTAAPTKPPTAT---PAPTAQP-PAAATPPTAT---PP 327
           S A +   L+LGLLA+S +AQ PT  P+ PPT +   PA TA P P  + PP A    PP
Sbjct: 4   SRAMLMTTLMLGLLASSTIAQGPTMPPSMPPTTSASPPAATAAPSPMVSAPPPAAMTPPP 63

Query: 326 TATPPAAVPAPATPAPASSPATSPP-------APTPAST-PSTAP--TPSTAGSPPAPTP 177
            ATP +  P  ++P+P+ SP  SPP        PT ++T PS AP  +P   GSPP P  
Sbjct: 64  AATPMSPPPTMSSPSPSMSPTMSPPPTMSPTMPPTSSATPPSMAPESSPPEMGSPPEPA- 122

Query: 176 DSLGPGPS-GADTPPSPSAAFSYSKPIIAATALSAA 72
              GP P+ G  +PPSP  A   S P ++ T  S A
Sbjct: 123 ---GPAPTPGGMSPPSP--AMVPSTPPVSTTPDSGA 153

[33][TOP]
>UniRef100_A9P9Z1 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P9Z1_POPTR
          Length = 207

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 65/154 (42%), Positives = 79/154 (51%), Gaps = 16/154 (10%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQ-PPAAATPPTATPPTATPPAAVPAPATPAPAS-S 270
           AT+     P A  T PP + P P  Q PP A  PP + PP A+PP A P PATP PA+  
Sbjct: 38  ATTPTTSPPPATSTPPPVSAPPPVTQSPPPATPPPVSAPPPASPPPATPPPATPPPATPP 97

Query: 269 PATSPPAPTPASTPSTAPTPSTAGSPPAP--TPDSLGPGPSGADT-------PPSPSAAF 117
           PAT PPA  P +TP  A TP  A  PPAP  +P +L P P+ A +        PSP A+ 
Sbjct: 98  PATPPPATPPPATPPPA-TPPPAVPPPAPLASPPALVPAPAPAPSKSKLKAPAPSPLASS 156

Query: 116 SYSKPIIA-ATALSAALFAIAF*DLS----MWRL 30
             + P  A A +L A+       DLS    MW L
Sbjct: 157 PPAPPTGAPAPSLGASSPGPVGTDLSGAEKMWSL 190

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 60/143 (41%), Positives = 80/143 (55%), Gaps = 13/143 (9%)
 Frame = -3

Query: 467 IFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPP--------TATPPTAT-P 315
           I +++G ++    A +PTA P  PPTAT   T+ PPA +TPP        T +PP AT P
Sbjct: 13  ICIVIGGVSGQAPATSPTATPA-PPTATTPTTSPPPATSTPPPVSAPPPVTQSPPPATPP 71

Query: 314 PAAVPAPATPAPAS-SPATSPPA-PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 141
           P + P PA+P PA+  PAT PPA P PA+ P   P P+T   PP  TP    P P+   +
Sbjct: 72  PVSAPPPASPPPATPPPATPPPATPPPATPPPATPPPAT---PPPATPPPAVPPPAPLAS 128

Query: 140 PPS--PSAAFSYSKPIIAATALS 78
           PP+  P+ A + SK  + A A S
Sbjct: 129 PPALVPAPAPAPSKSKLKAPAPS 151

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 50/120 (41%), Positives = 58/120 (48%), Gaps = 7/120 (5%)
 Frame = -3

Query: 410 APTKPPTATPAPTAQPPAAATPPTATPPTAT---PPAAVPAPATPAPASSPATSPP--AP 246
           AP   PTATPAP       AT PT +PP AT   PP + P P T +P   PAT PP  AP
Sbjct: 24  APATSPTATPAPPT-----ATTPTTSPPPATSTPPPVSAPPPVTQSP--PPATPPPVSAP 76

Query: 245 TPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
            PAS P   P P+T    +PP  TP    P P     P +P  A     P+ +  AL  A
Sbjct: 77  PPASPPPATPPPATPPPATPPPATPPPATP-PPATPPPATPPPAVPPPAPLASPPALVPA 135

[34][TOP]
>UniRef100_A7J8U3 AGP6 (Fragment) n=1 Tax=Pinus squamata RepID=A7J8U3_9CONI
          Length = 227

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 60/150 (40%), Positives = 66/150 (44%), Gaps = 36/150 (24%)
 Frame = -3

Query: 422 APTAAPTKP------PTATPAPTAQPPAAA------------TPPTATPPTATPPAAVPA 297
           AP  APTKP      PT  P PT +PPA A            TPP A PP ATPP A P 
Sbjct: 78  APAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPP 137

Query: 296 PATPAPASSPATSPPAPTPAST---------------PSTAPTPSTAGSPPAPTPDSLGP 162
            A P PAS PA  PP   PA +               P+ APTPS   SPP+P   S GP
Sbjct: 138 VAVP-PASPPAIPPPVQAPAPSHHKHKKKKKKHHHHGPAPAPTPSALKSPPSPPLGSPGP 196

Query: 161 GPSG---ADTPPSPSAAFSYSKPIIAATAL 81
             S    A  P  PSA    S   +  T +
Sbjct: 197 STSADSFAPAPSQPSAGMKSSAASVCGTVV 226

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 47/130 (36%), Positives = 56/130 (43%), Gaps = 11/130 (8%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
           L  + LA AP A  T KPPT  PA     P         PPT TP A   AP  P P  +
Sbjct: 14  LLDTVLATAPAAPTTAKPPTTAPAAPVSTPK--------PPTTTPVAPAVAPTKPTPPVA 65

Query: 269 PATSPPAPTPASTPSTAPT----PSTA---GSPPAPTPDSLGPGPSGADTPP---SPSAA 120
           PA +P  P P   P+ APT    P TA     PP   P ++ P  +    PP    P A 
Sbjct: 66  PAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAV 125

Query: 119 FSYSKPIIAA 90
              + P +AA
Sbjct: 126 PPVATPPVAA 135

[35][TOP]
>UniRef100_Q8B9G6 Putative uncharacterized protein n=1 Tax=Rachiplusia ou MNPV
           RepID=Q8B9G6_NPVRO
          Length = 237

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 43/95 (45%), Positives = 50/95 (52%), Gaps = 1/95 (1%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSPPAPTPAST 231
           PT PPT TP+P   PP+   PPT  PPT TP P   P P TP P   P   PP PTP   
Sbjct: 51  PTPPPTPTPSP---PPSPTPPPTPIPPTPTPTPPPTPIPPTPTPTPPPTPIPPTPTPTPP 107

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           PS  P   T   PP+P P +  P P  +  PP+P+
Sbjct: 108 PSPIPPTPTPSPPPSPIPPTPTPSPPPSPIPPTPT 142

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 45/100 (45%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSPPAP 246
           +P  +PT PPT  P PT   P    PPT  PPT TP P   P P TP P   P+  PP P
Sbjct: 60  SPPPSPTPPPTPIP-PT---PTPTPPPTPIPPTPTPTPPPTPIPPTPTPTPPPSPIPPTP 115

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           TP+  PS  P   T   PP+P P +  P P     PPSPS
Sbjct: 116 TPSPPPSPIPPTPTPSPPPSPIPPTPTPSP-----PPSPS 150

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 50/124 (40%), Positives = 63/124 (50%), Gaps = 4/124 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATP-APTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           PT  PT PPT  P  PT  PP    PPT TP    PP+ +P   TP+P  SP   PP PT
Sbjct: 74  PTPTPTPPPTPIPPTPTPTPPPTPIPPTPTP--TPPPSPIPPTPTPSPPPSPI--PPTPT 129

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPG---PSGADTPPSPSAAFSYSKPIIAATALSAA 72
           P+  PS  P   T   PP+P+P  LG     PS  DT     A  ++ +P + AT  + A
Sbjct: 130 PSPPPSPIPPTPTPSPPPSPSP--LGEPMYYPSNIDT---NEALINFLRP-LCATDRTRA 183

Query: 71  LFAI 60
            +A+
Sbjct: 184 TYAV 187

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/114 (33%), Positives = 51/114 (44%)
 Frame = -3

Query: 467 IFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT 288
           I ++L L     + +     P  PP  +P     P    TP  + PP+ TPP   P P T
Sbjct: 17  IIILLTLKILDDIQELYPNPPIVPPPTSPPIVPLPTPPPTPTPSPPPSPTPPPT-PIPPT 75

Query: 287 PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P P   P   PP PTP   P+  P   T   PP+P P +  P P  +  PP+P+
Sbjct: 76  PTPTPPPTPIPPTPTPTPPPTPIPPTPTPTPPPSPIPPTPTPSPPPSPIPPTPT 129

[36][TOP]
>UniRef100_A9PGI2 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
           RepID=A9PGI2_POPTR
          Length = 196

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 50/110 (45%), Positives = 57/110 (51%), Gaps = 3/110 (2%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQ-PPAAATPPTATPPTATPPAAVPAPATPAPASSP-ATSPPA 249
           +P  A T PP + P P  Q PP A  PP + PP ATPP A P PATP PA+ P AT PPA
Sbjct: 41  SPPPATTPPPVSAPPPVTQSPPPATPPPVSAPPPATPPPATPPPATPPPATPPPATPPPA 100

Query: 248 -PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P PA+ P   P P+   +PPA  P      P      PSP A    S P
Sbjct: 101 TPPPATPPPAVPPPAPLAAPPALVPAPAPSKPKLKSPAPSPLALSPPSPP 150

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 56/115 (48%), Positives = 63/115 (54%), Gaps = 8/115 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAA----ATPPTATPPTATPPAAVPAPATPAPAS-SPATS 258
           AP      PP ATP P + PP A    ATPP ATPP ATPP A P PATP PA+  PA  
Sbjct: 53  APPPVTQSPPPATPPPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPAVP 112

Query: 257 PPAP---TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           PPAP    PA  P+ AP+     S PAP+P +L P PS     P+PS   S   P
Sbjct: 113 PPAPLAAPPALVPAPAPSKPKLKS-PAPSPLALSP-PSPPTGAPAPSLGASSPGP 165

 Score = 84.0 bits (206), Expect = 7e-15
 Identities = 52/109 (47%), Positives = 57/109 (52%), Gaps = 3/109 (2%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           AT     AP  A   PP ATP P   PP  ATPP ATPP ATPP A P PA P PA  P 
Sbjct: 64  ATPPPVSAPPPAT--PPPATPPPATPPP--ATPPPATPPPATPPPATPPPAVPPPA--PL 117

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPA---PTPDSLGPGPSGADTPPSPS 126
            +PPA  PA  PS     S A SP A   P+P +  P PS   + P P+
Sbjct: 118 AAPPALVPAPAPSKPKLKSPAPSPLALSPPSPPTGAPAPSLGASSPGPA 166

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 44/97 (45%), Positives = 50/97 (51%), Gaps = 6/97 (6%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAA---ATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           T  P  PP ATP P   PPA    ATPP ATPP A PP   PAP    PA  PA +P  P
Sbjct: 76  TPPPATPPPATPPPATPPPATPPPATPPPATPPPAVPP---PAPLAAPPALVPAPAPSKP 132

Query: 245 ---TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
              +PA +P     PS     PAP+  +  PGP+G D
Sbjct: 133 KLKSPAPSPLALSPPSPPTGAPAPSLGASSPGPAGTD 169

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 48/117 (41%), Positives = 57/117 (48%), Gaps = 16/117 (13%)
 Frame = -3

Query: 380 APTAQPPAAATPPTAT---PPTATPP--------AAVPAPATPAPASS--PATSPPA-PT 243
           AP   P AA  PPT T   PP  TPP           P PATP P S+  PAT PPA P 
Sbjct: 24  APATSPTAAPAPPTPTSSPPPATTPPPVSAPPPVTQSPPPATPPPVSAPPPATPPPATPP 83

Query: 242 PASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALS 78
           PA+ P   P P+T    +PP  TP    P P+    PP+   A + SKP + + A S
Sbjct: 84  PATPPPATPPPATPPPATPPPATPPPAVPPPAPLAAPPALVPAPAPSKPKLKSPAPS 140

[37][TOP]
>UniRef100_A9P8J4 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P8J4_POPTR
          Length = 196

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 50/110 (45%), Positives = 57/110 (51%), Gaps = 3/110 (2%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQ-PPAAATPPTATPPTATPPAAVPAPATPAPASSP-ATSPPA 249
           +P  A T PP + P P  Q PP A  PP + PP ATPP A P PATP PA+ P AT PPA
Sbjct: 41  SPPPATTPPPVSAPPPVTQSPPPATPPPVSAPPPATPPPATPPPATPPPATPPPATPPPA 100

Query: 248 -PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P PA+ P   P P+   +PPA  P      P      PSP A    S P
Sbjct: 101 TPPPATPPPAVPPPAPLAAPPALVPAPAPSKPKLKSPAPSPLALSPPSPP 150

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 56/115 (48%), Positives = 63/115 (54%), Gaps = 8/115 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAA----ATPPTATPPTATPPAAVPAPATPAPAS-SPATS 258
           AP      PP ATP P + PP A    ATPP ATPP ATPP A P PATP PA+  PA  
Sbjct: 53  APPPVTQSPPPATPPPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPAVP 112

Query: 257 PPAP---TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           PPAP    PA  P+ AP+     S PAP+P +L P PS     P+PS   S   P
Sbjct: 113 PPAPLAAPPALVPAPAPSKPKLKS-PAPSPLALSP-PSPPTGAPAPSLGASSPGP 165

 Score = 84.0 bits (206), Expect = 7e-15
 Identities = 52/109 (47%), Positives = 57/109 (52%), Gaps = 3/109 (2%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           AT     AP  A   PP ATP P   PP  ATPP ATPP ATPP A P PA P PA  P 
Sbjct: 64  ATPPPVSAPPPAT--PPPATPPPATPPP--ATPPPATPPPATPPPATPPPAVPPPA--PL 117

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPA---PTPDSLGPGPSGADTPPSPS 126
            +PPA  PA  PS     S A SP A   P+P +  P PS   + P P+
Sbjct: 118 AAPPALVPAPAPSKPKLKSPAPSPLALSPPSPPTGAPAPSLGASSPGPA 166

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 44/97 (45%), Positives = 50/97 (51%), Gaps = 6/97 (6%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAA---ATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           T  P  PP ATP P   PPA    ATPP ATPP A PP   PAP    PA  PA +P  P
Sbjct: 76  TPPPATPPPATPPPATPPPATPPPATPPPATPPPAVPP---PAPLAAPPALVPAPAPSKP 132

Query: 245 ---TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
              +PA +P     PS     PAP+  +  PGP+G D
Sbjct: 133 KLKSPAPSPLALSPPSPPTGAPAPSLGASSPGPAGTD 169

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 47/117 (40%), Positives = 58/117 (49%), Gaps = 23/117 (19%)
 Frame = -3

Query: 359 AAATPPTATP----PTATPPAAV--------------PAPATPAPASS--PATSPPA-PT 243
           A AT PTATP    PT++PP A               P PATP P S+  PAT PPA P 
Sbjct: 24  APATSPTATPAPPTPTSSPPPATTPPPVSAPPPVTQSPPPATPPPVSAPPPATPPPATPP 83

Query: 242 PASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALS 78
           PA+ P   P P+T    +PP  TP    P P+    PP+   A + SKP + + A S
Sbjct: 84  PATPPPATPPPATPPPATPPPATPPPAVPPPAPLAAPPALVPAPAPSKPKLKSPAPS 140

[38][TOP]
>UniRef100_A7J8U2 AGP6 (Fragment) n=1 Tax=Pinus gerardiana RepID=A7J8U2_PINGE
          Length = 227

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 60/148 (40%), Positives = 65/148 (43%), Gaps = 36/148 (24%)
 Frame = -3

Query: 422 APTAAPTKP------PTATPAPTAQPPAAA------------TPPTATPPTATPPAAVPA 297
           AP  APTKP      PT  P PT +PPA A            TPP A PP ATPP A P 
Sbjct: 78  APAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPP 137

Query: 296 PATPAPASSPATSPPAPTPAST---------------PSTAPTPSTAGSPPAPTPDSLGP 162
            A P PAS PA  PP   PA +               P+ APTPS   SPP+P   S GP
Sbjct: 138 VAVP-PASPPAIPPPVQAPAPSHHKHKKKKKKHHHHGPTPAPTPSALKSPPSPPLGSPGP 196

Query: 161 GPSG---ADTPPSPSAAFSYSKPIIAAT 87
             S    A  P  PSA    S   +  T
Sbjct: 197 STSADSFAPAPSQPSAGMKSSAASVCGT 224

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 47/130 (36%), Positives = 56/130 (43%), Gaps = 11/130 (8%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
           L  + LA AP A  T KPPT  PA     P         PPT TP A   AP  P P  +
Sbjct: 14  LVDTVLATAPAAPTTAKPPTTAPAAPVSTPK--------PPTTTPVAPAVAPTKPTPPVA 65

Query: 269 PATSPPAPTPASTPSTAPT----PSTA---GSPPAPTPDSLGPGPSGADTPP---SPSAA 120
           PA +P  P P   P+ APT    P TA     PP   P ++ P  +    PP    P A 
Sbjct: 66  PAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAV 125

Query: 119 FSYSKPIIAA 90
              + P +AA
Sbjct: 126 PPVATPPVAA 135

[39][TOP]
>UniRef100_A7J8Q9 AGP6 (Fragment) n=1 Tax=Pinus ayacahuite var. veitchii
           RepID=A7J8Q9_9CONI
          Length = 214

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 60/148 (40%), Positives = 65/148 (43%), Gaps = 36/148 (24%)
 Frame = -3

Query: 422 APTAAPTKP------PTATPAPTAQPPAAA------------TPPTATPPTATPPAAVPA 297
           AP  APTKP      PT  P PT +PPA A            TPP A PP ATPP A P 
Sbjct: 65  APAVAPTKPVPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPP 124

Query: 296 PATPAPASSPATSPPAPTPAST---------------PSTAPTPSTAGSPPAPTPDSLGP 162
            A P PAS PA  PP   PA +               P+ APTPS   SPP+P   S GP
Sbjct: 125 VAVP-PASPPAIPPPVQAPAPSHHKRKKKKKKHHHHGPAPAPTPSALKSPPSPPLGSPGP 183

Query: 161 GPSG---ADTPPSPSAAFSYSKPIIAAT 87
             S    A  P  PSA    S   +  T
Sbjct: 184 STSADSFAPAPSQPSAGMKSSAASVCGT 211

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 46/123 (37%), Positives = 55/123 (44%), Gaps = 4/123 (3%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
           L  + LA AP A  T KPPT  PA     P         PPT TP A   AP  PAP  +
Sbjct: 14  LVDTVLATAPAAPTTAKPPTTAPAAPVSTPK--------PPTTTPVAPAVAPTKPAPPVA 65

Query: 269 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP---SPSAAFSYSKPI 99
           PA +P  P P   P TAPT +    PP   P ++ P  +    PP    P A    + P 
Sbjct: 66  PAVAPTKPVP---PVTAPTKA---PPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPP 119

Query: 98  IAA 90
           +AA
Sbjct: 120 VAA 122

[40][TOP]
>UniRef100_B6U1N0 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6U1N0_MAIZE
          Length = 299

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 65/141 (46%), Positives = 71/141 (50%), Gaps = 16/141 (11%)
 Frame = -3

Query: 461 LILGLLATSCLAQ-APTAAPTKPPTATPA--PTAQPPAAATPPTATPP---TATPPAAVP 300
           L+L LL  SC AQ +P A P   P A PA  P   PPA   PP   PP   TATPP   P
Sbjct: 8   LVLVLLIASCTAQQSPPAQPPPTPNAPPANSPPQAPPAGNPPPAGNPPPAPTATPP---P 64

Query: 299 APATPAPA-----SSPATSPPAP-TPASTPSTAPTPSTAGSPPAPT--PDS--LGPGPSG 150
           AP TP PA      +P T PPAP TP   P+T P    A  PPAPT  P S    P P+ 
Sbjct: 65  APTTPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAP 124

Query: 149 ADTPPSPSAAFSYSKPIIAAT 87
           A  PPSP  A   + P   AT
Sbjct: 125 ATPPPSPPMAPPPATPPPPAT 145

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 49/121 (40%), Positives = 62/121 (51%), Gaps = 1/121 (0%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA-PASSPATSPPAP 246
           APT  P  P T  PAPT  PPA  TPP + P +  P    P P+ PA P  +PAT PP+P
Sbjct: 72  APTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPPSP 131

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAALF 66
             A  P+T P P+T   P APT     P PS        +AA + +  ++AA A + A  
Sbjct: 132 PMAPPPATPPPPATPPPPAAPT-----PAPSVGTVVAVEAAATAVAGAVMAAAATAVAAA 186

Query: 65  A 63
           A
Sbjct: 187 A 187

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 60/134 (44%), Positives = 73/134 (54%), Gaps = 13/134 (9%)
 Frame = -3

Query: 419 PTAAPTKPPTAT--PAPTAQPPAAATPPTA--TPPTA--TPPAAVPAPATPAPASSPATS 258
           P   P   PTAT  PAPT  PPA  TPP A  TPP A  TPP   PAP TP P S PA+ 
Sbjct: 50  PAGNPPPAPTATPPPAPTTPPPAPTTPPPAPTTPPPAPTTPP---PAPTTP-PPSPPASP 105

Query: 257 PPAP-TPASTPSTAPTPSTAGSPPAP---TPDSLGPGPSGADTPPSPSAAFSYSKPI--- 99
           PPAP TP  +P  +P P+ A  PP+P    P +  P P+    P +P+ A S    +   
Sbjct: 106 PPAPTTPPPSPPASPPPAPATPPPSPPMAPPPATPPPPATPPPPAAPTPAPSVGTVVAVE 165

Query: 98  IAATALSAALFAIA 57
            AATA++ A+ A A
Sbjct: 166 AAATAVAGAVMAAA 179

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 43/124 (34%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP--A 249
           APT  P  P T  P+P A PP A T P  +PP + PPA    P +P  A  PAT PP   
Sbjct: 86  APTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPATPPPSPPMAPPPATPPPPAT 145

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAAL 69
           P P + P+ AP+  T  +  A      G   + A T  + +A  + +  ++ A A + A 
Sbjct: 146 PPPPAAPTPAPSVGTVVAVEAAATAVAGAVMAAAATAVAAAATVAAAATVVVAAATAVAT 205

Query: 68  FAIA 57
            A A
Sbjct: 206 VAAA 209

[41][TOP]
>UniRef100_Q3EC03 Uncharacterized protein At2g14890.2 n=1 Tax=Arabidopsis thaliana
           RepID=Q3EC03_ARATH
          Length = 176

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 59/151 (39%), Positives = 71/151 (47%), Gaps = 28/151 (18%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT-- 318
           MA S A+ +  I+  L      QAPT+ PT  P A P PT  PPAA  PP + PP  T  
Sbjct: 1   MARSFAIAVICIV--LIAGVTGQAPTSPPTATP-APPTPTTPPPAATPPPVSAPPPVTTS 57

Query: 317 -------------------PPAAVPAPATPAPASSP----ATSPPA-PTPASTPSTAPTP 210
                              PP A P PATP P +SP    A+ PPA P P +TP  AP  
Sbjct: 58  PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLA 117

Query: 209 STAGSPPAPTPDSL--GPGPSGADTPPSPSA 123
           S     PAP P +    P PS + +PP PS+
Sbjct: 118 SPPAQVPAPAPTTKPDSPSPSPSSSPPLPSS 148

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 46/109 (42%), Positives = 58/109 (53%), Gaps = 10/109 (9%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPP---TATPPAAVPAPATPAPAS----SPA 264
           +P    T PP A P P    P  A+PP ATPP   +  PP A P PATP P +    +P 
Sbjct: 57  SPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPL 116

Query: 263 TSPPAPTPASTPST---APTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            SPPA  PA  P+T   +P+PS + SPP P+ D+ GP        PSP+
Sbjct: 117 ASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSISPAPSPT 165

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 45/104 (43%), Positives = 55/104 (52%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           A  P  A   PP A+P P A PP  ATPP A  P A+PPA VPAPA       P T P +
Sbjct: 85  ATPPPVASPPPPVASP-PPATPPPVATPPPA--PLASPPAQVPAPA-------PTTKPDS 134

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAF 117
           P+P  +PS++P P  +   P P+ DS+ P PS  D     S  F
Sbjct: 135 PSP--SPSSSP-PLPSSDAPGPSTDSISPAPSPTDVNDQVSNLF 175

[42][TOP]
>UniRef100_Q9C5S0 Classical arabinogalactan protein 9 n=1 Tax=Arabidopsis thaliana
           RepID=AGP9_ARATH
          Length = 191

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 59/151 (39%), Positives = 71/151 (47%), Gaps = 28/151 (18%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT-- 318
           MA S A+ +  I+  L      QAPT+ PT  P A P PT  PPAA  PP + PP  T  
Sbjct: 1   MARSFAIAVICIV--LIAGVTGQAPTSPPTATP-APPTPTTPPPAATPPPVSAPPPVTTS 57

Query: 317 -------------------PPAAVPAPATPAPASSP----ATSPPA-PTPASTPSTAPTP 210
                              PP A P PATP P +SP    A+ PPA P P +TP  AP  
Sbjct: 58  PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLA 117

Query: 209 STAGSPPAPTPDSL--GPGPSGADTPPSPSA 123
           S     PAP P +    P PS + +PP PS+
Sbjct: 118 SPPAQVPAPAPTTKPDSPSPSPSSSPPLPSS 148

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 46/109 (42%), Positives = 58/109 (53%), Gaps = 10/109 (9%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPP---TATPPAAVPAPATPAPAS----SPA 264
           +P    T PP A P P    P  A+PP ATPP   +  PP A P PATP P +    +P 
Sbjct: 57  SPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPL 116

Query: 263 TSPPAPTPASTPST---APTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            SPPA  PA  P+T   +P+PS + SPP P+ D+ GP        PSP+
Sbjct: 117 ASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSISPAPSPT 165

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 43/95 (45%), Positives = 53/95 (55%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           A  P  A   PP A+P P A PP  ATPP A  P A+PPA VPAPA       P T P +
Sbjct: 85  ATPPPVASPPPPVASP-PPATPPPVATPPPA--PLASPPAQVPAPA-------PTTKPDS 134

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
           P+P  +PS++P P  +   P P+ DS+ P PS  D
Sbjct: 135 PSP--SPSSSP-PLPSSDAPGPSTDSISPAPSPTD 166

[43][TOP]
>UniRef100_A8C635 Putative uncharacterized protein n=1 Tax=Antheraea pernyi
           nucleopolyhedrovirus RepID=A8C635_NPVAP
          Length = 204

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 49/114 (42%), Positives = 60/114 (52%), Gaps = 3/114 (2%)
 Frame = -3

Query: 467 IFLILGLLAT-SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA 291
           IFL+L LLAT  C+ + P   PT                 TPPT TPP + PP+  P P 
Sbjct: 14  IFLVLYLLATLKCVHKLPQPLPTP----------------TPPTPTPPPSPPPSPTPTPP 57

Query: 290 TPAPASSPATSPPAPTPASTP--STAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           TP P  SP  +PP PTP+ TP   T P PS   +PP+PTP +  P PS   +PP
Sbjct: 58  TPTPPPSPTPTPPTPTPSPTPPTPTPPPPSPTPTPPSPTPPTPTPPPSPPPSPP 111

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 30/70 (42%), Positives = 39/70 (55%), Gaps = 7/70 (10%)
 Frame = -3

Query: 314 PAAVPAPA------TPAPASSPATSPPAPTPASTPS-TAPTPSTAGSPPAPTPDSLGPGP 156
           P  +P P        P+P  SP  +PP PTP  +P+ T PTP+ + +PP PTP    P P
Sbjct: 31  PQPLPTPTPPTPTPPPSPPPSPTPTPPTPTPPPSPTPTPPTPTPSPTPPTPTP----PPP 86

Query: 155 SGADTPPSPS 126
           S   TPPSP+
Sbjct: 87  SPTPTPPSPT 96

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 34/73 (46%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA-PT 243
           P+  PT PPT TP+PT  PP    PP +  PT TPP+  P P TP P  SP  SPP  P 
Sbjct: 63  PSPTPT-PPTPTPSPT--PPTPTPPPPS--PTPTPPS--PTPPTPTPPPSPPPSPPPNPE 115

Query: 242 PASTPSTAPTPST 204
           P   P   P   T
Sbjct: 116 PLGEPMYFPADIT 128

[44][TOP]
>UniRef100_Q9XIV1 Arabinogalactan protein n=1 Tax=Cucumis sativus RepID=Q9XIV1_CUCSA
          Length = 243

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 50/114 (43%), Positives = 64/114 (56%), Gaps = 13/114 (11%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAA-------------TPPTATPPTATPPAAVPAPATPA 282
           +P AAP KP  ATPAP + PPA+A             TPPTA+ P ++PPAA   P++P 
Sbjct: 57  SPAAAPQKP--ATPAPVSTPPASAPPAVAPVASPPASTPPTASVPASSPPAASVPPSSPP 114

Query: 281 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            A+ PA+SPP P P S+P   P      SPP PTP    P P    +PP+P A+
Sbjct: 115 AATVPASSPPVPVPVSSP---PVSVPVSSPPVPTPTESPPAPE--SSPPAPVAS 163

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 55/154 (35%), Positives = 69/154 (44%), Gaps = 24/154 (15%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPP 312
           M   + + + LI  ++A     Q+P AAPT  P ATP   A  P  A  P +TP   +P 
Sbjct: 1   MGRQSVIALVLICAVVA-GVGGQSPAAAPTTTPAATPPVAATYPPPAASPVSTPTNPSPA 59

Query: 311 AAVPAPATPAPASS------PATSPPAPTPASTPSTAPTPST------------------ 204
           AA   PATPAP S+      PA +P A  PASTP TA  P++                  
Sbjct: 60  AAPQKPATPAPVSTPPASAPPAVAPVASPPASTPPTASVPASSPPAASVPPSSPPAATVP 119

Query: 203 AGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           A SPP P P S  P      +PP P+   S   P
Sbjct: 120 ASSPPVPVPVSSPPVSVPVSSPPVPTPTESPPAP 153

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 49/141 (34%), Positives = 65/141 (46%), Gaps = 34/141 (24%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA--PATPAPAS 273
           ++T   +  P  AP   P A+  PTA  PA++ P  + PP++ P A VPA  P  P P S
Sbjct: 71  VSTPPASAPPAVAPVASPPASTPPTASVPASSPPAASVPPSSPPAATVPASSPPVPVPVS 130

Query: 272 S-----PATSPPAPTPASTPST-----------------APTPSTAGS----PPAPTPDS 171
           S     P +SPP PTP  +P                   AP PS   S     PAP+P  
Sbjct: 131 SPPVSVPVSSPPVPTPTESPPAPESSPPAPVASPPVEVPAPAPSKKKSKKHRAPAPSPAL 190

Query: 170 LGP------GPSGADTPPSPS 126
           LGP       P+G++  P+PS
Sbjct: 191 LGPPAPPSEAPAGSEEGPAPS 211

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 35/89 (39%), Positives = 45/89 (50%), Gaps = 5/89 (5%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
           ++  P + P   P   P PT  PPA  + P A  P A+PP  VPAPA P+   S     P
Sbjct: 129 VSSPPVSVPVSSPPV-PTPTESPPAPESSPPA--PVASPPVEVPAPA-PSKKKSKKHRAP 184

Query: 251 APTPA-----STPSTAPTPSTAGSPPAPT 180
           AP+PA     + PS AP  S  G  P+P+
Sbjct: 185 APSPALLGPPAPPSEAPAGSEEGPAPSPS 213

[45][TOP]
>UniRef100_B9RJR0 Protein binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RJR0_RICCO
          Length = 143

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 58/142 (40%), Positives = 76/142 (53%), Gaps = 9/142 (6%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQAPTAAPT-----KPPTATPAPTAQPPAAA---TPPTA 336
           MA+ + V  F++L L A++ L QAP AAPT     K P+A PAP    PA A    PP +
Sbjct: 1   MAAKSTVT-FMLLALFASAALGQAPGAAPTVSPPSKSPSAAPAPKTATPAPAPTQAPPVS 59

Query: 335 TPPTATPPAAVPAPATPAPASSPATSPPAP-TPASTPSTAPTPSTAGSPPAPTPDSLGPG 159
            P  A P AA P PA  AP  +P +SPPAP  P+S PS A  P T   PPA TP      
Sbjct: 60  APSPAPPTAATPTPA-GAPTMTPTSSPPAPVAPSSVPSVALPPGTTVGPPAETP------ 112

Query: 158 PSGADTPPSPSAAFSYSKPIIA 93
              A+  P+  A F+ +  +++
Sbjct: 113 ---AENSPNNGAGFNRNGAVLS 131

[46][TOP]
>UniRef100_A7SXP8 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SXP8_NEMVE
          Length = 1190

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 62/129 (48%), Positives = 72/129 (55%), Gaps = 16/129 (12%)
 Frame = -3

Query: 422  APTAAPTKPPTA--TPAPTAQPPAAATP-PTATPPTATPPAAVPAPA---TPAPASSPAT 261
            APT APT  PT   TPAPT  P  A TP PT  P  A  PA  PAP    TPAPA +P  
Sbjct: 801  APTPAPTPAPTPAPTPAPTPAPTPAPTPAPTPAPTPAPTPAPTPAPTPEPTPAPAPAPTP 860

Query: 260  SP---------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSPSAAFSY 111
            SP         PAPTPA TP+  P P+ A + PAPTP +L P P+ A TP P+P+ A + 
Sbjct: 861  SPAPALTPALTPAPTPAPTPAPTPAPTPAPT-PAPTP-ALTPVPTPAPTPAPTPAPAPTP 918

Query: 110  SKPIIAATA 84
            +     ATA
Sbjct: 919  APTPAPATA 927

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 55/115 (47%), Positives = 67/115 (58%), Gaps = 13/115 (11%)
 Frame = -3

Query: 425  QAPTAAPTKPPTA--TPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSP 255
            QAPT +PT  PT   TP+PT  P  A TP PT  P  A  PA  PAP TPAP  +P  +P
Sbjct: 776  QAPTPSPTPAPTPAPTPSPTPAPTPAPTPAPTPAPTPAPTPAPTPAP-TPAPTPAPTPAP 834

Query: 254  -PAPTPASTPSTAPTPSTAGSP-PAPTP-----DSLGPGPSGADTP---PSPSAA 120
             PAPTPA TP+  P P+ A +P P P+P      +L P P+ A TP   P+P+ A
Sbjct: 835  TPAPTPAPTPAPTPEPTPAPAPAPTPSPAPALTPALTPAPTPAPTPAPTPAPTPA 889

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 56/117 (47%), Positives = 67/117 (57%), Gaps = 14/117 (11%)
 Frame = -3

Query: 422  APTAAPTKPPTA--TPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSP- 255
            APT APT  PT   TPAPT  P  A TP PT  P  A  PA  PAP TPAP  +P  +P 
Sbjct: 785  APTPAPTPSPTPAPTPAPTPAPTPAPTPAPTPAPTPAPTPAPTPAP-TPAPTPAPTPAPT 843

Query: 254  PAPTPASTPSTAPTPSTAGSP-------PAPTPDSLGPGPSGADTP---PSPSAAFS 114
            PAPTP  TP+ AP P+ + +P       PAPTP +  P P+ A TP   P+P+ A +
Sbjct: 844  PAPTPEPTPAPAPAPTPSPAPALTPALTPAPTP-APTPAPTPAPTPAPTPAPTPALT 899

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 51/102 (50%), Positives = 61/102 (59%), Gaps = 6/102 (5%)
 Frame = -3

Query: 413  AAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSP-PAPTP 240
            A PT  P  T APT  P  A TP PT +P  A  PA  PAP TPAP  +P  +P PAPTP
Sbjct: 766  ACPTPKPEPTQAPTPSPTPAPTPAPTPSPTPAPTPAPTPAP-TPAPTPAPTPAPTPAPTP 824

Query: 239  ASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTP-PSPS 126
            A TP+  P P+ A +P   PAPTP+   P P+ A TP P+P+
Sbjct: 825  APTPAPTPAPTPAPTPAPTPAPTPEPT-PAPAPAPTPSPAPA 865

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 45/93 (48%), Positives = 56/93 (60%), Gaps = 3/93 (3%)
 Frame = -3

Query: 389  ATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSP-PAPTPASTPSTAP 216
            A P P  +P  A TP PT  P  A  P+  PAP TPAP  +P  +P PAPTPA TP+  P
Sbjct: 766  ACPTPKPEPTQAPTPSPTPAPTPAPTPSPTPAP-TPAPTPAPTPAPTPAPTPAPTPAPTP 824

Query: 215  TPSTAGSPPAPTPDSLGPGPSGADTP-PSPSAA 120
             P+ A + PAPTP +  P P+ A TP P+P+ A
Sbjct: 825  APTPAPT-PAPTP-APTPAPTPAPTPEPTPAPA 855

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 41/87 (47%), Positives = 46/87 (52%), Gaps = 1/87 (1%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPP 252
            A  P+ AP   P  TPAPT  P  A TP PT  P  A  PA  P P TPAP        P
Sbjct: 857  APTPSPAPALTPALTPAPTPAPTPAPTPAPTPAPTPAPTPALTPVP-TPAPT-------P 908

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDS 171
            APTPA  P+ APTP+ A + P   PD+
Sbjct: 909  APTPAPAPTPAPTPAPATAEP-QNPDA 934

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 39/86 (45%), Positives = 46/86 (53%), Gaps = 3/86 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP---PA 249
            P  AP   P+  PA T   PA    PT  P  A  PA  PAP TPAP  +PA +P   PA
Sbjct: 852  PAPAPAPTPSPAPALT---PALTPAPTPAPTPAPTPAPTPAP-TPAP--TPALTPVPTPA 905

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDS 171
            PTPA TP+ APTP+   +P    P +
Sbjct: 906  PTPAPTPAPAPTPAPTPAPATAEPQN 931

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 35/65 (53%), Positives = 37/65 (56%), Gaps = 2/65 (3%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPA-TPAPASSP 267
            T  L  APT APT  P  TPAPT  P  A TP     PT  P PA  PAPA TPAP  +P
Sbjct: 867  TPALTPAPTPAPT--PAPTPAPTPAPTPAPTPALTPVPTPAPTPAPTPAPAPTPAPTPAP 924

Query: 266  ATSPP 252
            AT+ P
Sbjct: 925  ATAEP 929

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 38/84 (45%), Positives = 48/84 (57%), Gaps = 10/84 (11%)
 Frame = -3

Query: 341  TATPPTATP-PAAVPAPATPAPASSPATSP---PAPTPASTPSTAPTPSTAGSP---PAP 183
            T   PT  P P   P P+ P PA +PA +P   PAPTPA TP+  P P+ A +P   PAP
Sbjct: 764  TIACPTPKPEPTQAPTPS-PTPAPTPAPTPSPTPAPTPAPTPAPTPAPTPAPTPAPTPAP 822

Query: 182  TPDSLGPGPSGADTP---PSPSAA 120
            TP +  P P+ A TP   P+P+ A
Sbjct: 823  TP-APTPAPTPAPTPAPTPAPTPA 845

[47][TOP]
>UniRef100_B4FYJ4 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4FYJ4_MAIZE
          Length = 397

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 58/133 (43%), Positives = 66/133 (49%), Gaps = 22/133 (16%)
 Frame = -3

Query: 452 GLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV--PAPATPAP 279
           G  A    A +P  A T PP ++P   A PP +ATPP   PP   PP AV  PAPATPAP
Sbjct: 207 GAAAPPTTAASPQLAATLPPVSSPPLAATPPVSATPPATLPPATQPPVAVAAPAPATPAP 266

Query: 278 -ASSPATSPPAPTPAST--PSTAPTPSTAG----------SPPAPTPDSLGPGPSGADTP 138
            AS P   PPA    +T  P+ APTP  A           + PAP P S  P PS A TP
Sbjct: 267 VASPPVAMPPAALAPATLPPAMAPTPLLAAPVMAPIAPPVTAPAPAPVSPAPSPSVAPTP 326

Query: 137 -------PSPSAA 120
                  PSP+ A
Sbjct: 327 SPTEAPTPSPTEA 339

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 54/141 (38%), Positives = 70/141 (49%), Gaps = 17/141 (12%)
 Frame = -3

Query: 449 LLATSCLAQAPTAA---PTKPPTATPAPTAQPPA-AATPPTATPPTATPPAAVPAPATP- 285
           L AT  ++  P A     T+PP A  AP    PA  A+PP A PP A  PA +P    P 
Sbjct: 232 LAATPPVSATPPATLPPATQPPVAVAAPAPATPAPVASPPVAMPPAALAPATLPPAMAPT 291

Query: 284 --------APASSPATSP-PAP-TPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP 138
                   AP + P T+P PAP +PA +PS APTPS   +P P+PT     P PS    P
Sbjct: 292 PLLAAPVMAPIAPPVTAPAPAPVSPAPSPSVAPTPSPTEAPTPSPTE---APTPSPTQAP 348

Query: 137 P-SPSAAFSYSKPIIAATALS 78
             +P ++ S S  +    AL+
Sbjct: 349 TLAPLSSVSVSPSLAPGPALA 369

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 52/147 (35%), Positives = 62/147 (42%), Gaps = 29/147 (19%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAA--------ATPPTATPPTA----------T 318
           AT   A  P  A   P  ATPAP A PP A        AT P A  PT            
Sbjct: 244 ATLPPATQPPVAVAAPAPATPAPVASPPVAMPPAALAPATLPPAMAPTPLLAAPVMAPIA 303

Query: 317 PPAAVPAPATPAPASSPATSP---------PAPTPASTPSTAPTPSTAGSPPAPTPDSLG 165
           PP   PAPA  +PA SP+ +P         P+PT A TPS    P+ A         SL 
Sbjct: 304 PPVTAPAPAPVSPAPSPSVAPTPSPTEAPTPSPTEAPTPSPTQAPTLAPLSSVSVSPSLA 363

Query: 164 PGPSGA--DTPPSPSAAFSYSKPIIAA 90
           PGP+ A  D   +PS+       ++AA
Sbjct: 364 PGPALAQEDESAAPSSRTGVVAALVAA 390

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 48/161 (29%), Positives = 69/161 (42%), Gaps = 32/161 (19%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTAAPTK-----------------PPTATPAP----------TAQP 363
           L+L +L  SC+AQ+P ++P+                  P TA  AP           A  
Sbjct: 8   LLLSVLIVSCVAQSPASSPSASNAPPVSASAPRGSVAPPTTAVSAPQGSVAAPTTAAASA 67

Query: 362 PAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPS-TAPTPSTAGSPPA 186
           P A+  P  T   + P A+V AP T A A   + +PP  T AS P+ +   P  +  PPA
Sbjct: 68  PQASVAPPMTTAASAPQASVAAPTTAASAPQASAAPPTTTAASAPTVSVAAPQASAQPPA 127

Query: 185 P----TPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSA 75
           P     P +    P+ A + P  SAA   +  +   T+ SA
Sbjct: 128 PVFASAPQASAAAPTKAASAPQVSAAAPATAALPPTTSASA 168

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 49/150 (32%), Positives = 67/150 (44%), Gaps = 5/150 (3%)
 Frame = -3

Query: 497 PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT 318
           P  A+++A Q  +   +   +   QA  AAPT   +A P  +A PP        T   A 
Sbjct: 60  PTTAAASAPQASVAPPMTTAASAPQASVAAPTTAASA-PQASAAPPTTTAASAPTVSVAA 118

Query: 317 PPAAVPAPATPAPASSPATSPPAPTPASTPS--TAPTPSTAGSPP---APTPDSLGPGPS 153
           P A+   PA P  AS+P  S  APT A++    +A  P+TA  PP   A  P +    P+
Sbjct: 119 PQASAQPPA-PVFASAPQASAAAPTKAASAPQVSAAAPATAALPPTTSASAPQASAAAPT 177

Query: 152 GADTPPSPSAAFSYSKPIIAATALSAALFA 63
            A  PP   AA     P  +A A  A+  A
Sbjct: 178 KAALPPQAFAA----APTTSAAAPQASAAA 203

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 47/158 (29%), Positives = 67/158 (42%), Gaps = 18/158 (11%)
 Frame = -3

Query: 506 SLHPKMASSAAVQIFLILGLLATSCLAQAPTAAPT----KPPT---ATPAPTAQPPAAAT 348
           S+ P M ++A+     +      +   QA  A PT      PT   A P  +AQPPA   
Sbjct: 71  SVAPPMTTAASAPQASVAAPTTAASAPQASAAPPTTTAASAPTVSVAAPQASAQPPAPVF 130

Query: 347 PPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPP-----AP 183
                   A P  A  AP   A A + A  PP  + ++  ++A  P+ A  PP     AP
Sbjct: 131 ASAPQASAAAPTKAASAPQVSAAAPATAALPPTTSASAPQASAAAPTKAALPPQAFAAAP 190

Query: 182 TPDSLGP------GPSGADTPPSPSAAFSYSKPIIAAT 87
           T  +  P       P+GA  PP+ +A+     P +AAT
Sbjct: 191 TTSAAAPQASAAAPPTGAAAPPTTAAS-----PQLAAT 223

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 42/124 (33%), Positives = 56/124 (45%), Gaps = 12/124 (9%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQ---PPAAATPPTATPPTATPPAAVP---APATPAPASSP 267
           A AP  A   P T+  AP A    P  AA PP A     T  AA P   A A P  A++P
Sbjct: 152 AAAPATAALPPTTSASAPQASAAAPTKAALPPQAFAAAPTTSAAAPQASAAAPPTGAAAP 211

Query: 266 ATSPPAPT------PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSK 105
            T+  +P       P S+P  A TP  + +PPA  P +  P  + A   P+P+     + 
Sbjct: 212 PTTAASPQLAATLPPVSSPPLAATPPVSATPPATLPPATQPPVAVA--APAPATPAPVAS 269

Query: 104 PIIA 93
           P +A
Sbjct: 270 PPVA 273

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 43/126 (34%), Positives = 55/126 (43%), Gaps = 12/126 (9%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPT---------ATPPT--ATPPAA-VPAPATPA 282
           QA  AAPTK  +A     A P  AA PPT         A  PT  A PP A   AP T A
Sbjct: 135 QASAAAPTKAASAPQVSAAAPATAALPPTTSASAPQASAAAPTKAALPPQAFAAAPTTSA 194

Query: 281 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            A   + + P    A+ P+TA +P  A + P  +   L   P  + TPP+     +    
Sbjct: 195 AAPQASAAAPPTGAAAPPTTAASPQLAATLPPVSSPPLAATPPVSATPPATLPPATQPPV 254

Query: 101 IIAATA 84
            +AA A
Sbjct: 255 AVAAPA 260

[48][TOP]
>UniRef100_UPI0001925A99 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra
           magnipapillata RepID=UPI0001925A99
          Length = 373

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 48/109 (44%), Positives = 56/109 (51%), Gaps = 1/109 (0%)
 Frame = -3

Query: 443 ATSCLAQAPTAAP-TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP 267
           A S  A +P A P   PP A P PT   P A  PP A PP   PPAA P+PA P   ++P
Sbjct: 203 APSPAAPSPAAPPPAAPPPAAPKPTPPSPVALIPPAAPPPVTPPPAAPPSPAVPPTPAAP 262

Query: 266 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            T    PTPA+ P+ A  P+ A  PP   P    P P+   TPP P AA
Sbjct: 263 PTPAAPPTPAAPPTPAAPPTPAAPPPPAKPPPAKPPPA---TPPIPPAA 308

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 58/113 (51%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTK---PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS 273
           AT   A  P AAP     PP AT  P A  PAA  PP A PPT TPPAA P PA P+PA+
Sbjct: 107 ATLPPAIPPPAAPCSLAAPPPATLPPAAPSPAA--PPPAPPPTVTPPAASP-PAAPSPAA 163

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG--PSGADTPPSPSAA 120
            P   P AP+PA+ P  AP+P TA SP AP P +  P   PS A +P +PS A
Sbjct: 164 PP---PAAPSPAAPPLAAPSP-TAPSPAAPLPAAPSPAAPPSAAPSPAAPSPA 212

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 61/128 (47%), Positives = 70/128 (54%), Gaps = 14/128 (10%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA----AVPAPATPAPA 276
           A  C   AP  A T PP A P+P A PPA   PPT TPP A+PPA    A P PA P+PA
Sbjct: 117 AAPCSLAAPPPA-TLPPAA-PSPAAPPPAP--PPTVTPPAASPPAAPSPAAPPPAAPSPA 172

Query: 275 SSP--ATSPPAPTPA----STPSTAPTPSTAGSPPAPTPDSLGPG--PSGA--DTPPSPS 126
           + P  A SP AP+PA    + PS A  PS A SP AP+P +  P   P  A   TPPSP 
Sbjct: 173 APPLAAPSPTAPSPAAPLPAAPSPAAPPSAAPSPAAPSPAAPPPAAPPPAAPKPTPPSPV 232

Query: 125 AAFSYSKP 102
           A    + P
Sbjct: 233 ALIPPAAP 240

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 63/144 (43%), Positives = 77/144 (53%), Gaps = 15/144 (10%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTAAPTKPPTATPAPTAQ-----PPAAATPPTATPPTATPPAAVPA 297
           L+L L      A+ P AA T PPTA P+P A      PP+ A PP   PP AT P A+P 
Sbjct: 57  LVLSLPVVPPPAKPPPAALT-PPTAPPSPAAPPSPAVPPSPAAPPLIEPPPATLPPAIPP 115

Query: 296 PATPA--PASSPATSPP-APTPASTPSTAP---TPSTAGSPPAPTPDSLGP-GPSGADTP 138
           PA P    A  PAT PP AP+PA+ P   P   TP  A  P AP+P +  P  PS A  P
Sbjct: 116 PAAPCSLAAPPPATLPPAAPSPAAPPPAPPPTVTPPAASPPAAPSPAAPPPAAPSPAAPP 175

Query: 137 ---PSPSAAFSYSKPIIAATALSA 75
              PSP+A  S + P+ AA + +A
Sbjct: 176 LAAPSPTAP-SPAAPLPAAPSPAA 198

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 48/131 (36%), Positives = 60/131 (45%), Gaps = 5/131 (3%)
 Frame = -3

Query: 497 PKMASSAAVQIFLILGLLATSCLAQAPTA-APTKPPTATPAPTAQ----PPAAATPPTAT 333
           P  A S A          A S  A  P A +P  PP+A P+P A     PP AA PP A 
Sbjct: 165 PPAAPSPAAPPLAAPSPTAPSPAAPLPAAPSPAAPPSAAPSPAAPSPAAPPPAAPPPAAP 224

Query: 332 PPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 153
            PT   P A+  PA P P + P  +PP+P    TP+  PTP+   +P AP   +  P P+
Sbjct: 225 KPTPPSPVALIPPAAPPPVTPPPAAPPSPAVPPTPAAPPTPAAPPTPAAPPTPAAPPTPA 284

Query: 152 GADTPPSPSAA 120
               P  P  A
Sbjct: 285 APPPPAKPPPA 295

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 49/124 (39%), Positives = 61/124 (49%), Gaps = 15/124 (12%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAA---ATPPTATPPTATPPAAVPAPATPAPAS----- 273
           A +P A P  PP     P A PPAA   A PP A P  A PP A P+P  P+PA+     
Sbjct: 134 APSPAAPPPAPPPTVTPPAASPPAAPSPAAPPPAAPSPAAPPLAAPSPTAPSPAAPLPAA 193

Query: 272 -------SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
                  S A SP AP+PA+ P  AP P+ A  P  P+P +L P  +     P P+A  S
Sbjct: 194 PSPAAPPSAAPSPAAPSPAAPPPAAPPPA-APKPTPPSPVALIPPAAPPPVTPPPAAPPS 252

Query: 113 YSKP 102
            + P
Sbjct: 253 PAVP 256

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 47/117 (40%), Positives = 60/117 (51%), Gaps = 12/117 (10%)
 Frame = -3

Query: 443 ATSCLAQAPTA-APTKPPTATPAPTAQPPAA---ATPPTATPPTATPPAAVPAPATPAPA 276
           A S  A  P A +P  PP A P+PTA  PAA   A P  A PP+A P  A P+PA P PA
Sbjct: 158 APSPAAPPPAAPSPAAPPLAAPSPTAPSPAAPLPAAPSPAAPPSAAPSPAAPSPAAPPPA 217

Query: 275 ----SSPATSPPAPT----PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
               ++P  +PP+P     PA+ P   P P+   SP  P   +  P P+   TP +P
Sbjct: 218 APPPAAPKPTPPSPVALIPPAAPPPVTPPPAAPPSPAVPPTPAAPPTPAAPPTPAAP 274

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 66/176 (37%), Positives = 78/176 (44%), Gaps = 33/176 (18%)
 Frame = -3

Query: 503 LHPKMASSAAVQIFLILGLLATSCLAQAPTAAP---TKPPTAT------------PAPTA 369
           L P     A +   +   L A S LA  P AAP     PP  T            P P  
Sbjct: 10  LPPAAPPPATLPSSVAPSLPAASPLATPPPAAPPPPAAPPPVTLPSPLVLSLPVVPPPAK 69

Query: 368 QPPAAATPPTATPPTATPP--AAVPAPATPA-----PASSPATSPP--------APTPAS 234
            PPAA TPPTA P  A PP  A  P+PA P      PA+ P   PP        AP PA+
Sbjct: 70  PPPAALTPPTAPPSPAAPPSPAVPPSPAAPPLIEPPPATLPPAIPPPAAPCSLAAPPPAT 129

Query: 233 TPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPPS-PSAAFSYSKPIIAATALSA 75
            P  AP+P  A  PPAP P    P   P  A +P + P AA S + P +AA + +A
Sbjct: 130 LPPAAPSP--AAPPPAPPPTVTPPAASPPAAPSPAAPPPAAPSPAAPPLAAPSPTA 183

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 50/111 (45%), Positives = 60/111 (54%), Gaps = 9/111 (8%)
 Frame = -3

Query: 428 AQAPTAAPTK--PPTATPAPTAQPPAAATPPTATPPTATPPAA----VPAPATPAPAS-S 270
           A +P AAP+   PP A P+P A PP AA  PTA  P A  PAA     P  A P+PA+ S
Sbjct: 152 AASPPAAPSPAAPPPAAPSPAA-PPLAAPSPTAPSPAAPLPAAPSPAAPPSAAPSPAAPS 210

Query: 269 PATSPP-APTPASTPSTAPTPSTAGSPPAPTPDSLGP-GPSGADTPPSPSA 123
           PA  PP AP PA+   T P+P     P AP P +  P  P     PP+P+A
Sbjct: 211 PAAPPPAAPPPAAPKPTPPSPVALIPPAAPPPVTPPPAAPPSPAVPPTPAA 261

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 53/143 (37%), Positives = 64/143 (44%), Gaps = 7/143 (4%)
 Frame = -3

Query: 437 SCLAQAPTAAP---TKPPTATPAPTAQPPAAATPPTATPP-TATP--PAAVPAPATPAPA 276
           S +A  P AAP   T PP A P+P   P  AA P  A PP  A P  PAA P PA P P 
Sbjct: 230 SPVALIPPAAPPPVTPPPAAPPSPAVPPTPAAPPTPAAPPTPAAPPTPAAPPTPAAPPP- 288

Query: 275 SSPATSPPAPTPASTPSTAP-TPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
             PA  PPA  P +TP   P  P +  +PP  TP    P      TPP    A     PI
Sbjct: 289 --PAKPPPAKPPPATPPIPPAAPPSPVAPPLETPFPAIPPRLPEATPPLMPLASPVPAPI 346

Query: 98  IAATALSAALFAIAF*DLSMWRL 30
               A+  A       D +++++
Sbjct: 347 PEPIAIIPAFSTAVLTDWTVFKI 369

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 47/126 (37%), Positives = 56/126 (44%), Gaps = 7/126 (5%)
 Frame = -3

Query: 428 AQAPTAA--PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA--- 264
           A+ P A   P  PP AT   +  P   A  P ATPP    PAA P PA P P + P+   
Sbjct: 3   AELPLAILPPAAPPPATLPSSVAPSLPAASPLATPP----PAAPPPPAAPPPVTLPSPLV 58

Query: 263 -TSPPAPTPASTPSTAPTPSTA-GSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAA 90
            + P  P PA  P  A TP TA  SP AP   ++ P P+       P A    + P  AA
Sbjct: 59  LSLPVVPPPAKPPPAALTPPTAPPSPAAPPSPAVPPSPAAPPLIEPPPATLPPAIPPPAA 118

Query: 89  TALSAA 72
               AA
Sbjct: 119 PCSLAA 124

[49][TOP]
>UniRef100_UPI0001925155 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra
           magnipapillata RepID=UPI0001925155
          Length = 781

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 50/125 (40%), Positives = 67/125 (53%), Gaps = 2/125 (1%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTK--PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP 267
           +S +A  PT  P    PP   P+P   PPAA   P A+PP A PPAA  +PA P PA+  
Sbjct: 134 SSPVAPPPTEPPLPVLPPETPPSPAVLPPAAPISPAASPPAAPPPAAPASPAAPPPAAPA 193

Query: 266 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAAT 87
           +++ P P   ++P+ AP P+  GSP AP P +  P    +   P P+A  S + P  AA 
Sbjct: 194 SSAAPPPAAPASPA-APPPAAPGSPAAPPPAAPPPAAPASPAAPPPAAPASPAAPPPAAP 252

Query: 86  ALSAA 72
           A  AA
Sbjct: 253 ASPAA 257

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 58/154 (37%), Positives = 74/154 (48%), Gaps = 7/154 (4%)
 Frame = -3

Query: 497 PKMASSAAVQIFLILGLLATSCLAQAPTAAPTK---PPTATPAPTAQPPAA----ATPPT 339
           P +   AA++   +      S +A  P AAP+    PP ATP     PP A    A+PP 
Sbjct: 545 PAVPPPAALRPASLPPAAPASPVAPIPPAAPSLLVVPPPATPPSLVAPPPAAPMLASPPP 604

Query: 338 ATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG 159
           A+P   TPP A P+PA P PA+ P  SPP   PA+TPS  P    A  PPA TP    P 
Sbjct: 605 ASPVALTPPTAPPSPAAPPPAAPPTASPP---PAATPSPVPLIPLATLPPA-TPPPAEPA 660

Query: 158 PSGADTPPSPSAAFSYSKPIIAATALSAALFAIA 57
            +    P SP A    + P  A+  L+A    +A
Sbjct: 661 SAPPAAPASPVALIPPATPPPASPPLAAPASPVA 694

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 58/141 (41%), Positives = 70/141 (49%), Gaps = 11/141 (7%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTK--PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAP-AS 273
           A   LA  P A+P    PPTA P+P A PPAA  PPTA+PP    PAA P+P    P A+
Sbjct: 595 AAPMLASPPPASPVALTPPTAPPSPAAPPPAA--PPTASPP----PAATPSPVPLIPLAT 648

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD--------TPPSPSAAF 117
            P  +PP   PAS P  AP    A  PPA  P +  P  + A          P SP+A  
Sbjct: 649 LPPATPPPAEPASAPPAAPASPVALIPPATPPPASPPLAAPASPVALAPPAAPASPAAPI 708

Query: 116 SYSKPIIAATALSAALFAIAF 54
           S   P+ AA  L+A    +AF
Sbjct: 709 SPLTPLPAAPPLAAPPSPVAF 729

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 51/116 (43%), Positives = 61/116 (52%), Gaps = 5/116 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPA--SSPATSPP 252
           A  A+P  PP A PA +A PP AA    A PP A P + A P PA P PA  +SPA  PP
Sbjct: 179 AAPASPAAPPPAAPASSAAPPPAAPASPAAPPPAAPGSPAAPPPAAPPPAAPASPAAPPP 238

Query: 251 A--PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAA 90
           A   +PA+ P  AP    A  P AP   ++ P P+    PPSP A  S + P  AA
Sbjct: 239 AAPASPAAPPPAAPASPAAPPPAAPASPAVLPPPA---APPSPVALISPAAPSPAA 291

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 58/151 (38%), Positives = 68/151 (45%), Gaps = 27/151 (17%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTA-------QPPAAATPPTATPPT-----ATPPAAVP 300
           A   LA  P AAP  PP ATP+P A        PP A + P A PPT       PP   P
Sbjct: 98  AAPSLAATPPAAP--PPAATPSPVALIPLVVPPPPVAPSSPVAPPPTEPPLPVLPPETPP 155

Query: 299 APATPAPAS--SPATSPPAPTPASTP-------------STAPTPSTAGSPPAPTPDSLG 165
           +PA   PA+  SPA SPPA  P + P             S AP P+   SP AP P + G
Sbjct: 156 SPAVLPPAAPISPAASPPAAPPPAAPASPAAPPPAAPASSAAPPPAAPASPAAPPPAAPG 215

Query: 164 PGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
              +     P P+A  S + P  AA A  AA
Sbjct: 216 SPAAPPPAAPPPAAPASPAAPPPAAPASPAA 246

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 56/144 (38%), Positives = 69/144 (47%), Gaps = 19/144 (13%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKP----PTATPAPTAQPPAAATPPTATPPTAT---PPAAVPAPATP 285
           A S  A  P A P  P    P A P+  A PP+   PP A PP+     PPAA+  PA P
Sbjct: 410 AASTPASPPPAVPASPVALIPPAAPSLPAAPPSPVAPPPAAPPSPVALIPPAALSLPAAP 469

Query: 284 APASSPATSPP--APTPASTPSTAP----TPSTAGSPPAPTPDSLGPG--PSGADTPP-- 135
            PA+SP+ +PP  AP+P   P  +P     P T+  P AP P S  P   P+ A  PP  
Sbjct: 470 LPAASPSAAPPIAAPSPVDPPPPSPPLAAPPLTSPPPAAPIPLSTPPPVVPTPASPPPAV 529

Query: 134 --SPSAAFSYSKPIIAATALSAAL 69
             SP A    + P + A    AAL
Sbjct: 530 PASPVALNPPAAPSLPAVPPPAAL 553

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 50/123 (40%), Positives = 61/123 (49%), Gaps = 4/123 (3%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA--SSPATSPP 252
           + P +    PP A  +P A PPAA  P     P A PPAA  + A P PA  +SPA  PP
Sbjct: 152 ETPPSPAVLPPAAPISPAASPPAAPPPAAPASPAAPPPAAPASSAAPPPAAPASPAAPPP 211

Query: 251 AP--TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALS 78
           A   +PA+ P  AP P+   SP AP P      P+    PP P+A  S + P  AA A  
Sbjct: 212 AAPGSPAAPPPAAPPPAAPASPAAPPP----AAPASPAAPP-PAAPASPAAPPPAAPASP 266

Query: 77  AAL 69
           A L
Sbjct: 267 AVL 269

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 47/113 (41%), Positives = 59/113 (52%), Gaps = 2/113 (1%)
 Frame = -3

Query: 410 APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAST 231
           +P  P  A P P + PPAA   P A  P A PP AVP+PA+P PA++PA SP A  P + 
Sbjct: 283 SPAAPSPAAPLPASPPPAALASPVAPIPPAAPPLAVPSPASP-PAAAPA-SPVALIPPAA 340

Query: 230 PSTAPTPSTAGSPP--APTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALS 78
           PS    P +  +PP  AP P +  P       P SP A  S + P + AT  S
Sbjct: 341 PSLPAAPPSPVAPPPVAPPPAASIPASPPPAAPASPVALISPAAPSLPATPFS 393

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 54/134 (40%), Positives = 63/134 (47%), Gaps = 12/134 (8%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTA-TPPTATPPAAVPAPATPAPA--SSPATSPP 252
           A  A+P  PP A P   A PP AA PP A   P A PPAA  +PA P PA  +SPA  PP
Sbjct: 201 AAPASPAAPPPAAPGSPAAPPPAAPPPAAPASPAAPPPAAPASPAAPPPAAPASPAAPPP 260

Query: 251 A--------PTPASTPSTAPTPSTAG-SPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
           A        P PA+ PS     S A  SP AP P S  P    +   P P AA   + P 
Sbjct: 261 AAPASPAVLPPPAAPPSPVALISPAAPSPAAPLPASPPPAALASPVAPIPPAAPPLAVPS 320

Query: 98  IAATALSAALFAIA 57
            A+   +A    +A
Sbjct: 321 PASPPAAAPASPVA 334

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 53/116 (45%), Positives = 59/116 (50%), Gaps = 7/116 (6%)
 Frame = -3

Query: 428 AQAPTAAPTK---PPTATPAPTAQPPAAATPPTATPPTATPPAAVPA-PATPAPASSPAT 261
           A  P AAP     PP A PA  A PP AA    A PP A PP A PA PA P PA +PA 
Sbjct: 185 AAPPPAAPASSAAPPPAAPASPAAPPPAAPGSPAAPPPAAPPPAAPASPAAPPPA-APA- 242

Query: 260 SPPAPTPASTPS-TAPTPSTAGSPPAPTPDSLGPGPSGADTP--PSPSAAFSYSKP 102
           SP AP PA+  S  AP P+   SP    P +  P P    +P  PSP+A    S P
Sbjct: 243 SPAAPPPAAPASPAAPPPAAPASPAVLPPPAAPPSPVALISPAAPSPAAPLPASPP 298

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 51/122 (41%), Positives = 62/122 (50%), Gaps = 5/122 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTATPA-PTAQPPAAATPPTATPPTA-TPPAAVPAPATPAPASSPATSPPA 249
           A  A+P  PP A PA P A PPAA   P A PP A   PA +P PA P P+     SP A
Sbjct: 228 AAPASPAAPPPAAPASPAAPPPAAPASPAAPPPAAPASPAVLPPPAAP-PSPVALISPAA 286

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPII---AATALS 78
           P+PA+    +P P+   SP AP P +    P    +P SP AA   S   +   AA +L 
Sbjct: 287 PSPAAPLPASPPPAALASPVAPIPPA--APPLAVPSPASPPAAAPASPVALIPPAAPSLP 344

Query: 77  AA 72
           AA
Sbjct: 345 AA 346

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 47/118 (39%), Positives = 56/118 (47%), Gaps = 15/118 (12%)
 Frame = -3

Query: 428  AQAPTAAPTKP----PTATPAPTAQPPAAATPPTATPPTATP--PAAVPAPATPAPASSP 267
            A AP AAP  P    P ATP P + P AA   P A  P A P  PAA  +P TP PA+ P
Sbjct: 660  ASAPPAAPASPVALIPPATPPPASPPLAAPASPVALAPPAAPASPAAPISPLTPLPAAPP 719

Query: 266  ATSPPAPT---------PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
              +PP+P          PA  P  AP P+T  S  AP+  +  P  +     P P AA
Sbjct: 720  LAAPPSPVAFIPPAALPPAILPPAAPPPATLPSSVAPSLAAASPLAAPPPAAPPPPAA 777

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 48/120 (40%), Positives = 58/120 (48%), Gaps = 7/120 (5%)
 Frame = -3

Query: 410 APTKPPTATPA-PTAQ-PPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPA 237
           +P  PP A PA P A  PPAA + P A P    PP   P PA   PAS P  +P +P   
Sbjct: 320 SPASPPAAAPASPVALIPPAAPSLPAAPPSPVAPPPVAPPPAASIPASPPPAAPASPVAL 379

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPPSPSAAFSYSKPII---AATALSAA 72
            +P+    P+T  SP AP P +  P   P  A TP SP  A   S   +   AA +L AA
Sbjct: 380 ISPAAPSLPATPFSPVAPPPVAPPPTATPPAASTPASPPPAVPASPVALIPPAAPSLPAA 439

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 50/127 (39%), Positives = 61/127 (48%), Gaps = 24/127 (18%)
 Frame = -3

Query: 410 APTKPPTATPAPTAQPPAAATPPTATPPTATP--------------PAAVPAPATPAPAS 273
           +P  PP   P PTA PPAA+TP  A+PP A P              PAA P+P  P PA+
Sbjct: 393 SPVAPPPVAPPPTATPPAASTP--ASPPPAVPASPVALIPPAAPSLPAAPPSPVAPPPAA 450

Query: 272 SPA----------TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
            P+          + P AP PA++PS AP P  A SP  P P S  P  +   T P P+A
Sbjct: 451 PPSPVALIPPAALSLPAAPLPAASPSAAP-PIAAPSPVDPPPPS-PPLAAPPLTSPPPAA 508

Query: 122 AFSYSKP 102
               S P
Sbjct: 509 PIPLSTP 515

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 61/148 (41%), Positives = 68/148 (45%), Gaps = 22/148 (14%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPTKP----PTATPAPTAQPPA-AATPPTATPPTATPPAAVP--APAT 288
           LA    A  P AAP  P    P A P+  A PP+  A PP A PP A+ PA+ P  APA+
Sbjct: 316 LAVPSPASPPAAAPASPVALIPPAAPSLPAAPPSPVAPPPVAPPPAASIPASPPPAAPAS 375

Query: 287 PAPASSPAT--------SPPAPTPASTPSTA--PTPSTAGSPPAPTPDS---LGP--GPS 153
           P    SPA         SP AP P + P TA  P  ST  SPP   P S   L P   PS
Sbjct: 376 PVALISPAAPSLPATPFSPVAPPPVAPPPTATPPAASTPASPPPAVPASPVALIPPAAPS 435

Query: 152 GADTPPSPSAAFSYSKPIIAATALSAAL 69
               PPSP A    + P   A    AAL
Sbjct: 436 LPAAPPSPVAPPPAAPPSPVALIPPAAL 463

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 49/125 (39%), Positives = 57/125 (45%), Gaps = 13/125 (10%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPA--PTAQPPAAA----TPPTATPPTATPPAAVPAPATPAPA 276
           S +A  P AA + P    PA  P+A PP AA     PP  +PP A PP   P PA P P 
Sbjct: 453 SPVALIPPAALSLPAAPLPAASPSAAPPIAAPSPVDPPPPSPPLAAPPLTSPPPAAPIPL 512

Query: 275 SSPATSPPAPTPASTPSTAPTPSTAGSPPA-------PTPDSLGPGPSGADTPPSPSAAF 117
           S+P   P  PTPAS P   P    A +PPA       P P +L P       P SP A  
Sbjct: 513 STP--PPVVPTPASPPPAVPASPVALNPPAAPSLPAVPPPAALRPASLPPAAPASPVAPI 570

Query: 116 SYSKP 102
             + P
Sbjct: 571 PPAAP 575

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 58/145 (40%), Positives = 67/145 (46%), Gaps = 21/145 (14%)
 Frame = -3

Query: 449 LLATSCLAQAPTAAPT-------KPPTATPAPTAQPPAA----ATPPTATPPTATPPAAV 303
           L A S  A  P AAP+        PP A P  T+ PPAA    +TPP   P  A+PP AV
Sbjct: 470 LPAASPSAAPPIAAPSPVDPPPPSPPLAAPPLTSPPPAAPIPLSTPPPVVPTPASPPPAV 529

Query: 302 PAPAT----PAPASSPATSPPAP-TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 138
           PA       PA  S PA  PPA   PAS P  AP    A  PPA     + P P+   TP
Sbjct: 530 PASPVALNPPAAPSLPAVPPPAALRPASLPPAAPASPVAPIPPAAPSLLVVPPPA---TP 586

Query: 137 PS-----PSAAFSYSKPIIAATALS 78
           PS     P+A    S P  +  AL+
Sbjct: 587 PSLVAPPPAAPMLASPPPASPVALT 611

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 53/133 (39%), Positives = 65/133 (48%), Gaps = 13/133 (9%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAP-TAQPPAAATPPTATPPTATP------PAAVPAP--ATPAP 279
           L  +P A  T    A P+P +A P  AATPP A PP ATP      P  VP P  A  +P
Sbjct: 77  LPDSPAAPFTLATLAVPSPPSAAPSLAATPPAAPPPAATPSPVALIPLVVPPPPVAPSSP 136

Query: 278 ASSPATSPPAPT--PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP--PSPSAAFSY 111
            + P T PP P   P + PS A  P  A   PA +P +  P P+   +P  P P+A  S 
Sbjct: 137 VAPPPTEPPLPVLPPETPPSPAVLPPAAPISPAASPPA-APPPAAPASPAAPPPAAPASS 195

Query: 110 SKPIIAATALSAA 72
           + P  AA A  AA
Sbjct: 196 AAPPPAAPASPAA 208

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 46/117 (39%), Positives = 54/117 (46%), Gaps = 5/117 (4%)
 Frame = -3

Query: 455 LGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP-ATPAP 279
           L L A    A +P+AAP   P A P+P   PP +  PP A PP  +PP A P P +TP P
Sbjct: 463 LSLPAAPLPAASPSAAP---PIAAPSPVDPPPPS--PPLAAPPLTSPPPAAPIPLSTPPP 517

Query: 278 ASSPATSPPAPTPAS----TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
                 SPP   PAS     P  AP+      P A  P SL P    +   P P AA
Sbjct: 518 VVPTPASPPPAVPASPVALNPPAAPSLPAVPPPAALRPASLPPAAPASPVAPIPPAA 574

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 51/138 (36%), Positives = 63/138 (45%), Gaps = 19/138 (13%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPT--KPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPAT---- 288
           LAT  +   P+AAP+    P A P P A P P A  P    PP   P + V  P T    
Sbjct: 87  LATLAVPSPPSAAPSLAATPPAAPPPAATPSPVALIPLVVPPPPVAPSSPVAPPPTEPPL 146

Query: 287 ----PAPASSPATSPPAP--TPASTPSTAPTPSTAGSPPAPTP----DSLGPGPSGADTP 138
               P    SPA  PPA   +PA++P  AP P+   SP AP P     S  P P+   +P
Sbjct: 147 PVLPPETPPSPAVLPPAAPISPAASPPAAPPPAAPASPAAPPPAAPASSAAPPPAAPASP 206

Query: 137 --PSPSAAFSYSKPIIAA 90
             P P+A  S + P  AA
Sbjct: 207 AAPPPAAPGSPAAPPPAA 224

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 46/120 (38%), Positives = 61/120 (50%), Gaps = 12/120 (10%)
 Frame = -3

Query: 416  TAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP--APATP---APASSPAT--- 261
            T  P  PP A PA +A P A A+P    PP   PPA+ P  APA+P   AP ++PA+   
Sbjct: 648  TLPPATPPPAEPA-SAPPAAPASPVALIPPATPPPASPPLAAPASPVALAPPAAPASPAA 706

Query: 260  --SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPPSPSAAFSYSKPIIA 93
              SP  P PA+ P  AP    A  PPA  P ++ P   P  A  P S + + + + P+ A
Sbjct: 707  PISPLTPLPAAPPLAAPPSPVAFIPPAALPPAILPPAAPPPATLPSSVAPSLAAASPLAA 766

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 48/152 (31%), Positives = 61/152 (40%), Gaps = 22/152 (14%)
 Frame = -3

Query: 446 LATSCLAQAPTAAP---TKPPTATPAPTAQPPA-----------------AATPPTATPP 327
           LA   L   P AAP   + PP   P P + PPA                 A  PP A  P
Sbjct: 496 LAAPPLTSPPPAAPIPLSTPPPVVPTPASPPPAVPASPVALNPPAAPSLPAVPPPAALRP 555

Query: 326 TATPPAAVPAPATPAPASSPA--TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 153
            + PPAA  +P  P P ++P+    PP  TP S  +  P      SPP  +P +L P  +
Sbjct: 556 ASLPPAAPASPVAPIPPAAPSLLVVPPPATPPSLVAPPPAAPMLASPPPASPVALTPPTA 615

Query: 152 GADTPPSPSAAFSYSKPIIAATALSAALFAIA 57
                  P AA   + P  AAT     L  +A
Sbjct: 616 PPSPAAPPPAAPPTASPPPAATPSPVPLIPLA 647

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 51/124 (41%), Positives = 59/124 (47%), Gaps = 4/124 (3%)
 Frame = -3

Query: 431 LAQAPTAA-PTKPPTATPA-PTA--QPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           +A  P A+ P  PP A PA P A   P A + P T   P A PP A P  ATP PA+S  
Sbjct: 356 VAPPPAASIPASPPPAAPASPVALISPAAPSLPATPFSPVAPPPVAPPPTATP-PAASTP 414

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATA 84
            SPP   PAS    A  P  A S PA  P  + P P+    PPSP A    +   + A  
Sbjct: 415 ASPPPAVPAS--PVALIPPAAPSLPAAPPSPVAPPPA---APPSPVALIPPAALSLPAAP 469

Query: 83  LSAA 72
           L AA
Sbjct: 470 LPAA 473

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 41/106 (38%), Positives = 47/106 (44%), Gaps = 4/106 (3%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKP----PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA 276
           AT   A  P AAP  P    P A PA  A P +  TP  A PP A PP+  P    P  A
Sbjct: 677 ATPPPASPPLAAPASPVALAPPAAPASPAAPISPLTPLPAAPPLAAPPS--PVAFIPPAA 734

Query: 275 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 138
             PA  PPA  P +T  ++  PS A + P   P    P P  A  P
Sbjct: 735 LPPAILPPAAPPPATLPSSVAPSLAAASPLAAPPPAAPPPPAAPPP 780

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 48/125 (38%), Positives = 59/125 (47%), Gaps = 14/125 (11%)
 Frame = -3

Query: 404 TKP-PTATPAPTAQPPAAATPPTATPPTATPP-----AAVPAPATPAPASSPATSPPAPT 243
           T+P P   P P  +PP   TPP + P +   P      AVP+P + AP S  AT P AP 
Sbjct: 53  TEPSPPFKPPPPVEPPPTVTPPASLPDSPAAPFTLATLAVPSPPSAAP-SLAATPPAAPP 111

Query: 242 PASTPS-------TAPTPSTAGSPPAPTPDSLGPGP-SGADTPPSPSAAFSYSKPIIAAT 87
           PA+TPS         P P  A S P   P +  P P    +TPPSP A    + PI  A 
Sbjct: 112 PAATPSPVALIPLVVPPPPVAPSSPVAPPPTEPPLPVLPPETPPSP-AVLPPAAPISPAA 170

Query: 86  ALSAA 72
           +  AA
Sbjct: 171 SPPAA 175

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 5/106 (4%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTAT-PAPTAQPPAAATPPTATPPTATPPAAVP----APATPAPASSP 267
           +A+ P   P +  + T P+P  +PP    PP   PPT TPPA++P    AP T A  + P
Sbjct: 38  VAEHPLDVPFEEHSLTEPSPPFKPP----PPVEPPPTVTPPASLPDSPAAPFTLATLAVP 93

Query: 266 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           +    AP+ A+TP  AP P+   SP A  P  + P P    +P +P
Sbjct: 94  SPPSAAPSLAATPPAAPPPAATPSPVALIPLVVPPPPVAPSSPVAP 139

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 46/138 (33%), Positives = 60/138 (43%), Gaps = 15/138 (10%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPT----------ATP-APTAQPPAA----ATPPTATPPTATPPA 309
           A S  A  P AAP  P            ATP +P A PP A    ATPP A+ P + PPA
Sbjct: 361 AASIPASPPPAAPASPVALISPAAPSLPATPFSPVAPPPVAPPPTATPPAASTPASPPPA 420

Query: 308 AVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              +P    P ++P+     P+P + P  AP    A  PPA       P P+ + +   P
Sbjct: 421 VPASPVALIPPAAPSLPAAPPSPVAPPPAAPPSPVALIPPAALSLPAAPLPAASPSAAPP 480

Query: 128 SAAFSYSKPIIAATALSA 75
            AA S   P   +  L+A
Sbjct: 481 IAAPSPVDPPPPSPPLAA 498

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 46/137 (33%), Positives = 56/137 (40%), Gaps = 28/137 (20%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAA-----------ATPPTATPPTATPPAAVPAPATPAPASSPA---- 264
           PP   P PT  PPA+           AT    +PP+A P  A   PA P PA++P+    
Sbjct: 62  PPPVEPPPTVTPPASLPDSPAAPFTLATLAVPSPPSAAPSLAATPPAAPPPAATPSPVAL 121

Query: 263 ------------TSPPAPTPASTPSTAPTPSTAGSPPA-PTPDSLGPGPSGADTPPSPSA 123
                       +SP AP P   P     P T  SP   P    + P  S    PP P+A
Sbjct: 122 IPLVVPPPPVAPSSPVAPPPTEPPLPVLPPETPPSPAVLPPAAPISPAASPPAAPP-PAA 180

Query: 122 AFSYSKPIIAATALSAA 72
             S + P  AA A SAA
Sbjct: 181 PASPAAPPPAAPASSAA 197

[50][TOP]
>UniRef100_Q605T2 Putative uncharacterized protein n=1 Tax=Methylococcus capsulatus
           RepID=Q605T2_METCA
          Length = 416

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 53/89 (59%), Positives = 58/89 (65%), Gaps = 5/89 (5%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAP-ATPAPASSPAT 261
           A  P A PT  PT TPAPT  P   ATP PTATP PTATP P A PAP ATPAP SSPA 
Sbjct: 110 ADLPVATPTPTPTPTPAPTVTPAPTATPAPTATPAPTATPAPTATPAPTATPAPTSSPAP 169

Query: 260 SP-PAPTPASTPSTAPTPSTAGSPPAPTP 177
           +P PAPT +  P++ P P+   S PAP P
Sbjct: 170 TPSPAPTASPAPTSTPAPT---SSPAPFP 195

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 52/102 (50%), Positives = 58/102 (56%), Gaps = 6/102 (5%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPT--KPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPA-TP 285
           +AT      PT APT    PTATPAPTA P   ATP PTATP PTATP P + PAP  +P
Sbjct: 114 VATPTPTPTPTPAPTVTPAPTATPAPTATPAPTATPAPTATPAPTATPAPTSSPAPTPSP 173

Query: 284 APASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG 159
           AP +SPA   P  TPA T S AP P        P  D++  G
Sbjct: 174 APTASPA---PTSTPAPTSSPAPFPIGCLLQSRPELDTIPTG 212

[51][TOP]
>UniRef100_C5BID0 Putative uncharacterized protein n=1 Tax=Teredinibacter turnerae
           T7901 RepID=C5BID0_TERTT
          Length = 890

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 50/132 (37%), Positives = 79/132 (59%), Gaps = 8/132 (6%)
 Frame = -3

Query: 506 SLHPKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATP-PTATP 330
           SL P +A   +++    L   A+   + +PT +P+  P+ +P P+  P  + +P P+ TP
Sbjct: 112 SLEPTLAPQPSMEPMPSLAPSASPTPSPSPTPSPSPTPSPSPTPSLSPTPSLSPTPSPTP 171

Query: 329 PTATPPAAVPAPA---TPAPASSPATSP---PAPTPASTPSTAPTPSTAGSP-PAPTPDS 171
           P +  P+  P P+   TP+P+ +P+ SP   P+PTP+ TPS +PTPS + +P P+PTP S
Sbjct: 172 PPSPTPSPSPTPSMSPTPSPSPTPSPSPTPSPSPTPSPTPSPSPTPSPSPTPSPSPTP-S 230

Query: 170 LGPGPSGADTPP 135
             P PS + TPP
Sbjct: 231 PSPTPSPSPTPP 242

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 50/124 (40%), Positives = 66/124 (53%), Gaps = 19/124 (15%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTA--TPAPTAQPPAAATPPTATPPTATPPAAVPAP-----ATPA 282
           TS LA  PT   +  PT    PAP+  P   +T P+  P  A  P+  P P     A+P 
Sbjct: 77  TSTLATTPTPVVSAVPTLFPLPAPSNPPATPSTGPSLEPTLAPQPSMEPMPSLAPSASPT 136

Query: 281 PASSPATSP-PAPTPASTPSTAPTPSTAGS-----PPAPTPD-----SLGPGPSGADTP- 138
           P+ SP  SP P P+P+ TPS +PTPS + +     PP+PTP      S+ P PS + TP 
Sbjct: 137 PSPSPTPSPSPTPSPSPTPSLSPTPSLSPTPSPTPPPSPTPSPSPTPSMSPTPSPSPTPS 196

Query: 137 PSPS 126
           PSP+
Sbjct: 197 PSPT 200

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSP-PA 249
           +PT +PT PP+ TP+P+  P  + TP P+ TP  +  P+  P P +P P+ SP  SP P 
Sbjct: 164 SPTPSPTPPPSPTPSPSPTPSMSPTPSPSPTPSPSPTPSPSPTP-SPTPSPSPTPSPSPT 222

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLG 165
           P+P+ TPS +PTPS + +PP    D  G
Sbjct: 223 PSPSPTPSPSPTPSPSPTPPPIPGDDAG 250

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 44/109 (40%), Positives = 63/109 (57%), Gaps = 11/109 (10%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP---PTATPPTATPPAAVPAPA-TPAPASSPATSP- 255
           P+  P+  PT  P P+ +P  +  P   PT +P     P+  P+P+ TP+ + +P+ SP 
Sbjct: 107 PSTGPSLEPTLAPQPSMEPMPSLAPSASPTPSPSPTPSPSPTPSPSPTPSLSPTPSLSPT 166

Query: 254 --PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP---PSPS 126
             P P P+ TPS +PTPS + +P P+PTP S  P PS + TP   PSPS
Sbjct: 167 PSPTPPPSPTPSPSPTPSMSPTPSPSPTP-SPSPTPSPSPTPSPTPSPS 214

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 49/131 (37%), Positives = 71/131 (54%), Gaps = 23/131 (17%)
 Frame = -3

Query: 419 PTAAP--TKPPTATPAPTAQPPAAATP---PTATPPTATPPAAVPAPA-------TPAPA 276
           PT AP  +  P  + AP+A P  + +P   P+ TP  +  P+  P P+       TP P+
Sbjct: 115 PTLAPQPSMEPMPSLAPSASPTPSPSPTPSPSPTPSPSPTPSLSPTPSLSPTPSPTPPPS 174

Query: 275 SSPATSP-----PAPTPASTPSTAPTPSTAGSP-----PAPTPDSLGPGPSGADTP-PSP 129
            +P+ SP     P P+P+ TPS +PTPS + +P     P+PTP S  P PS + TP PSP
Sbjct: 175 PTPSPSPTPSMSPTPSPSPTPSPSPTPSPSPTPSPTPSPSPTP-SPSPTPSPSPTPSPSP 233

Query: 128 SAAFSYSKPII 96
           + + S + P I
Sbjct: 234 TPSPSPTPPPI 244

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 45/124 (36%), Positives = 61/124 (49%), Gaps = 9/124 (7%)
 Frame = -3

Query: 452 GLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPT--ATPPAAVPAPAT-PA 282
           G+      A   T A T  P  +  PT  P  A + P ATP T  +  P   P P+  P 
Sbjct: 67  GVTTEESTAGTSTLATTPTPVVSAVPTLFPLPAPSNPPATPSTGPSLEPTLAPQPSMEPM 126

Query: 281 PASSPATSPPAPTPASTPSTAPTPSTAGSPP---APTPDSLGPGPSGADTP---PSPSAA 120
           P+ +P+ SP   TP+ +P+ +P+P+ + SP    +PTP SL P PS    P   PSPS  
Sbjct: 127 PSLAPSASP---TPSPSPTPSPSPTPSPSPTPSLSPTP-SLSPTPSPTPPPSPTPSPSPT 182

Query: 119 FSYS 108
            S S
Sbjct: 183 PSMS 186

[52][TOP]
>UniRef100_Q9FUL8 Arabinogalactan protein n=1 Tax=Nicotiana alata RepID=Q9FUL8_NICAL
          Length = 228

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 62/147 (42%), Positives = 76/147 (51%), Gaps = 22/147 (14%)
 Frame = -3

Query: 467 IFLI--LGLLATSCLAQAPTAAPTKPPT---ATPAPTAQP-----PAAATPPTATPPTA- 321
           +FL+  L ++  S   Q P AAP K P    AT  P A P     PA AT P + PPTA 
Sbjct: 6   VFLVSFLCIVVASVTGQTPAAAPAKAPVGAKATTPPAAAPTKPKTPAPATAPASAPPTAV 65

Query: 320 -TPPAAVPA--PATPA--------PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPD 174
            TPPAA PA  P TP         PA +PA+SPPA  P S+P  A TP    SPPAP P 
Sbjct: 66  STPPAAAPATAPTTPVVTSPVSAPPAKTPASSPPAAVPVSSPPLAVTP--VQSPPAPAPV 123

Query: 173 SLGPGPSGADTPPSPSAAFSYSKPIIA 93
           +  P  + A   P P +A + S+ + A
Sbjct: 124 AATPPAASAPPAPVPVSAPAVSETVPA 150

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 52/128 (40%), Positives = 65/128 (50%), Gaps = 23/128 (17%)
 Frame = -3

Query: 419 PTAAPTKPPTATPA--PTAQPPAA-ATPPTATPPTA--------------------TPPA 309
           P AAPTKP T  PA  P + PP A +TPP A P TA                    +PPA
Sbjct: 41  PAAAPTKPKTPAPATAPASAPPTAVSTPPAAAPATAPTTPVVTSPVSAPPAKTPASSPPA 100

Query: 308 AVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           AVP  ++P  A +P  SPPAP P      A TP  A +PPAP P S    P+ ++T P+P
Sbjct: 101 AVPV-SSPPLAVTPVQSPPAPAP-----VAATPPAASAPPAPVPVS---APAVSETVPAP 151

Query: 128 SAAFSYSK 105
           + + S  K
Sbjct: 152 APSKSKGK 159

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 51/135 (37%), Positives = 61/135 (45%), Gaps = 34/135 (25%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATP-------APTAQPPAA---ATPPTATPPTATPPAAVPAPATPAP 279
           A AP  APT P   +P        P + PPAA   ++PP A  P  +PPA  P  ATP  
Sbjct: 70  AAAPATAPTTPVVTSPVSAPPAKTPASSPPAAVPVSSPPLAVTPVQSPPAPAPVAATPPA 129

Query: 278 ASSPATSPPAPTPASTPST-----APTPSTA-----------GSPPAPTPDSL------- 168
           AS    +PPAP P S P+      AP PS +            S PAP+PD +       
Sbjct: 130 AS----APPAPVPVSAPAVSETVPAPAPSKSKGKGKKKGKKHASSPAPSPDMMSPPAPPT 185

Query: 167 -GPGPSGADTPPSPS 126
             PGPS     PSPS
Sbjct: 186 EAPGPSMESDSPSPS 200

[53][TOP]
>UniRef100_Q89X06 Blr0521 protein n=1 Tax=Bradyrhizobium japonicum RepID=Q89X06_BRAJA
          Length = 745

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 57/109 (52%), Positives = 60/109 (55%), Gaps = 13/109 (11%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAAT------PPTATP-PTATP-PAAVPAP-ATPAPASSP 267
           P A PT  PTATP P A PPAA T       P ATP PT TP P A PAP ATPAP S+P
Sbjct: 185 PAARPTPAPTATPTPVAPPPAAPTARPGSPAPAATPAPTPTPAPTATPAPTATPAPGSTP 244

Query: 266 ATSPPAPTPASTPSTAP-TPSTAGSPPAP--TP-DSLGPGPSGADTPPS 132
              P     A  P   P +P  AGSPPAP  TP  +  P P G  TPPS
Sbjct: 245 GAPPAGRPGAPPPGVRPGSPPAAGSPPAPGATPAPTTTPAPGGTATPPS 293

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 54/120 (45%), Positives = 63/120 (52%), Gaps = 18/120 (15%)
 Frame = -3

Query: 428 AQAPTAA--PTKPPTATPAPTAQPPAAATP-------PTATPPTATPPAAVPA--PATPA 282
           A AP  A  P  PP A P PT  PP  A P       PTATP    PP A P   P +PA
Sbjct: 156 AAAPQHAPPPPPPPAARPTPTPPPPPPAGPAARPTPAPTATPTPVAPPPAAPTARPGSPA 215

Query: 281 PASSPATSP-PAPTPASTPSTAPTP-STAGSPPAPTPDSLGPG-----PSGADTPPSPSA 123
           PA++PA +P PAPT    P+  P P ST G+PPA  P +  PG     P  A +PP+P A
Sbjct: 216 PAATPAPTPTPAPTATPAPTATPAPGSTPGAPPAGRPGAPPPGVRPGSPPAAGSPPAPGA 275

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 49/107 (45%), Positives = 54/107 (50%), Gaps = 5/107 (4%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPA-PTAQPPAAATP--PTATPPTATPPA-AVPAPATPAPASSPATS 258
           Q P   P   P A PA P A PPAAA P  P A PP A PP  A P P  P PA+ PA  
Sbjct: 50  QPPKGPPGAAPPAAPARPAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPPPPPPAARPAPP 109

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPT-PDSLGPGPSGADTPPSPSAA 120
           PP P PA+    +P P+ A    APT P    P    A TPP+P  A
Sbjct: 110 PPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAPPPA 156

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 48/128 (37%), Positives = 56/128 (43%), Gaps = 13/128 (10%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT--------PPAAVPAPATPAPAS 273
           A  P AAP  PP A P P A PP  A PP   PP A         PP A P   +P PA+
Sbjct: 69  APPPAAAPPHPP-AAPPPAAAPPRPAAPPPPPPPPAARPAPPPPPPPPAAPKQPSPPPAA 127

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGP-----SGADTPPSPSAAFSYS 108
           +P    P P P + P+  P P+    PPA  P    P P         TPP P  A   +
Sbjct: 128 APQQHAPTPPPPAPPAARPAPTPPAPPPAAAPQHAPPPPPPPAARPTPTPPPPPPAGPAA 187

Query: 107 KPIIAATA 84
           +P  A TA
Sbjct: 188 RPTPAPTA 195

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 51/111 (45%), Positives = 58/111 (52%), Gaps = 13/111 (11%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATP-------PTATPP---TATPPAA--VPAP-AT 288
           A  P   PT  PTATPAPTA P   +TP       P A PP     +PPAA   PAP AT
Sbjct: 217 AATPAPTPTPAPTATPAPTATPAPGSTPGAPPAGRPGAPPPGVRPGSPPAAGSPPAPGAT 276

Query: 287 PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           PAP ++PA    A  P+  P  A TP+   + PAPT     P P GA TPP
Sbjct: 277 PAPTTTPAPGGTATPPSGRPGPASTPAPGAATPAPTAT---PAPGGALTPP 324

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 49/122 (40%), Positives = 60/122 (49%), Gaps = 3/122 (2%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTA-TPPTATPPAAVPAPATPAP--ASSPATS 258
           A  P   P  PP A P   + PPAAA    A TPP   PPAA PAP  PAP  A++P  +
Sbjct: 103 AARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAPPPAAAPQHA 162

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALS 78
           PP P P   P+  PTP+    PPA       P P+   TP +P  A   ++P   A A +
Sbjct: 163 PPPPPP---PAARPTPTPPPPPPAGPAARPTPAPTATPTPVAPPPAAPTARPGSPAPAAT 219

Query: 77  AA 72
            A
Sbjct: 220 PA 221

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 50/117 (42%), Positives = 56/117 (47%), Gaps = 14/117 (11%)
 Frame = -3

Query: 422 APTAAPTKP-PTATPAPTAQPPAAATP-PTATPPTATPPAAVPA--PATPAPASSP---- 267
           APTA P  P P ATPAPT  P   ATP PTATP   + P A PA  P  P P   P    
Sbjct: 206 APTARPGSPAPAATPAPTPTPAPTATPAPTATPAPGSTPGAPPAGRPGAPPPGVRPGSPP 265

Query: 266 -ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-----PSPSAAFS 114
            A SPPAP     P+T P P    +PP+  P        GA TP     P+P  A +
Sbjct: 266 AAGSPPAPGATPAPTTTPAPGGTATPPSGRPGPASTPAPGAATPAPTATPAPGGALT 322

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 47/110 (42%), Positives = 55/110 (50%), Gaps = 15/110 (13%)
 Frame = -3

Query: 407 PTKPPTATP---APTAQPPAAATPPTATPPTATPPAAVP---APATPAPASSPATSPPAP 246
           P+ PP A P   APT  PPA      A  P A PPAA P    P  P PA+ P  +PP P
Sbjct: 121 PSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAPPPAAAPQHAPPPPPPPAARPTPTPPPP 180

Query: 245 TPAS-----TPSTAPTPSTAGSPP-APT--PDSLGPGPSGADTP-PSPSA 123
            PA      TP+   TP+    PP APT  P S  P  + A TP P+P+A
Sbjct: 181 PPAGPAARPTPAPTATPTPVAPPPAAPTARPGSPAPAATPAPTPTPAPTA 230

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 47/114 (41%), Positives = 57/114 (50%), Gaps = 7/114 (6%)
 Frame = -3

Query: 422 APTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATP-PAAVPAP--ATPAPASSPATSP 255
           +P AA + P P ATPAPT  P   A   TATPP+  P PA+ PAP  ATPAP ++PA   
Sbjct: 263 SPPAAGSPPAPGATPAPTTTP---APGGTATPPSGRPGPASTPAPGAATPAPTATPAPGG 319

Query: 254 PAPTPASTPSTAPTPS-TAGSPPAPTPDSLGPG--PSGADTPPSPSAAFSYSKP 102
               P   P   PTP    G+PPA  P +  P   P     P  P+A    + P
Sbjct: 320 ALTPPPGRPGAGPTPGPQGGTPPAGAPAAGTPAAPPQAGGLPARPAAPAGAAAP 373

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 45/130 (34%), Positives = 57/130 (43%), Gaps = 5/130 (3%)
 Frame = -3

Query: 464 FLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATP-----PTATPPTATPPAAVP 300
           F++L   A + +  A TA+  +  +      AQP           P   PP A PPAA  
Sbjct: 6   FVLLATTALTAMQLANTASHAQGASPLVVAQAQPQETGPDGKPKQPPKGPPGAAPPAAPA 65

Query: 299 APATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            PA P PA++P   P AP PA+ P     P  A  PP P P +  P P     PP P+A 
Sbjct: 66  RPAAPPPAAAPPHPPAAPPPAAAP-----PRPAAPPPPPPPPAARPAP--PPPPPPPAAP 118

Query: 119 FSYSKPIIAA 90
              S P  AA
Sbjct: 119 KQPSPPPAAA 128

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 41/115 (35%), Positives = 51/115 (44%), Gaps = 7/115 (6%)
 Frame = -3

Query: 395 PTATPAPTAQPPAAATPPTA-TPPTATPPAAVP--APATPAPASSP----ATSPPAPTPA 237
           P   P    + P  A PP A   P A PPAA P   PA P PA++P    A  PP P PA
Sbjct: 44  PDGKPKQPPKGPPGAAPPAAPARPAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPPPPPPA 103

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
           + P+  P P    +P  P+P         A TPP P+   +   P   A   +AA
Sbjct: 104 ARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAPPPAAA 158

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 44/116 (37%), Positives = 53/116 (45%), Gaps = 16/116 (13%)
 Frame = -3

Query: 422 APTAAPTKPPTATP-AP-----TAQPPAAATPPT--ATPPTATPPA----AVPAPATPAP 279
           AP + P  PP   P AP        PPAA +PP   ATP   T PA    A P    P P
Sbjct: 239 APGSTPGAPPAGRPGAPPPGVRPGSPPAAGSPPAPGATPAPTTTPAPGGTATPPSGRPGP 298

Query: 278 ASSPATSPPAPTPASTP----STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
           AS+PA     P P +TP    +  P P   G+ P P P   G  P+GA    +P+A
Sbjct: 299 ASTPAPGAATPAPTATPAPGGALTPPPGRPGAGPTPGPQG-GTPPAGAPAAGTPAA 353

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 51/145 (35%), Positives = 60/145 (41%), Gaps = 24/145 (16%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAP--TAQPPAAATPPTATPPTATPPAAVPAP-ATPAPASS------- 270
           P    T  PT TPAP  TA PP+    P +TP    P AA PAP ATPAP  +       
Sbjct: 271 PAPGATPAPTTTPAPGGTATPPSGRPGPASTP---APGAATPAPTATPAPGGALTPPPGR 327

Query: 269 --------------PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
                         PA +P A TPA+ P     P+   +P      S  PG S A TPP 
Sbjct: 328 PGAGPTPGPQGGTPPAGAPAAGTPAAPPQAGGLPARPAAPAGAAAPSTVPG-SAAATPPP 386

Query: 131 PSAAFSYSKPIIAATALSAALFAIA 57
             A F+   P     A  AA   +A
Sbjct: 387 NRAQFA---PPTVTPAFQAAPTVVA 408

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 51/147 (34%), Positives = 60/147 (40%), Gaps = 22/147 (14%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPP--AAATP--------PTATPPTATPPAAVPA---PATPAP 279
           P + P  P  ATPAPTA P    A TP        PT  P   TPPA  PA   PA P  
Sbjct: 298 PASTPA-PGAATPAPTATPAPGGALTPPPGRPGAGPTPGPQGGTPPAGAPAAGTPAAPPQ 356

Query: 278 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAP---TPDSLGPGPSGADT-----PPSPSA 123
           A      P AP  A+ PST P  + A  PP      P ++ P    A T     PP P  
Sbjct: 357 AGGLPARPAAPAGAAAPSTVPGSAAATPPPNRAQFAPPTVTPAFQAAPTVVAPLPPPPRP 416

Query: 122 AFSYSKPI-IAATALSAALFAIAF*DL 45
                 P+ I A  ++ A+      DL
Sbjct: 417 PQRDLTPLAIGAGVVAGAVIGATIADL 443

[54][TOP]
>UniRef100_Q5W1I7 Putative arabinogalactan-protein n=1 Tax=Nicotiana glauca
           RepID=Q5W1I7_NICGL
          Length = 135

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 55/140 (39%), Positives = 82/140 (58%), Gaps = 3/140 (2%)
 Frame = -3

Query: 473 VQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP 294
           V + L+L L+  S  AQAP A+P   P ++P     PP A++PP ATPP+A  P + PA 
Sbjct: 6   VIVALMLALVVGSAFAQAPGASPAASPKSSP-----PPVASSPPLATPPSAVTPVSAPAN 60

Query: 293 A---TPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
           A     +P+ SP  SPPAP    TP+++P+  TA       P S+   PSG+ T  SP++
Sbjct: 61  APTTASSPSESPLASPPAPPTVDTPASSPSGGTA-------PPSISESPSGSPT-SSPNS 112

Query: 122 AFSYSKPIIAATALSAALFA 63
           A S+++  +A +A+  A+FA
Sbjct: 113 A-SFNRVAVAGSAV-VAIFA 130

[55][TOP]
>UniRef100_B6UDN6 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6UDN6_MAIZE
          Length = 207

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 58/118 (49%), Positives = 69/118 (58%), Gaps = 13/118 (11%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPA-----TPAPASSPAT 261
           AP A  T PP ATP+  A PPAA TPPT TPPT +PP+ A P P+      PAP+S+PAT
Sbjct: 16  APPANATNPPPATPS--APPPAAPTPPTPTPPTPSPPSPAAPPPSPPSVPAPAPSSTPAT 73

Query: 260 -SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS------GADTPPSPSAAFSYS 108
            S P+P+  S+PST  TPS     P+P P S G G S      G  TP S S   S+S
Sbjct: 74  PSAPSPSSPSSPSTPATPSPPSDTPSP-PSSGGGGRSPPSSGGGRSTPSSHSPPKSHS 130

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 53/124 (42%), Positives = 68/124 (54%), Gaps = 14/124 (11%)
 Frame = -3

Query: 431 LAQAPTAAPTKP-PTATPAPTAQPPAA---ATPPTA-TPPTATPPAAVPAPATPAPASSP 267
           ++ +PTAAP    P+A PA    PP A   A PP A TPPT TP    P P+ P+PA+ P
Sbjct: 1   MSSSPTAAPAPTTPSAPPANATNPPPATPSAPPPAAPTPPTPTP----PTPSPPSPAAPP 56

Query: 266 ATSP--PAPTPASTPST--APTPSTAGSP-----PAPTPDSLGPGPSGADTPPSPSAAFS 114
            + P  PAP P+STP+T  AP+PS+  SP     P+P  D+  P  SG      PS+   
Sbjct: 57  PSPPSVPAPAPSSTPATPSAPSPSSPSSPSTPATPSPPSDTPSPPSSGGGGRSPPSSGGG 116

Query: 113 YSKP 102
            S P
Sbjct: 117 RSTP 120

 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 39/91 (42%), Positives = 48/91 (52%), Gaps = 2/91 (2%)
 Frame = -3

Query: 353 ATPPTATPPTATPPAAVPAPATPAPASSPATSPP-APTPAS-TPSTAPTPSTAGSPPAPT 180
           ++ PTA P   T P+A PA AT  P ++P+  PP APTP + TP T   PS A  PP+P 
Sbjct: 2   SSSPTAAP-APTTPSAPPANATNPPPATPSAPPPAAPTPPTPTPPTPSPPSPAAPPPSP- 59

Query: 179 PDSLGPGPSGADTPPSPSAAFSYSKPIIAAT 87
           P    P PS     PS  +  S S P   AT
Sbjct: 60  PSVPAPAPSSTPATPSAPSPSSPSSPSTPAT 90

[56][TOP]
>UniRef100_O10341 Uncharacterized 29.3 kDa protein n=1 Tax=Orgyia pseudotsugata MNPV
           RepID=Y091_NPVOP
          Length = 279

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 52/117 (44%), Positives = 64/117 (54%), Gaps = 12/117 (10%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATP-PTATP-----PTATP---PAAVPAPA- 291
           T  L+  PT +PT  PT +P PT  P  + TP PT TP     PT TP   P+  P P+ 
Sbjct: 74  TPALSPTPTPSPTLSPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSP 133

Query: 290 TPAPASSPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPSPS 126
           TP P+ +P+ +P P PTP+ TPS  PTPS   SP P P+P      P     PPSPS
Sbjct: 134 TPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPPPSPTPPPSPS 190

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 51/106 (48%), Positives = 63/106 (59%), Gaps = 8/106 (7%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPA-TPAPASSPATSP-PA 249
           PT +PT  PT TP PT  P  + TP  A  PT TP P   P P+ TP P+ +P+ +P P 
Sbjct: 49  PTPSPTPTPTPTPTPTPTPTPSPTPTPALSPTPTPSPTLSPTPSPTPTPSPTPSPTPSPT 108

Query: 248 PTPASTPSTAPTPSTAGSP---PAPTP-DSLGPGPSGADTP-PSPS 126
           PTP+ TPS  PTPS   SP   P+PTP  S  P P+ + TP PSP+
Sbjct: 109 PTPSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPSPTPTPSPT 154

 Score = 84.0 bits (206), Expect = 7e-15
 Identities = 59/134 (44%), Positives = 69/134 (51%), Gaps = 21/134 (15%)
 Frame = -3

Query: 464 FLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATP---PTATP-PTATP-----P 312
           ++I+ LL    L        TKPP  +P PT  P    TP   PT TP PT TP     P
Sbjct: 10  YIIIILLTLWLLTSLKQNIETKPPLPSPTPTPTPSPTPTPTPSPTPTPTPTPTPTPTPTP 69

Query: 311 AAVPAPA-----TPAPASSPATSP---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLG 165
           +  P PA     TP+P  SP  SP   P+PTP+ TPS  PTPS   SP   P+PTP S  
Sbjct: 70  SPTPTPALSPTPTPSPTLSPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTP-SPT 128

Query: 164 PGPSGADTP-PSPS 126
           P PS   TP P+PS
Sbjct: 129 PTPSPTPTPSPTPS 142

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 49/113 (43%), Positives = 66/113 (58%), Gaps = 6/113 (5%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSP-PA 249
           +PT  P   PT TP+PT  P  + TP  +  P+ TP P   P+P TP+P  +P+ +P P 
Sbjct: 70  SPTPTPALSPTPTPSPTLSPTPSPTPTPSPTPSPTPSPTPTPSP-TPSPTPTPSPTPSPT 128

Query: 248 PTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTP-PSPSAAFSYSKP 102
           PTP+ TP+ +PTPS   SP   P+PTP S  P PS   +P P+PS   S + P
Sbjct: 129 PTPSPTPTPSPTPSPTPSPTPTPSPTP-SPTPTPSPTPSPTPTPSPTPSPTPP 180

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 44/105 (41%), Positives = 61/105 (58%), Gaps = 7/105 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSP-PAP 246
           PT  PT  P+ TP P   P    +P  +  P+ TP P+  P+P TP+P  +P+ +P P P
Sbjct: 61  PTPTPTPTPSPTPTPALSPTPTPSPTLSPTPSPTPTPSPTPSP-TPSPTPTPSPTPSPTP 119

Query: 245 TPASTPSTAPTPSTAGSP---PAPTPD-SLGPGPSGADTP-PSPS 126
           TP+ TPS  PTPS   +P   P+PTP  +  P P+ + TP PSP+
Sbjct: 120 TPSPTPSPTPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPT 164

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 35/82 (42%), Positives = 50/82 (60%), Gaps = 1/82 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAPT 243
           PT +PT  PT TP+PT   P  +  P+ TP     P+  P+P TP P+ +P+ +P P+PT
Sbjct: 119 PTPSPTPSPTPTPSPT---PTPSPTPSPTPSPTPTPSPTPSP-TPTPSPTPSPTPTPSPT 174

Query: 242 PASTPSTAPTPSTAGSPPAPTP 177
           P+ TP  +PTP     PP+P+P
Sbjct: 175 PSPTPPPSPTP-----PPSPSP 191

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 30/76 (39%), Positives = 41/76 (53%), Gaps = 7/76 (9%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPA-TPAPASSPA-----T 261
           P+  PT  PT TP+PT  P  + TP  +  P+ TP P+  P+P  TP+P  SP      T
Sbjct: 125 PSPTPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPPPSPT 184

Query: 260 SPPAPTPASTPSTAPT 213
            PP+P+P   P   P+
Sbjct: 185 PPPSPSPLGDPMYFPS 200

[57][TOP]
>UniRef100_Q1QHE7 OmpA/MotB n=1 Tax=Nitrobacter hamburgensis X14 RepID=Q1QHE7_NITHX
          Length = 673

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 50/106 (47%), Positives = 56/106 (52%), Gaps = 2/106 (1%)
 Frame = -3

Query: 425 QAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
           + P A P    PP A P P A  PAA  PP  TPPTATPP     PATP P ++P  +P 
Sbjct: 80  ERPAAPPPHAAPPHAPPPPAAARPAAPPPPHVTPPTATPP----RPATPPPHATPPAAPA 135

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
           AP  A  P  A TP  A  PPAP   +  P PS   TPP P+A  S
Sbjct: 136 APKAAPAPKPA-TPPVAPKPPAPPTAAPPPSPSKGTTPPPPAATKS 180

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 54/117 (46%), Positives = 57/117 (48%), Gaps = 14/117 (11%)
 Frame = -3

Query: 428 AQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPT-------ATPPAAVPAPATPAPA 276
           A  P AAP    PP A   P A PP   TPPTATPP        ATPPAA  AP   APA
Sbjct: 84  APPPHAAPPHAPPPPAAARPAAPPPPHVTPPTATPPRPATPPPHATPPAAPAAPKA-APA 142

Query: 275 SSPATSPPAPTPASTPSTAPTPS----TAGSPPAPTPDS-LGPGPSGADTPPSPSAA 120
             PAT P AP P + P+ AP PS    T   PPA T  +   P P    T PS   A
Sbjct: 143 PKPATPPVAPKPPAPPTAAPPPSPSKGTTPPPPAATKSAPTTPAPQPQTTSPSTPPA 199

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 45/101 (44%), Positives = 50/101 (49%), Gaps = 5/101 (4%)
 Frame = -3

Query: 419 PTAAP----TKPPTAT-PAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP 255
           PTA P    T PP AT PA  A P AA  P  ATPP A  P   PAP T AP  SP+   
Sbjct: 114 PTATPPRPATPPPHATPPAAPAAPKAAPAPKPATPPVAPKP---PAPPTAAPPPSPSKGT 170

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
             P PA+T S APT       PAP P +  P    A+  P+
Sbjct: 171 TPPPPAATKS-APT------TPAPQPQTTSPSTPPANGEPN 204

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 49/140 (35%), Positives = 58/140 (41%), Gaps = 12/140 (8%)
 Frame = -3

Query: 455 LGLLATSCLAQAPTAAPTKPPTATPAPTAQ--PPAAATPPTA----------TPPTATPP 312
           L LLATS L  A   AP     + P   AQ  P      P+A          +PP    P
Sbjct: 6   LVLLATSALTVASLTAPPLHAQSAPVQLAQAAPSTEKAAPSAESGNETKRKESPPKGPAP 65

Query: 311 AAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
            A  APA PAP       P AP P + P  AP P  A  P AP P  + P  +   TPP 
Sbjct: 66  KA--APAHPAPPPGAPERPAAPPPHAAPPHAPPPPAAARPAAPPPPHVTPPTA---TPPR 120

Query: 131 PSAAFSYSKPIIAATALSAA 72
           P+    ++ P  A  A  AA
Sbjct: 121 PATPPPHATPPAAPAAPKAA 140

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 42/108 (38%), Positives = 52/108 (48%), Gaps = 8/108 (7%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAA----TPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAST 231
           P   TPAP +  PAA     T P ATP T + P A PA   P+ A++PA + P   PA T
Sbjct: 235 PAQTTPAPGSTTPAAPDVTPTSPRATPATPSAPVASPAATPPSGAAAPAAATPPTGPAGT 294

Query: 230 PSTAPTPSTAGS----PPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
            +  P PST G     PP       GP       PP P++A +  KPI
Sbjct: 295 KAGTP-PSTPGGQTALPPGAPVSRHGPPTVTTPLPPPPTSAQAL-KPI 340

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 46/132 (34%), Positives = 52/132 (39%), Gaps = 36/132 (27%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-----------------------PA 309
           P  A TK    TPAP  Q  + +TPP    P AT                          
Sbjct: 173 PPPAATKSAPTTPAPQPQTTSPSTPPANGEPNATRRDERGRSGPGREHGGPGGPGDHRKG 232

Query: 308 AVPAPATPAPASSPATSPPAP--TPASTPSTAPTPSTAGSPPAPTPDS-----------L 168
           A PA  TPAP S   T+P AP  TP S  +T  TPS   + PA TP S            
Sbjct: 233 AAPAQTTPAPGS---TTPAAPDVTPTSPRATPATPSAPVASPAATPPSGAAAPAAATPPT 289

Query: 167 GPGPSGADTPPS 132
           GP  + A TPPS
Sbjct: 290 GPAGTKAGTPPS 301

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 38/108 (35%), Positives = 46/108 (42%), Gaps = 8/108 (7%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           AP   P  PP A P P A PP AA PP+ +  T  PP A    A   PA  P T+ P+  
Sbjct: 140 APAPKPATPPVA-PKPPA-PPTAAPPPSPSKGTTPPPPAATKSAPTTPAPQPQTTSPSTP 197

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSG--------ADTPPSPSA 123
           PA+    A      G    P  +  GPG  G        A T P+P +
Sbjct: 198 PANGEPNATRRDERGR-SGPGREHGGPGGPGDHRKGAAPAQTTPAPGS 244

[58][TOP]
>UniRef100_A5BMY8 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BMY8_VITVI
          Length = 138

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 59/144 (40%), Positives = 80/144 (55%), Gaps = 2/144 (1%)
 Frame = -3

Query: 479 AAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATP-PTATPPAAV 303
           ++V + ++  L+A S  AQ+P ++PT  P  T +PTA PP  ATPP+ TP P+ TP A  
Sbjct: 4   SSVVLVMMFALVAGSAFAQSPASSPTASP--TKSPTASPP-VATPPSPTPSPSTTPSAPA 60

Query: 302 PAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT-PPSPS 126
           PAP+T         SPPA TP+ T  + P P T+ + P  T  S  P  S   T PPSPS
Sbjct: 61  PAPST--------VSPPASTPSPTSGSPPAPPTSPASPPTTGASPSPSISTPPTEPPSPS 112

Query: 125 AAFSYSKPIIAATALSAALFAIAF 54
           AA   +   +  T  +AA+F  AF
Sbjct: 113 AA---ALNTVTFTGSAAAVFLGAF 133

[59][TOP]
>UniRef100_A3BLQ9 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A3BLQ9_ORYSJ
          Length = 240

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 53/127 (41%), Positives = 69/127 (54%), Gaps = 4/127 (3%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQ--PPAAATPPTATPPTA- 321
           MA +AA+ + L+  L+A S  AQ  T  P   P  TP  +++  P  AA P T TPP A 
Sbjct: 1   MARAAALCLALLC-LVAASASAQKATPTPAAAPATTPPASSKKTPAPAAAPTTTTPPAAS 59

Query: 320 TPPAAVPA-PATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
           TPPAA P  PATPAPA +P T  P   P +  + AP P+   +   P P S  P  +   
Sbjct: 60  TPPAAAPTTPATPAPAEAPTTPAPTKAPPTKSTKAPAPAPKAAKATPPPASSPPVEAPVA 119

Query: 143 TPPSPSA 123
           +PPSP+A
Sbjct: 120 SPPSPAA 126

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 55/143 (38%), Positives = 63/143 (44%), Gaps = 21/143 (14%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTK--PPTATPAPTAQPPAAATP----------PTATPPTATPPAAVP 300
           A+S    AP AAPT   PP A+  P A P   ATP          PT  PPT +  A  P
Sbjct: 38  ASSKKTPAPAAAPTTTTPPAASTPPAAAPTTPATPAPAEAPTTPAPTKAPPTKSTKAPAP 97

Query: 299 AP----ATPAPASSP-----ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA 147
           AP    ATP PASSP       SPP+P  A  P+T PT      P AP P    P     
Sbjct: 98  APKAAKATPPPASSPPVEAPVASPPSPA-AEAPATIPT-----KPDAPAP---APAKKKK 148

Query: 146 DTPPSPSAAFSYSKPIIAATALS 78
            +PPS     S   P  A  A++
Sbjct: 149 PSPPSKKKKKSSKAPAPAPVAVA 171

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 43/136 (31%), Positives = 62/136 (45%), Gaps = 14/136 (10%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKP---------PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT 288
           T+    AP  APT P          T  PAP  +   A  PP ++PP   P A+ P+PA 
Sbjct: 67  TTPATPAPAEAPTTPAPTKAPPTKSTKAPAPAPKAAKATPPPASSPPVEAPVASPPSPAA 126

Query: 287 PAPASSPATSPPAPTPASTPSTAPTPST-----AGSPPAPTPDSLGPGPSGADTPPSPSA 123
            APA+ P T P AP PA      P+P +     +   PAP P ++   P  +    +P+A
Sbjct: 127 EAPATIP-TKPDAPAPAPAKKKKPSPPSKKKKKSSKAPAPAPVAVAESPKHSKKAKAPAA 185

Query: 122 AFSYSKPIIAATALSA 75
           + +   P  A   ++A
Sbjct: 186 SSTADAPGPAGDGVAA 201

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 36/87 (41%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = -3

Query: 353 ATPPTATPPTATPPAAVPAPATPAPASSP-ATSPPAPT--PASTPSTAPTPSTAGSPPAP 183
           ATP  A  P  TPPA+  +  TPAPA++P  T+PPA +  PA+ P+T  TP+ A +P  P
Sbjct: 24  ATPTPAAAPATTPPAS--SKKTPAPAAAPTTTTPPAASTPPAAAPTTPATPAPAEAPTTP 81

Query: 182 TPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P    P  S     P+P AA +   P
Sbjct: 82  APTKAPPTKSTKAPAPAPKAAKATPPP 108

[60][TOP]
>UniRef100_Q9LIE8 Similarity to cell wall-plasma membrane linker protein n=1
            Tax=Arabidopsis thaliana RepID=Q9LIE8_ARATH
          Length = 1480

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 54/124 (43%), Positives = 65/124 (52%), Gaps = 2/124 (1%)
 Frame = -3

Query: 443  ATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
            AT  +A  P A P  T PPTATP P A PP A TPPTA PP ATPP A+P  A P   + 
Sbjct: 711  ATPPVATPPIAKPPTTIPPTATP-PVAMPPIA-TPPTAKPPIATPPIAIPPVAKPPVVTP 768

Query: 269  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAA 90
            P  +PP  TP    S   TP TA +PP  TP    P  +   T   P+A    +KP +A 
Sbjct: 769  PTATPPIATPPIAKSPVATPPTA-TPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVAT 827

Query: 89   TALS 78
              ++
Sbjct: 828  PPIA 831

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 52/120 (43%), Positives = 62/120 (51%), Gaps = 2/120 (1%)
 Frame = -3

Query: 446 LATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS 273
           +AT  +A++P A P    PP ATP P A+PP   TPPT TPPTATPP A P  ATP  A+
Sbjct: 525 IATPPIAKSPVATPPTATPPVATP-PIAKPPVV-TPPTTTPPTATPPVAKPPVATPPIAT 582

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
            P   PP  TP  + S   T      PPA TP    P P+       P A    +KP +A
Sbjct: 583 PPTAKPPISTPPISKSPVAT------PPAATPPITTPPPAKPPVATPPIATPPIAKPPVA 636

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 3/143 (2%)
 Frame = -3

Query: 497  PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT 318
            P +A+   V+  ++   +AT  +A++P A P   P  TP P A+PP A TPPTATPP AT
Sbjct: 1244 PPVATPPIVKPPIVTPPIATPPIAKSPIAPP---PIGTP-PIAKPPVA-TPPTATPPVAT 1298

Query: 317  PPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 138
             P A P  ATP PA+ P   PP  TP +      TP  A  P A  P +  P      TP
Sbjct: 1299 SPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPPGARPPVATPP----VATP 1354

Query: 137  P---SPSAAFSYSKPIIAATALS 78
            P   SP A    +KP +A++ ++
Sbjct: 1355 PIAKSPVATPPMTKPPVASSPIA 1377

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 53/120 (44%), Positives = 64/120 (53%), Gaps = 2/120 (1%)
 Frame = -3

Query: 446  LATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS 273
            +AT  +A++P A P    PP ATP P A+PP A TPPT  PPTATPP A P  ATP  A+
Sbjct: 775  IATPPIAKSPVATPPTATPPVATP-PIAKPPVA-TPPTTAPPTATPPVAKPPVATPPIAT 832

Query: 272  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
             P   PP  TP   P + P  +T   PPA TP    P P+       P A    +KP +A
Sbjct: 833  PPTAKPPILTP---PISKPPVAT---PPAATPPITTPPPAKPPVATPPIATPPIAKPPVA 886

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 58/144 (40%), Positives = 67/144 (46%), Gaps = 26/144 (18%)
 Frame = -3

Query: 446 LATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPT---------------AT 318
           +AT  +A+ P   P  T PPTATP P A+PP A TPP ATPPT               AT
Sbjct: 545 VATPPIAKPPVVTPPTTTPPTATP-PVAKPPVA-TPPIATPPTAKPPISTPPISKSPVAT 602

Query: 317 PPAAVPAPATPAPASSPATSPPAPT------PASTPSTAPTP---STAGSPPAPTPDSLG 165
           PPAA P   TP PA  P  +PP  T      P +TP TA  P   S    PP  TP    
Sbjct: 603 PPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKT 662

Query: 164 PGPSGADTPPSPSAAFSYSKPIIA 93
           P P+       P A    +KP +A
Sbjct: 663 PPPAKPPVAIPPIATPPVAKPPVA 686

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 58/144 (40%), Positives = 67/144 (46%), Gaps = 26/144 (18%)
 Frame = -3

Query: 446  LATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPT---------------AT 318
            +AT  +A+ P A P  T PPTATP P A+PP A TPP ATPPT               AT
Sbjct: 795  VATPPIAKPPVATPPTTAPPTATP-PVAKPPVA-TPPIATPPTAKPPILTPPISKPPVAT 852

Query: 317  PPAAVPAPATPAPASSPATSPPAPT------PASTPSTAPTP---STAGSPPAPTPDSLG 165
            PPAA P   TP PA  P  +PP  T      P +TP TA  P   S    PP   P    
Sbjct: 853  PPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKT 912

Query: 164  PGPSGADTPPSPSAAFSYSKPIIA 93
            P P+       P A    +KP +A
Sbjct: 913  PPPAKPPVAIPPIATPPVAKPPVA 936

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 54/128 (42%), Positives = 62/128 (48%), Gaps = 5/128 (3%)
 Frame = -3

Query: 443  ATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
            AT  +A  P A P    PPTATP P A PP A  PPT  PPTATPP A+P  ATP  A  
Sbjct: 691  ATPPIATPPIATPPVVTPPTATP-PVATPPIAK-PPTTIPPTATPPVAMPPIATPPTAKP 748

Query: 269  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS---PSAAFSYSKPI 99
            P  +PP   P        TP TA  P A  P +  P      TPP+   P A    +KP 
Sbjct: 749  PIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSP----VATPPTATPPVATPPIAKPP 804

Query: 98   IAATALSA 75
            +A    +A
Sbjct: 805  VATPPTTA 812

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 47/107 (43%), Positives = 57/107 (53%), Gaps = 3/107 (2%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPTKPPTATP---APTAQPPAAATPPTATPPTATPPAAVPAPATPAPA 276
           +AT  +A++P A P   PTATP    P  + P  ATPPT TPPTATPP A P   TP  A
Sbjct: 405 VATPPIAKSPIATP---PTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIA 461

Query: 275 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           + P   PP  TP  +     TP  A +PP  TP  + P  +   TPP
Sbjct: 462 TPPTAKPPISTPPISKPPVATP-PAATPPITTPTPVKPPVA---TPP 504

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 51/127 (40%), Positives = 63/127 (49%), Gaps = 5/127 (3%)
 Frame = -3

Query: 446 LATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS 273
           +AT  +A++P A P    PPTATP  T  P   ATPP  TPP A PP  +P  ATP  A+
Sbjct: 217 IATPPIAKSPVATPPIATPPTATPPITIPP--VATPPITTPPIANPPIIMPPIATPPVAA 274

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS---PSAAFSYSKP 102
            P T+PP   P  T     TP  A  P A  P S  P    A TPP+   P      +KP
Sbjct: 275 PPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPP----AATPPAATPPITTLPPAKP 330

Query: 101 IIAATAL 81
            +A + +
Sbjct: 331 PVAISPI 337

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 56/140 (40%), Positives = 68/140 (48%), Gaps = 11/140 (7%)
 Frame = -3

Query: 446  LATSCLAQAPTAAP--TKPPTATP----APTAQPPAAATPPTATPPTATPPAAVPAPATP 285
            +AT  +A  P A P    PPTATP    +P A+PP A TPP  TPP A PP A+P  ATP
Sbjct: 620  VATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVA-TPPIKTPPPAKPPVAIPPIATP 678

Query: 284  APASSPATSPPAPTP--ASTPSTAP---TPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
              A  P  +PP  TP  A+ P   P   TP TA +PP  TP    P  +   T   P A 
Sbjct: 679  PVAKPPVATPPTATPPIATPPIATPPVVTPPTA-TPPVATPPIAKPPTTIPPTATPPVAM 737

Query: 119  FSYSKPIIAATALSAALFAI 60
               + P  A   ++    AI
Sbjct: 738  PPIATPPTAKPPIATPPIAI 757

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 54/134 (40%), Positives = 64/134 (47%), Gaps = 16/134 (11%)
 Frame = -3

Query: 446  LATSCLAQAPTAAP-------TKPPTATPA----PTAQPPAA----ATPPTATPPTATPP 312
            +A   +A  PTA P        KPP ATP     P A+PP A    ATPP A PP ATPP
Sbjct: 630  IAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPP 689

Query: 311  AAVPAPATPAPASSPATSPPAPT-PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
             A P  ATP  A+ P  +PP  T P +TP  A  P+T   PP  TP    P  +   T  
Sbjct: 690  TATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTI--PPTATPPVAMPPIATPPTAK 747

Query: 134  SPSAAFSYSKPIIA 93
             P A    + P +A
Sbjct: 748  PPIATPPIAIPPVA 761

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 50/118 (42%), Positives = 61/118 (51%)
 Frame = -3

Query: 446  LATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP 267
            +ATS +A+ P A P   P  TP P A+PP A  PP ATPP A PP A P  ATP  A+SP
Sbjct: 895  IATSPVAKPPVAIP---PIKTPPP-AKPPVAI-PPIATPPVAKPPVATPPTATPPIATSP 949

Query: 266  ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
              +PP  TP +  S   TP  A  PP  TP +  P  +       P+A    + P IA
Sbjct: 950  IATPPVVTPPTATSPVATPPIA-KPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIA 1006

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 52/132 (39%), Positives = 64/132 (48%), Gaps = 9/132 (6%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPT-------KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT 288
           +A S +A  PTA P        KPP ATP PT  PP A TPP A PP  TPP A P  A 
Sbjct: 410 IAKSPIATPPTATPPVATPPIEKPPVATP-PTTTPPTA-TPPVAKPPVETPPIATPPTAK 467

Query: 287 PAPASSPATSPPAPTP--ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
           P  ++ P + PP  TP  A+ P T PTP     PP  TP    P  +       P+A   
Sbjct: 468 PPISTPPISKPPVATPPAATPPITTPTPV---KPPVATPPLAIPPVAKPPVVTPPTATPP 524

Query: 113 YSKPIIAATALS 78
            + P IA + ++
Sbjct: 525 IATPPIAKSPVA 536

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 49/129 (37%), Positives = 63/129 (48%), Gaps = 6/129 (4%)
 Frame = -3

Query: 446 LATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS 273
           +AT  + + P A P  T PPTATP P A+PP   TPP ATPPTA PP + P  + P  A+
Sbjct: 425 VATPPIEKPPVATPPTTTPPTATP-PVAKPPVE-TPPIATPPTAKPPISTPPISKPPVAT 482

Query: 272 SPATSPPAPTPASTPSTAPTPSTA----GSPPAPTPDSLGPGPSGADTPPSPSAAFSYSK 105
            PA +PP  TP        TP  A      PP  TP +  P  +      SP A    + 
Sbjct: 483 PPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTAT 542

Query: 104 PIIAATALS 78
           P +A   ++
Sbjct: 543 PPVATPPIA 551

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 54/128 (42%), Positives = 60/128 (46%), Gaps = 13/128 (10%)
 Frame = -3

Query: 446  LATSCLAQAP--TAAPTKPPTATPA----PTAQPPAA----ATPPTATPPTATPPAAVPA 297
            +AT   A  P  T  P KPP ATP     P A+PP A    ATPP AT P A PP A+P 
Sbjct: 850  VATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPP 909

Query: 296  PATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP---SPS 126
              TP PA  P   PP  TP        TP TA  P A +P +  P      TPP   SP 
Sbjct: 910  IKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPP----VVTPPTATSPV 965

Query: 125  AAFSYSKP 102
            A    +KP
Sbjct: 966  ATPPIAKP 973

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 48/125 (38%), Positives = 61/125 (48%), Gaps = 2/125 (1%)
 Frame = -3

Query: 446 LATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS 273
           +AT   A+ P + P  +KPP ATP P A PP   TP    PP ATPP A+P  A P   +
Sbjct: 460 IATPPTAKPPISTPPISKPPVATP-PAATPPIT-TPTPVKPPVATPPLAIPPVAKPPVVT 517

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
            P  +PP  TP    S   TP TA +PP  TP    P      T   P+A    +KP +A
Sbjct: 518 PPTATPPIATPPIAKSPVATPPTA-TPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVA 576

Query: 92  ATALS 78
              ++
Sbjct: 577 TPPIA 581

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 57/147 (38%), Positives = 64/147 (43%), Gaps = 29/147 (19%)
 Frame = -3

Query: 446  LATSCLAQAPTAAP------------TKPPTATPAPTAQPPA---AATPPTATPPTATPP 312
            +AT  +A  PTA P              PP ATP  T  PPA    ATPP ATPP A PP
Sbjct: 825  VATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPP 884

Query: 311  AAVPAPATPAPASSPATSPP-------APTPASTPSTAPTPST--AGSPPAPTPDSLGP- 162
             A P  ATP  A+SP   PP        P PA  P   P  +T     PP  TP +  P 
Sbjct: 885  VATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPP 944

Query: 161  -GPSGADTPP---SPSAAFSYSKPIIA 93
               S   TPP    P+A    + P IA
Sbjct: 945  IATSPIATPPVVTPPTATSPVATPPIA 971

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 56/138 (40%), Positives = 70/138 (50%), Gaps = 15/138 (10%)
 Frame = -3

Query: 446  LATSCLAQAPTAAP--TKPPTATP----APTAQPPAAATPPTATPPTATPPAAVPAPATP 285
            +AT  +A  P A P    PPTATP    +P A+PP A  PP  TPP A PP A+P  ATP
Sbjct: 870  VATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAI-PPIKTPPPAKPPVAIPPIATP 928

Query: 284  APASSPATSPPAPTP--ASTPSTAP---TPSTAGSPPAPTPDSLGPGPS-GADTPP---S 132
              A  P  +PP  TP  A++P   P   TP TA SP A  P +  P  +    TPP    
Sbjct: 929  PVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMP 988

Query: 131  PSAAFSYSKPIIAATALS 78
            P A    +KP +A   ++
Sbjct: 989  PIATPPTAKPPVATPPIA 1006

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 52/125 (41%), Positives = 56/125 (44%), Gaps = 10/125 (8%)
 Frame = -3

Query: 446 LATSCLAQAP--TAAPTKPPTATPA----PTAQPPAA----ATPPTATPPTATPPAAVPA 297
           +AT   A  P  T  P KPP ATP     P A+PP A    ATPP AT P A PP A P 
Sbjct: 600 VATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPP 659

Query: 296 PATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAF 117
             TP PA  P   PP  TP        TP TA +PP  TP    P      T   P A  
Sbjct: 660 IKTPPPAKPPVAIPPIATPPVAKPPVATPPTA-TPPIATPPIATPPVVTPPTATPPVATP 718

Query: 116 SYSKP 102
             +KP
Sbjct: 719 PIAKP 723

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 50/115 (43%), Positives = 61/115 (53%), Gaps = 7/115 (6%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAA--ATPPTATPPTATPPAAVPAPATPAPASSPATSPP-AP 246
           T  P KPP A  +P   PP    A PP ATPPTATPP A P  ATP  + SP ++PP + 
Sbjct: 324 TLPPAKPPVAI-SPIVTPPVTPIAQPPVATPPTATPPVATPPIATPPTSKSPISTPPISE 382

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGP-GPSGADTPPS---PSAAFSYSKPIIA 93
           +P +TP TA +P     PPA  P +  P   S   TPP+   P A     KP +A
Sbjct: 383 SPVATPPTATSPIKT-PPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVA 436

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 52/131 (39%), Positives = 59/131 (45%), Gaps = 14/131 (10%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPT--KPPTATPA----PTAQPPAA----ATPPTATPPTATPPAAVPA 297
           +AT   A  P   PT  KPP ATP     P A+PP      ATPP ATPP A  P A P 
Sbjct: 480 VATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPP 539

Query: 296 PATPAPASSPATSPPAPTPASTPSTAPTPSTA----GSPPAPTPDSLGPGPSGADTPPSP 129
            ATP  A+ P   PP  TP +T     TP  A     +PP  TP +  P  S      SP
Sbjct: 540 TATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSP 599

Query: 128 SAAFSYSKPII 96
            A    + P I
Sbjct: 600 VATPPAATPPI 610

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 47/129 (36%), Positives = 60/129 (46%), Gaps = 6/129 (4%)
 Frame = -3

Query: 446 LATSCLAQAPTAAP--TKPPTATPAPTAQP---PAAATPPTATPPTATPPAAVPAPATPA 282
           ++T  +++ P A P    PP  TP P   P   P  A PP A PP  TPP A P  ATP 
Sbjct: 470 ISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPP 529

Query: 281 PASSPATSPPAPTP-ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSK 105
            A SP  +PP  TP  +TP  A  P    +PP  TP +  P  +       P A    +K
Sbjct: 530 IAKSPVATPPTATPPVATPPIAKPPVV--TPPTTTPPTATPPVAKPPVATPPIATPPTAK 587

Query: 104 PIIAATALS 78
           P I+   +S
Sbjct: 588 PPISTPPIS 596

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 55/143 (38%), Positives = 67/143 (46%), Gaps = 20/143 (13%)
 Frame = -3

Query: 446  LATSCLAQAPTAAP-------TKPPTATPA----PTAQPPAA----ATPPTATPPTATPP 312
            +ATS +A+ P A P        KPP A P     P A+PP A    ATPP ATPP ATPP
Sbjct: 645  IATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPP 704

Query: 311  AAVPAPATPAPASSPATSPPAP-TPASTPSTA----PTPSTAGSPPAPTPDSLGPGPSGA 147
               P  ATP  A+ P   PP    P +TP  A     TP TA  PP  TP    P  +  
Sbjct: 705  VVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTA-KPPIATPPIAIPPVAKP 763

Query: 146  DTPPSPSAAFSYSKPIIAATALS 78
                 P+A    + P IA + ++
Sbjct: 764  PVVTPPTATPPIATPPIAKSPVA 786

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 55/134 (41%), Positives = 64/134 (47%), Gaps = 16/134 (11%)
 Frame = -3

Query: 446  LATSCLAQAPTAAPT-------KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT 288
            +AT  +A+ P A+P        KPP ATP P  +PP A TPP ATPP A PP A     T
Sbjct: 1176 VATPPMAKPPVASPPIATPPIIKPPVATP-PITKPPVA-TPPVATPPIAKPPVATSPIET 1233

Query: 287  PAPASSPATSPPAPTP--ASTPSTAP---TPSTAGSPPAPTPDSLGP-GPSGADTPPS-- 132
            P  A  P T+PP  TP     P   P   TP  A SP AP P    P       TPP+  
Sbjct: 1234 PPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTAT 1293

Query: 131  -PSAAFSYSKPIIA 93
             P A    +KP +A
Sbjct: 1294 PPVATSPIAKPPVA 1307

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 45/100 (45%), Positives = 52/100 (52%), Gaps = 7/100 (7%)
 Frame = -3

Query: 446  LATSCLAQAPTAAP-------TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT 288
            +ATS +A+ P A P        KPP ATP PT  PP A TPP A PP A PP A P  AT
Sbjct: 1296 VATSPIAKPPVATPPPATPPVAKPPVATP-PTVTPPVA-TPPIAKPPGARPPVATPPVAT 1353

Query: 287  PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL 168
            P  A SP  +PP   P    S   TP  A +P A  P ++
Sbjct: 1354 PPIAKSPVATPPMTKPPVASSPIATPPIAKTPIATPPTTM 1393

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 52/127 (40%), Positives = 57/127 (44%), Gaps = 10/127 (7%)
 Frame = -3

Query: 443  ATSCLAQAPTAAP--TKPPTATPA----PTAQPPAA----ATPPTATPPTATPPAAVPAP 294
            AT  +A  P A P   KPP ATP     P A+PP      ATPP ATPP A  P A P  
Sbjct: 731  ATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPT 790

Query: 293  ATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
            ATP  A+ P   PP  TP +T     TP  A  PP  TP    P      T   P     
Sbjct: 791  ATPPVATPPIAKPPVATPPTTAPPTATPPVA-KPPVATPPIATP-----PTAKPPILTPP 844

Query: 113  YSKPIIA 93
             SKP +A
Sbjct: 845  ISKPPVA 851

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 54/141 (38%), Positives = 61/141 (43%), Gaps = 18/141 (12%)
 Frame = -3

Query: 446  LATSCLAQAPTAAPT-------KPPTATPA----PTAQPPAAATP----PTATPPTATPP 312
            +AT   A+ P A P        KPP ATP     PT  PP A  P    PTATPPTATPP
Sbjct: 990  IATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPP 1049

Query: 311  AAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP- 135
             A+P    P  A  P T PP  TP  T      P     PP  TP       S   TPP 
Sbjct: 1050 VAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPI---AKSPIATPPV 1106

Query: 134  --SPSAAFSYSKPIIAATALS 78
               P A    + P +A T ++
Sbjct: 1107 STPPIAKPPIATPPVATTPIA 1127

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/109 (43%), Positives = 54/109 (49%), Gaps = 2/109 (1%)
 Frame = -3

Query: 443  ATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
            AT  +A +P A P    PPTAT +P A PP A  PPT TPPTATPP A+P  ATP  A  
Sbjct: 941  ATPPIATSPIATPPVVTPPTAT-SPVATPPIAK-PPTTTPPTATPPVAMPPIATPPTAKP 998

Query: 269  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
            P  +PP   P        TP  A  PP   P    P    + T   P+A
Sbjct: 999  PVATPPIANPPVEKPPVATPPIA-KPPTVLPPIAKPPVETSPTATPPTA 1046

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 53/121 (43%), Positives = 60/121 (49%), Gaps = 12/121 (9%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT 288
           +I+  +AT  +A  P   P  +KPP  TP PT  PP A  PP ATPP +TPPAA P  AT
Sbjct: 262 IIMPPIATPPVAAPPITNPPISKPPVTTP-PTTTPPIAK-PPIATPPISTPPAATPPAAT 319

Query: 287 P-----APASSPATSPPAPTPASTPSTAP---TPSTAGSPPAPTPDSLGP--GPSGADTP 138
           P      PA  P    P  TP  TP   P   TP TA +PP  TP    P    S   TP
Sbjct: 320 PPITTLPPAKPPVAISPIVTPPVTPIAQPPVATPPTA-TPPVATPPIATPPTSKSPISTP 378

Query: 137 P 135
           P
Sbjct: 379 P 379

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 52/121 (42%), Positives = 60/121 (49%), Gaps = 3/121 (2%)
 Frame = -3

Query: 446  LATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS 273
            +AT  +A+ PT  P   KPP  T +PTA PP A TPP A PP   PP A+P    P  A+
Sbjct: 1015 VATPPIAKPPTVLPPIAKPPVET-SPTATPPTA-TPPVAIPPVVKPPVAIPPITKPPVAT 1072

Query: 272  SPATSPP-APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPII 96
             P T+PP A  P  TP    TP  A SP A  P S  P        P P A    +KP I
Sbjct: 1073 PPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATP-PVATTPIAKPPI 1131

Query: 95   A 93
            A
Sbjct: 1132 A 1132

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 48/115 (41%), Positives = 56/115 (48%), Gaps = 11/115 (9%)
 Frame = -3

Query: 446  LATSCLAQAPTAAP-------TKPPTATPAPTAQP---PAAATPPTATPPTATPPAAVPA 297
            +A   +A  PTA P        KPP ATP P   P   P  ATPPT TPP ATPP A P 
Sbjct: 1281 IAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPP 1340

Query: 296  PATPAPASSPATSPP-APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
             A P  A+ P  +PP A +P +TP     P  A SP A  P +  P  +   T P
Sbjct: 1341 GARPPVATPPVATPPIAKSPVATPPMT-KPPVASSPIATPPIAKTPIATPPTTMP 1394

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 51/124 (41%), Positives = 63/124 (50%), Gaps = 9/124 (7%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPTKPPTATPAPTAQPPAA----ATPPTATPPTATPPAAVPAPATPAP 279
           +A S +   P     +PP ATP PTA PP A    ATPPT+  P +TPP +    ATP  
Sbjct: 332 VAISPIVTPPVTPIAQPPVATP-PTATPPVATPPIATPPTSKSPISTPPISESPVATPPT 390

Query: 278 ASSP-ATSPPAPTPASTP----STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
           A+SP  T PPA  P +TP    S   TP TA +PP  TP    P  +   T   P+A   
Sbjct: 391 ATSPIKTPPPAKPPVATPPIAKSPIATPPTA-TPPVATPPIEKPPVATPPTTTPPTATPP 449

Query: 113 YSKP 102
            +KP
Sbjct: 450 VAKP 453

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 48/114 (42%), Positives = 56/114 (49%), Gaps = 2/114 (1%)
 Frame = -3

Query: 497  PKMASSAAVQIFLILGLLATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPT 324
            P +A+S      ++    ATS +A  P A P  T PPTATP P A PP A TPPTA PP 
Sbjct: 943  PPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATP-PVAMPPIA-TPPTAKPPV 1000

Query: 323  ATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP 162
            ATPP A P    P  A+ P   PP   P        T  TA  P A  P ++ P
Sbjct: 1001 ATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPP 1054

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 51/134 (38%), Positives = 64/134 (47%), Gaps = 11/134 (8%)
 Frame = -3

Query: 446 LATSCLAQAPTAAP--TKPPTATP----APTAQPPAA----ATPPTATPPTATPPAAVPA 297
           +A   +A  PTA P    PP ATP    +P + PP +    ATPPTAT P  TPP A P 
Sbjct: 345 IAQPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKPP 404

Query: 296 PATPAPASSPATSPPAPT-PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            ATP  A SP  +PP  T P +TP     P    +PP  TP +  P  +       P A 
Sbjct: 405 VATPPIAKSPIATPPTATPPVATPPIEKPP--VATPPTTTPPTATPPVAKPPVETPPIAT 462

Query: 119 FSYSKPIIAATALS 78
              +KP I+   +S
Sbjct: 463 PPTAKPPISTPPIS 476

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 52/138 (37%), Positives = 62/138 (44%), Gaps = 20/138 (14%)
 Frame = -3

Query: 446  LATSCLAQAPTAAPT-------KPPTATPAPTAQPPAA----ATPPTATPPTATPPAAVP 300
            +A   +A  PTA P+       KPP ATP P A+PP A    ATPP   PP ATPP   P
Sbjct: 1151 IAKPPIATPPTAMPSIATPPIGKPPVATP-PMAKPPVASPPIATPPIIKPPVATPPITKP 1209

Query: 299  APATPAPASSPATSPP-APTPASTPSTAPTPSTAG--------SPPAPTPDSLGPGPSGA 147
              ATP  A+ P   PP A +P  TP  A  P T           PP  TP    P  + +
Sbjct: 1210 PVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKS 1269

Query: 146  DTPPSPSAAFSYSKPIIA 93
               P P      +KP +A
Sbjct: 1270 PIAPPPIGTPPIAKPPVA 1287

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 45/113 (39%), Positives = 53/113 (46%), Gaps = 4/113 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQ--PPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           P    T PP +TP P     PP   TPP A+PP ATPP  +P  ATP  A SP  +PP  
Sbjct: 174 PKPPTTNPPPSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIA 233

Query: 245 TP--ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
           TP  A+ P T P  +T   PP  TP    P          P AA   + P I+
Sbjct: 234 TPPTATPPITIPPVAT---PPITTPPIANPPIIMPPIATPPVAAPPITNPPIS 283

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 45/118 (38%), Positives = 56/118 (47%), Gaps = 2/118 (1%)
 Frame = -3

Query: 446 LATSCLAQAPTA-APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
           ++ S +A  PTA +P K P     P A PP A +P  ATPPTATPP A P    P  A+ 
Sbjct: 380 ISESPVATPPTATSPIKTPPPAKPPVATPPIAKSP-IATPPTATPPVATPPIEKPPVATP 438

Query: 269 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP-GPSGADTPPSPSAAFSYSKPI 99
           P T+PP  TP        TP  A  P A  P S  P       TPP+ +   +   P+
Sbjct: 439 PTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPV 496

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 53/160 (33%), Positives = 69/160 (43%), Gaps = 25/160 (15%)
 Frame = -3

Query: 497  PKMASSAAVQIFLILGLLATSCLAQAPTAAP-------TKPPTATPAPTAQPPAAA---- 351
            P +A+S   +  + +  + T   A+ P A P        KPP ATP PTA PP A     
Sbjct: 893  PPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATP-PTATPPIATSPIA 951

Query: 350  -----TPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTA----- 201
                 TPPTAT P ATPP A P   TP  A+ P   PP  TP +      TP  A     
Sbjct: 952  TPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVE 1011

Query: 200  ----GSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
                 +PP   P ++ P  +      SP+A    + P +A
Sbjct: 1012 KPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVA 1051

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 51/138 (36%), Positives = 59/138 (42%), Gaps = 20/138 (14%)
 Frame = -3

Query: 446  LATSCLAQAPTAAP--TKPPTATPA----PTAQPPAAA--------------TPPTATPP 327
            +AT  + + P A P  TKPP ATP     P A+PP A               TPP ATPP
Sbjct: 1191 IATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPP 1250

Query: 326  TATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA 147
               PP   P  ATP  A SP   PP  TP        TP TA  P A +P  +   P   
Sbjct: 1251 IVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSP--IAKPPVAT 1308

Query: 146  DTPPSPSAAFSYSKPIIA 93
              P +P  A    KP +A
Sbjct: 1309 PPPATPPVA----KPPVA 1322

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 51/135 (37%), Positives = 60/135 (44%), Gaps = 14/135 (10%)
 Frame = -3

Query: 440  TSCLAQAPTAAP-------TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP-ATP 285
            TS  A  PTA P        KPP A P P  +PP A TPP   PPTA PP   P P  TP
Sbjct: 1037 TSPTATPPTATPPVAIPPVVKPPVAIP-PITKPPVA-TPPVTNPPTAMPPIVTPPPIVTP 1094

Query: 284  APASSPATSPPAPT------PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
              A SP  +PP  T      P +TP  A TP     PP  TP +  P  +      SP A
Sbjct: 1095 PIAKSPIATPPVSTPPIAKPPIATPPVATTP--IAKPPIATPPTANPPVANPPIAKSPIA 1152

Query: 122  AFSYSKPIIAATALS 78
                + P  A  +++
Sbjct: 1153 KPPIATPPTAMPSIA 1167

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 48/138 (34%), Positives = 60/138 (43%), Gaps = 20/138 (14%)
 Frame = -3

Query: 431  LAQAPTAAP--TKPPTATPA----PTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
            + + P A P  TKPP ATP     PTA PP    PP  TPP A  P A P  +TP  A  
Sbjct: 1055 VVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKP 1114

Query: 269  PATSPPAPT------PASTPSTAPTP--------STAGSPPAPTPDSLGPGPSGADTPPS 132
            P  +PP  T      P +TP TA  P        S    PP  TP +  P  +       
Sbjct: 1115 PIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKP 1174

Query: 131  PSAAFSYSKPIIAATALS 78
            P A    +KP +A+  ++
Sbjct: 1175 PVATPPMAKPPVASPPIA 1192

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 46/123 (37%), Positives = 52/123 (42%), Gaps = 9/123 (7%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-----PAAVPAPATPAPASSPATSP 255
           P     KPP  TP P    P  ATPPT  PP ATP     P A P  ATP  A+ P T P
Sbjct: 186 PQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIP 245

Query: 254 PAPT-PASTPSTAPTP---STAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAAT 87
           P  T P +TP  A  P       +PP   P    P  S       P+     +KP IA  
Sbjct: 246 PVATPPITTPPIANPPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATP 305

Query: 86  ALS 78
            +S
Sbjct: 306 PIS 308

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 49/117 (41%), Positives = 55/117 (47%), Gaps = 17/117 (14%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAA---------ATPPTATPPTATPPAAVPAPATPAPASSP 267
           PT     PP ATP PT  PP A         ATPP ATPPTATPP  +P  ATP   + P
Sbjct: 198 PTPPVASPPMATP-PTQMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPP 256

Query: 266 ATSPP-APTPASTPSTAPTPST---AGSPPAPTPDSLGP--GPSGADTPP--SPSAA 120
             +PP    P +TP  A  P T      PP  TP +  P        TPP  +P AA
Sbjct: 257 IANPPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPPAA 313

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 52/160 (32%), Positives = 67/160 (41%), Gaps = 37/160 (23%)
 Frame = -3

Query: 446 LATSCLAQAPTAAP--TKPPTATPA--------------PTAQPPAAATP---------P 342
           +AT  +A  PTA P  T PP ATP               P A PP AA P         P
Sbjct: 227 VATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITNPPISKPP 286

Query: 341 TATPPTATPPAAVPAPATPAPASSPATSPPAPTP------------ASTPSTAPTPSTAG 198
             TPPT TPP A P  ATP  ++ PA +PPA TP            A +P   P  +   
Sbjct: 287 VTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLPPAKPPVAISPIVTPPVTPIA 346

Query: 197 SPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALS 78
            PP  TP +  P  +       P++    S P I+ + ++
Sbjct: 347 QPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPVA 386

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 50/125 (40%), Positives = 60/125 (48%), Gaps = 7/125 (5%)
 Frame = -3

Query: 446  LATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS 273
            + T  +A++P A P  + PP A P P A PP A TP  A PP ATPP A P  A P  A 
Sbjct: 1091 IVTPPIAKSPIATPPVSTPPIAKP-PIATPPVATTP-IAKPPIATPPTANPPVANPPIAK 1148

Query: 272  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD--TPP---SPSAAFSYS 108
            SP   PP  TP +   +  TP   G PP  TP    P  +     TPP    P A    +
Sbjct: 1149 SPIAKPPIATPPTAMPSIATP-PIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPIT 1207

Query: 107  KPIIA 93
            KP +A
Sbjct: 1208 KPPVA 1212

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 49/132 (37%), Positives = 60/132 (45%), Gaps = 14/132 (10%)
 Frame = -3

Query: 446 LATSCLAQAPTAAP--TKPPTATPAPTAQP---PAAATPPTATPPTATPPAAVPAPATPA 282
           ++T  ++++P A P    PP  TP P   P   P  ATPP A PP ATPP A P  AT  
Sbjct: 590 ISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSP 649

Query: 281 PASSPATSPP--APTPASTPSTAPTPST--AGSPPAPTPDSLGP--GPSGADTPP---SP 129
            A  P  +PP   P PA  P   P  +T     PP  TP +  P        TPP    P
Sbjct: 650 VAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPP 709

Query: 128 SAAFSYSKPIIA 93
           +A    + P IA
Sbjct: 710 TATPPVATPPIA 721

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 53/124 (42%), Positives = 58/124 (46%), Gaps = 20/124 (16%)
 Frame = -3

Query: 446  LATSCLAQAPTAAP--TKPPTATPAPTAQPPAA----ATPPTATPPT-----ATPPAAVP 300
            +AT  +A  P A P    PPTA P P A PP A    A PP ATPPT     ATPP   P
Sbjct: 1116 IATPPVATTPIAKPPIATPPTANP-PVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKP 1174

Query: 299  APATPAPASSPATSPPAPTP-------ASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGA 147
              ATP  A  P  SPP  TP       A+ P T P  +T   PP  TP    P    S  
Sbjct: 1175 PVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVAT---PPVATPPIAKPPVATSPI 1231

Query: 146  DTPP 135
            +TPP
Sbjct: 1232 ETPP 1235

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 48/122 (39%), Positives = 59/122 (48%), Gaps = 4/122 (3%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPTKPPTATPAPTAQPPA---AATPPTATPPTATPPAAVPAPATPAPA 276
           ++T  ++++P A P   PTAT      PPA    ATPP A  P ATPP A P  ATP   
Sbjct: 375 ISTPPISESPVATP---PTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIE 431

Query: 275 SSPATSPPAPT-PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
             P  +PP  T P +TP  A  P    +PP  TP +  P  S   TPP        SKP 
Sbjct: 432 KPPVATPPTTTPPTATPPVAKPP--VETPPIATPPTAKPPIS---TPP-------ISKPP 479

Query: 98  IA 93
           +A
Sbjct: 480 VA 481

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 42/109 (38%), Positives = 48/109 (44%), Gaps = 6/109 (5%)
 Frame = -3

Query: 401 KPPTATPAP----TAQPPAAATPPTATPPTAT--PPAAVPAPATPAPASSPATSPPAPTP 240
           KPPT  P P       PP+   PPT  PP +T  PP   P P TP P   P  SPP  TP
Sbjct: 154 KPPTIKPPPKPPSVKPPPSTPKPPTTNPPPSTPQPPTHKPPPCTPTP---PVASPPMATP 210

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
            +      TP  A SP A  P +  P  +   T P P A    + P IA
Sbjct: 211 PTQMPPIATPPIAKSPVATPPIATPPTATPPITIP-PVATPPITTPPIA 258

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 33/96 (34%), Positives = 38/96 (39%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPA 237
           +  P KPP   P P  +PP    PP    P   PP   P P  P P + P    P P P 
Sbjct: 43  SVVPPKPPAVKPHPHPKPPTIKPPPPKRHPHPKPPTVKPHP-HPKPPTKP---HPHPKPP 98

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           + P   P P T   PP P P    P P   +  P P
Sbjct: 99  TKPHPHPKPPTIKPPPHPKP---RPHPKPPNVKPHP 131

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 40/113 (35%), Positives = 50/113 (44%), Gaps = 5/113 (4%)
 Frame = -3

Query: 401 KPPTATPAPTAQPPAA----ATPPTATPPTATPPAAVPAPATP-APASSPATSPPAPTPA 237
           KPPT  P P  +PP        PPT  PP   PP+  P P+TP  P ++P  S P P   
Sbjct: 134 KPPTK-PHPHPKPPTKHHPHPKPPTIKPP-PKPPSVKPPPSTPKPPTTNPPPSTPQPPTH 191

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALS 78
             P   PTP  A SPP  TP +  P  +      SP A    + P  A   ++
Sbjct: 192 KPPPCTPTPPVA-SPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPIT 243

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 32/73 (43%), Positives = 38/73 (52%), Gaps = 2/73 (2%)
 Frame = -3

Query: 440  TSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP 267
            T  +A  P A P   +PP ATP P A PP A +P  ATPP   PP A    ATP  A +P
Sbjct: 1328 TPPVATPPIAKPPGARPPVATP-PVATPPIAKSP-VATPPMTKPPVASSPIATPPIAKTP 1385

Query: 266  ATSPPAPTPASTP 228
              +PP   P + P
Sbjct: 1386 IATPPTTMPKTCP 1398

[61][TOP]
>UniRef100_B6TRK7 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6TRK7_MAIZE
          Length = 380

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 58/133 (43%), Positives = 67/133 (50%), Gaps = 22/133 (16%)
 Frame = -3

Query: 452 GLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV--PAPATPAP 279
           G  A    A +P  A T PP ++P   A PP +ATPP   PP A+P  AV  PAPATPAP
Sbjct: 190 GAAAPPTAAASPQLAATLPPVSSPPLAATPPVSATPPATLPPVASPTVAVAAPAPATPAP 249

Query: 278 ASSP--ATSPPAPTPASTPST-APTPSTAG----------SPPAPTPDSLGPGPSGADTP 138
            +SP  A  P A  PA+ P   APTP  A           + PAP P S  P PS A TP
Sbjct: 250 VASPPVAMPPAALAPATLPPVMAPTPLLAAPVMPPIAPPVTAPAPAPVSPAPSPSVAPTP 309

Query: 137 -------PSPSAA 120
                  PSP+ A
Sbjct: 310 SPTEAPTPSPTEA 322

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 47/140 (33%), Positives = 58/140 (41%), Gaps = 29/140 (20%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATP------------------PTATPPAAVPA 297
           +PT A   P  ATPAP A PP A  P    P                  P   PP   PA
Sbjct: 234 SPTVAVAAPAPATPAPVASPPVAMPPAALAPATLPPVMAPTPLLAAPVMPPIAPPVTAPA 293

Query: 296 PATPAPASSPATSP---------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA- 147
           PA  +PA SP+ +P         P+PT A TPS    P+ A         SL PGP+ A 
Sbjct: 294 PAPVSPAPSPSVAPTPSPTEAPTPSPTEAPTPSPTQAPTLAPLSSVSVSPSLAPGPALAQ 353

Query: 146 -DTPPSPSAAFSYSKPIIAA 90
            D   +PS+       ++AA
Sbjct: 354 EDESAAPSSRTGVVAALVAA 373

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 50/146 (34%), Positives = 70/146 (47%), Gaps = 17/146 (11%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTAAPT---KPPTATPAP---TAQPPAAATPP---TATPPTA---T 318
           L+L +L  SC+AQ+P ++P+    PP +  AP    A P  A + P    A P TA    
Sbjct: 6   LLLSVLIVSCVAQSPASSPSASNAPPVSASAPRGSVAPPTTAVSAPQGSVAAPTTAAASA 65

Query: 317 PPAAVPAPATPAPASSPATSPPAPTPASTPS-TAPTPSTAGSPPAP----TPDSLGPGPS 153
           P A+V AP T A A   + +PP  T AS P+ +   P  +  PPAP     P +    P+
Sbjct: 66  PXASVAAPTTAASAPQASAAPPTTTAASAPTVSVAAPQASAQPPAPVFASAPQASAAAPT 125

Query: 152 GADTPPSPSAAFSYSKPIIAATALSA 75
            A   P  SAA   +  +   T+ SA
Sbjct: 126 KAAAAPQVSAAAPATAALPPTTSASA 151

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 57/161 (35%), Positives = 78/161 (48%), Gaps = 25/161 (15%)
 Frame = -3

Query: 485 SSAAVQIFLILGLLATSCLAQAPTAAPTKPPT-----------ATPAPTAQPPAAATPPT 339
           ++A+ Q+   L  +++  LA  P  + T P T           A PAP A P   A+PP 
Sbjct: 197 AAASPQLAATLPPVSSPPLAATPPVSATPPATLPPVASPTVAVAAPAP-ATPAPVASPPV 255

Query: 338 ATPPTATPPAAVP----------APATPAPASSPATSP-PAP-TPASTPSTAPTPSTAGS 195
           A PP A  PA +P          AP  P P + P T+P PAP +PA +PS APTPS   +
Sbjct: 256 AMPPAALAPATLPPVMAPTPLLAAPVMP-PIAPPVTAPAPAPVSPAPSPSVAPTPSPTEA 314

Query: 194 P-PAPTPDSLGPGPSGADTPP-SPSAAFSYSKPIIAATALS 78
           P P+PT     P PS    P  +P ++ S S  +    AL+
Sbjct: 315 PTPSPTE---APTPSPTQAPTLAPLSSVSVSPSLAPGPALA 352

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 47/129 (36%), Positives = 59/129 (45%), Gaps = 10/129 (7%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAP--TAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP 267
           T+  A AP A+   P TA  AP  +A PP        T   A P A+   PA P  AS+P
Sbjct: 59  TTAAASAPXASVAAPTTAASAPQASAAPPTTTAASAPTVSVAAPQASAQPPA-PVFASAP 117

Query: 266 ATSPPAPTPASTPS--TAPTPSTAGSPP---APTPDSLGPGPSGADTPPSPSAA---FSY 111
             S  APT A+     +A  P+TA  PP   A  P +    P+ A  PP   AA    S 
Sbjct: 118 QASAAAPTKAAAAPQVSAAAPATAALPPTTSASAPQASAAAPTKAALPPQAFAAAPTTSA 177

Query: 110 SKPIIAATA 84
           + P  +ATA
Sbjct: 178 AAPQASATA 186

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 49/145 (33%), Positives = 63/145 (43%), Gaps = 26/145 (17%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQ---PPAAATPPTATPPTATPPAAVP---APATPAPASSP 267
           A AP  A   P T+  AP A    P  AA PP A     T  AA P   A A P  A++P
Sbjct: 135 AAAPATAALPPTTSASAPQASAAAPTKAALPPQAFAAAPTTSAAAPQASATAPPTGAAAP 194

Query: 266 ATSPPAPT------PASTPSTAPTPSTAGSPPAPTPDSLGP----------GPSGADTPP 135
            T+  +P       P S+P  A TP  + +PPA  P    P           P+   +PP
Sbjct: 195 PTAAASPQLAATLPPVSSPPLAATPPVSATPPATLPPVASPTVAVAAPAPATPAPVASPP 254

Query: 134 --SPSAAFSYS--KPIIAATALSAA 72
              P AA + +   P++A T L AA
Sbjct: 255 VAMPPAALAPATLPPVMAPTPLLAA 279

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 50/136 (36%), Positives = 58/136 (42%), Gaps = 20/136 (14%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPT---------ATPPT--ATPP---AAVPAPAT 288
           QA  AAPTK   A     A P  AA PPT         A  PT  A PP   AA P  + 
Sbjct: 118 QASAAAPTKAAAAPQVSAAAPATAALPPTTSASAPQASAAAPTKAALPPQAFAAAPTTSA 177

Query: 287 PAPASSPATSPPA-----PTPASTPSTAPTPSTAGSPP-APTPDSLGPGPSGADTPPSPS 126
            AP +S AT+PP      PT A++P  A T     SPP A TP      P+      SP+
Sbjct: 178 AAPQAS-ATAPPTGAAAPPTAAASPQLAATLPPVSSPPLAATPPVSATPPATLPPVASPT 236

Query: 125 AAFSYSKPIIAATALS 78
            A +   P   A   S
Sbjct: 237 VAVAAPAPATPAPVAS 252

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 49/134 (36%), Positives = 61/134 (45%), Gaps = 15/134 (11%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPT---ATPAPTAQPPAA--ATPPTATPPTATPPAAVP-----AP 294
           A    A  PT      PT   A P  +AQPPA   A+ P A+    T  AA P     AP
Sbjct: 79  APQASAAPPTTTAASAPTVSVAAPQASAQPPAPVFASAPQASAAAPTKAAAAPQVSAAAP 138

Query: 293 ATPA-----PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           AT A      AS+P  S  APT A+ P  A   +   S  AP   +  P P+GA  PP+ 
Sbjct: 139 ATAALPPTTSASAPQASAAAPTKAALPPQAFAAAPTTSAAAPQASATAP-PTGAAAPPTA 197

Query: 128 SAAFSYSKPIIAAT 87
           +A+     P +AAT
Sbjct: 198 AAS-----PQLAAT 206

[62][TOP]
>UniRef100_B4FTK0 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4FTK0_MAIZE
          Length = 269

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 54/130 (41%), Positives = 69/130 (53%), Gaps = 9/130 (6%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQP---PAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           + AP  +P  PP A PAP   P   P ++  P ATP + T PA  PA   PAP ++P +S
Sbjct: 140 SSAPLPSPPSPPAAAPAPATSPSSSPPSSAAPAATPTSPTSPALAPA---PAPTTTP-SS 195

Query: 257 PPAPTPASTPST--APTPST--AGSPPAPTPDSLGPGPSG--ADTPPSPSAAFSYSKPII 96
           PPAP P +TPS+  APTP+T   G  P PT  +  P   G  + TPP PS A     P++
Sbjct: 196 PPAPVPTTTPSSPPAPTPTTPAGGGSPPPTASASAPAAEGGSSTTPPQPSTA----APVV 251

Query: 95  AATALSAALF 66
           A    S   F
Sbjct: 252 AGFVGSLGAF 261

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 41/104 (39%), Positives = 60/104 (57%), Gaps = 5/104 (4%)
 Frame = -3

Query: 371 AQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAS--TPSTAPTP---S 207
           ++ P  ++ P  +PP+  PPAA PAPAT   +S P+++ PA TP S  +P+ AP P   +
Sbjct: 134 SRTPTPSSAPLPSPPS--PPAAAPAPATSPSSSPPSSAAPAATPTSPTSPALAPAPAPTT 191

Query: 206 TAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSA 75
           T  SPPAP P +  P    A TP +P+   S   P  +A+A +A
Sbjct: 192 TPSSPPAPVPTTT-PSSPPAPTPTTPAGGGS-PPPTASASAPAA 233

[63][TOP]
>UniRef100_B4FBH5 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4FBH5_MAIZE
          Length = 382

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 58/133 (43%), Positives = 67/133 (50%), Gaps = 22/133 (16%)
 Frame = -3

Query: 452 GLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV--PAPATPAP 279
           G  A    A +P  A T PP ++P   A PP +ATPP   PP A+P  AV  PAPATPAP
Sbjct: 192 GAAAPPTAAASPQLAATLPPVSSPPLAATPPVSATPPATLPPVASPTVAVAAPAPATPAP 251

Query: 278 ASSP--ATSPPAPTPASTPST-APTPSTAG----------SPPAPTPDSLGPGPSGADTP 138
            +SP  A  P A  PA+ P   APTP  A           + PAP P S  P PS A TP
Sbjct: 252 VASPPVAMPPAALAPATLPPVMAPTPLLAAPVMPPIAPPVTAPAPAPVSPAPSPSVAPTP 311

Query: 137 -------PSPSAA 120
                  PSP+ A
Sbjct: 312 SPTEAPTPSPTEA 324

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 47/140 (33%), Positives = 58/140 (41%), Gaps = 29/140 (20%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATP------------------PTATPPAAVPA 297
           +PT A   P  ATPAP A PP A  P    P                  P   PP   PA
Sbjct: 236 SPTVAVAAPAPATPAPVASPPVAMPPAALAPATLPPVMAPTPLLAAPVMPPIAPPVTAPA 295

Query: 296 PATPAPASSPATSP---------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA- 147
           PA  +PA SP+ +P         P+PT A TPS    P+ A         SL PGP+ A 
Sbjct: 296 PAPVSPAPSPSVAPTPSPTEAPTPSPTEAPTPSPTQAPTLAPLSSVSVSPSLAPGPALAQ 355

Query: 146 -DTPPSPSAAFSYSKPIIAA 90
            D   +PS+       ++AA
Sbjct: 356 EDESAAPSSRTGVVAALVAA 375

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 50/146 (34%), Positives = 70/146 (47%), Gaps = 17/146 (11%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTAAPT---KPPTATPAP---TAQPPAAATPP---TATPPTA---T 318
           L+L +L  SC+AQ+P ++P+    PP +  AP    A P  A + P    A P TA    
Sbjct: 8   LLLSVLIVSCVAQSPASSPSASNAPPVSASAPRGSVAPPTTAVSAPQGSVAAPTTAAASA 67

Query: 317 PPAAVPAPATPAPASSPATSPPAPTPASTPS-TAPTPSTAGSPPAP----TPDSLGPGPS 153
           P A+V AP T A A   + +PP  T AS P+ +   P  +  PPAP     P +    P+
Sbjct: 68  PKASVAAPTTAASAPQASAAPPTTTAASAPTVSVAAPQASAQPPAPVFASAPQASAAAPT 127

Query: 152 GADTPPSPSAAFSYSKPIIAATALSA 75
            A   P  SAA   +  +   T+ SA
Sbjct: 128 KAAAAPQVSAAAPATAALPPTTSASA 153

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 57/161 (35%), Positives = 78/161 (48%), Gaps = 25/161 (15%)
 Frame = -3

Query: 485 SSAAVQIFLILGLLATSCLAQAPTAAPTKPPT-----------ATPAPTAQPPAAATPPT 339
           ++A+ Q+   L  +++  LA  P  + T P T           A PAP A P   A+PP 
Sbjct: 199 AAASPQLAATLPPVSSPPLAATPPVSATPPATLPPVASPTVAVAAPAP-ATPAPVASPPV 257

Query: 338 ATPPTATPPAAVP----------APATPAPASSPATSP-PAP-TPASTPSTAPTPSTAGS 195
           A PP A  PA +P          AP  P P + P T+P PAP +PA +PS APTPS   +
Sbjct: 258 AMPPAALAPATLPPVMAPTPLLAAPVMP-PIAPPVTAPAPAPVSPAPSPSVAPTPSPTEA 316

Query: 194 P-PAPTPDSLGPGPSGADTPP-SPSAAFSYSKPIIAATALS 78
           P P+PT     P PS    P  +P ++ S S  +    AL+
Sbjct: 317 PTPSPTE---APTPSPTQAPTLAPLSSVSVSPSLAPGPALA 354

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 47/129 (36%), Positives = 59/129 (45%), Gaps = 10/129 (7%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAP--TAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP 267
           T+  A AP A+   P TA  AP  +A PP        T   A P A+   PA P  AS+P
Sbjct: 61  TTAAASAPKASVAAPTTAASAPQASAAPPTTTAASAPTVSVAAPQASAQPPA-PVFASAP 119

Query: 266 ATSPPAPTPASTPS--TAPTPSTAGSPP---APTPDSLGPGPSGADTPPSPSAA---FSY 111
             S  APT A+     +A  P+TA  PP   A  P +    P+ A  PP   AA    S 
Sbjct: 120 QASAAAPTKAAAAPQVSAAAPATAALPPTTSASAPQASAAAPTKAALPPQAFAAAPTTSA 179

Query: 110 SKPIIAATA 84
           + P  +ATA
Sbjct: 180 AAPQASATA 188

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 49/145 (33%), Positives = 63/145 (43%), Gaps = 26/145 (17%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQ---PPAAATPPTATPPTATPPAAVP---APATPAPASSP 267
           A AP  A   P T+  AP A    P  AA PP A     T  AA P   A A P  A++P
Sbjct: 137 AAAPATAALPPTTSASAPQASAAAPTKAALPPQAFAAAPTTSAAAPQASATAPPTGAAAP 196

Query: 266 ATSPPAPT------PASTPSTAPTPSTAGSPPAPTPDSLGP----------GPSGADTPP 135
            T+  +P       P S+P  A TP  + +PPA  P    P           P+   +PP
Sbjct: 197 PTAAASPQLAATLPPVSSPPLAATPPVSATPPATLPPVASPTVAVAAPAPATPAPVASPP 256

Query: 134 --SPSAAFSYS--KPIIAATALSAA 72
              P AA + +   P++A T L AA
Sbjct: 257 VAMPPAALAPATLPPVMAPTPLLAA 281

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 50/136 (36%), Positives = 58/136 (42%), Gaps = 20/136 (14%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPT---------ATPPT--ATPP---AAVPAPAT 288
           QA  AAPTK   A     A P  AA PPT         A  PT  A PP   AA P  + 
Sbjct: 120 QASAAAPTKAAAAPQVSAAAPATAALPPTTSASAPQASAAAPTKAALPPQAFAAAPTTSA 179

Query: 287 PAPASSPATSPPA-----PTPASTPSTAPTPSTAGSPP-APTPDSLGPGPSGADTPPSPS 126
            AP +S AT+PP      PT A++P  A T     SPP A TP      P+      SP+
Sbjct: 180 AAPQAS-ATAPPTGAAAPPTAAASPQLAATLPPVSSPPLAATPPVSATPPATLPPVASPT 238

Query: 125 AAFSYSKPIIAATALS 78
            A +   P   A   S
Sbjct: 239 VAVAAPAPATPAPVAS 254

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 49/134 (36%), Positives = 61/134 (45%), Gaps = 15/134 (11%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPT---ATPAPTAQPPAA--ATPPTATPPTATPPAAVP-----AP 294
           A    A  PT      PT   A P  +AQPPA   A+ P A+    T  AA P     AP
Sbjct: 81  APQASAAPPTTTAASAPTVSVAAPQASAQPPAPVFASAPQASAAAPTKAAAAPQVSAAAP 140

Query: 293 ATPA-----PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           AT A      AS+P  S  APT A+ P  A   +   S  AP   +  P P+GA  PP+ 
Sbjct: 141 ATAALPPTTSASAPQASAAAPTKAALPPQAFAAAPTTSAAAPQASATAP-PTGAAAPPTA 199

Query: 128 SAAFSYSKPIIAAT 87
           +A+     P +AAT
Sbjct: 200 AAS-----PQLAAT 208

[64][TOP]
>UniRef100_A7J8T9 AGP6 (Fragment) n=1 Tax=Pinus strobus RepID=A7J8T9_PINST
          Length = 212

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 59/146 (40%), Positives = 64/146 (43%), Gaps = 34/146 (23%)
 Frame = -3

Query: 422 APTAAPTKP------PTATPAPTAQPPAAA------------TPPTATPPTATPPAAVPA 297
           AP  APTKP      PT  P PT +PPA A            TPP A PP ATPP A P 
Sbjct: 65  APAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPPFAAPP 124

Query: 296 PATPAPASSPATSPPAPTPAST-------------PSTAPTPSTAGSPPAPTPDSLGPGP 156
            A P PAS PA  PP   PA +              + APTPS   SPP+P   S GP  
Sbjct: 125 VAVP-PASPPAIPPPVQAPAPSHHKRKKKKKHHHHAAPAPTPSALKSPPSPPLGSPGPST 183

Query: 155 SG---ADTPPSPSAAFSYSKPIIAAT 87
           S    A  P  PSA    S   +  T
Sbjct: 184 SADSFAPAPSQPSAGMKSSAASVCGT 209

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 47/128 (36%), Positives = 55/128 (42%), Gaps = 5/128 (3%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
           L  + LA AP A  T KPPT  PA     P         PPT TP A   AP  P P  +
Sbjct: 14  LVDTVLATAPAAPTTAKPPTTAPAAPVSTPK--------PPTTTPVAPAVAPTKPTPPVA 65

Query: 269 PATSPPAPTPAST-PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP---SPSAAFSYSKP 102
           PA +P  P P  T P+ AP P+T   PPA  P           TPP    P A   ++ P
Sbjct: 66  PAVAPTKPAPPVTAPTKAPPPTT--KPPAVAPAKAPVSAPPVATPPVAVPPVATPPFAAP 123

Query: 101 IIAATALS 78
            +A    S
Sbjct: 124 PVAVPPAS 131

[65][TOP]
>UniRef100_A5BDI9 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BDI9_VITVI
          Length = 138

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 51/114 (44%), Positives = 72/114 (63%), Gaps = 3/114 (2%)
 Frame = -3

Query: 479 AAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATP-PTATPPAAV 303
           ++V + ++  L+A S  AQ+P ++PT  PT +P  TA PP A TPP+ TP P+ TP A  
Sbjct: 4   SSVVLVMMFALVAGSAFAQSPASSPTASPTKSP--TASPPVA-TPPSPTPSPSTTPSAPA 60

Query: 302 PAPATPAP-ASSPA-TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA 147
           PAP+T +P AS+P+ TS   P P ++P++APT   + SP   TP S  P PS A
Sbjct: 61  PAPSTVSPPASTPSPTSGSPPAPPTSPASAPTTGASPSPSISTPPSEPPSPSAA 114

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 45/105 (42%), Positives = 62/105 (59%), Gaps = 3/105 (2%)
 Frame = -3

Query: 371 AQPPAAATPPTATP---PTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTA 201
           AQ PA++  PTA+P   PTA+PP A P   TP+P+++P+   PAP+  S P++ P+P T+
Sbjct: 21  AQSPASS--PTASPTKSPTASPPVATPPSPTPSPSTTPSAPAPAPSTVSPPASTPSP-TS 77

Query: 200 GSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAALF 66
           GSPPAP         +GA   PS S   S   P  +A AL+A  F
Sbjct: 78  GSPPAPPTSPASAPTTGASPSPSISTPPS-EPPSPSAAALNAVTF 121

[66][TOP]
>UniRef100_C3ZT83 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae
           RepID=C3ZT83_BRAFL
          Length = 602

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 55/131 (41%), Positives = 73/131 (55%), Gaps = 6/131 (4%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATPPTA-TPPTATPPAAVPAPATPAPASSP--AT 261
           +A  P A  T P  +TP   + PPAA+TPP A TPP A+ P   PA +TP  AS+P  A+
Sbjct: 314 VASTPPALSTPPVASTPPVASTPPAASTPPAASTPPAASTP---PAASTPLVASTPPAAS 370

Query: 260 SPPA---PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAA 90
           +PPA   P  ASTP  A TP  A +PPA +   +   P  A TPP  S   + S P +A+
Sbjct: 371 TPPAASTPPVASTPPVASTPLAASTPPAASTPPVASTPPAASTPPVASTPPAASTPPVAS 430

Query: 89  TALSAALFAIA 57
           T  +A+   +A
Sbjct: 431 TPPAASTPPVA 441

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 55/126 (43%), Positives = 69/126 (54%), Gaps = 6/126 (4%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPP--TATPPAA--VPAPATPAP 279
           L+T  +A  P  A T P  +TP   + PPAA+TPP A+ P   +TPPAA   PA +TP  
Sbjct: 321 LSTPPVASTPPVASTPPAASTPPAASTPPAASTPPAASTPLVASTPPAASTPPAASTPPV 380

Query: 278 ASSPATSPPAPTP--ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSK 105
           AS+P   P A TP  ASTP  A TP  A +PPA +   +   P  A TPP  S   + S 
Sbjct: 381 ASTP---PVASTPLAASTPPAASTPPVASTPPAASTPPVASTPPAASTPPVASTPPAAST 437

Query: 104 PIIAAT 87
           P +A T
Sbjct: 438 PPVANT 443

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 60/137 (43%), Positives = 73/137 (53%), Gaps = 18/137 (13%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTA--TPPAA--VPAPATPAPA 276
           +T   A  P  A T P  +TP   + PP A+TPP A+ P A  TPPAA   P  +TP  A
Sbjct: 352 STPPAASTPLVASTPPAASTPPAASTPPVASTPPVASTPLAASTPPAASTPPVASTPPAA 411

Query: 275 SSP--ATSPPA---PTPASTPSTAPTPSTAGSPPAP-TP--DSLGPGPS------GADTP 138
           S+P  A++PPA   P  ASTP  A TP  A +PPAP TP   S  P PS       A TP
Sbjct: 412 STPPVASTPPAASTPPVASTPPAASTPPVANTPPAPSTPPAPSTPPAPSTTRPQKAASTP 471

Query: 137 PSPSAAFSYSKPIIAAT 87
           P  S     S P++A+T
Sbjct: 472 PVASTPPVASTPLVAST 488

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 58/130 (44%), Positives = 73/130 (56%), Gaps = 11/130 (8%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTA-TPPTA-TPPAAVP--APATPAPA 276
           +T   A  P AA T P  +TP   + PPAA+TPP A TPP A TPP A    A +TP  A
Sbjct: 340 STPPAASTPPAASTPPAASTPLVASTPPAASTPPAASTPPVASTPPVASTPLAASTPPAA 399

Query: 275 SSP--ATSPPA---PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA--AF 117
           S+P  A++PPA   P  ASTP  A TP  A +PPA +   +   P    TPP+PS   A 
Sbjct: 400 STPPVASTPPAASTPPVASTPPAASTPPVASTPPAASTPPVANTPPAPSTPPAPSTPPAP 459

Query: 116 SYSKPIIAAT 87
           S ++P  AA+
Sbjct: 460 STTRPQKAAS 469

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 52/125 (41%), Positives = 62/125 (49%), Gaps = 6/125 (4%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTA-TPPTA-TPPAA--VPAPATPAPA 276
           +T   A  P  A T P  +TP   + PPAA+TPP A TPP A TPP A   PA +TP  A
Sbjct: 370 STPPAASTPPVASTPPVASTPLAASTPPAASTPPVASTPPAASTPPVASTPPAASTPPVA 429

Query: 275 SSP--ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           S+P  A++PP       PST P PST  +P    P      P  A TPP  S     S P
Sbjct: 430 STPPAASTPPVANTPPAPSTPPAPSTPPAPSTTRPQKAASTPPVASTPPVASTPLVASTP 489

Query: 101 IIAAT 87
            +  T
Sbjct: 490 PVPIT 494

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 55/124 (44%), Positives = 63/124 (50%), Gaps = 18/124 (14%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTA-TPPTA-TPPAAVPAPAT---PAP 279
           +T   A  P AA T P  +TP   + PP A+TPP A TPP A TPPAA   P     PAP
Sbjct: 388 STPLAASTPPAASTPPVASTPPAASTPPVASTPPAASTPPVASTPPAASTPPVANTPPAP 447

Query: 278 ASSPATS-PPAP----------TP--ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 138
           ++ PA S PPAP          TP  ASTP  A TP  A +PP P        P    TP
Sbjct: 448 STPPAPSTPPAPSTTRPQKAASTPPVASTPPVASTPLVASTPPVPITPPAPITPPAPSTP 507

Query: 137 PSPS 126
           P+PS
Sbjct: 508 PAPS 511

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 5/115 (4%)
 Frame = -3

Query: 401 KPPTATPAP---TAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP--ATSPPAPTPA 237
           K P+ T A    +A+     +  T+ PP A+ P   PA +TP  AS+P  A++PPA   A
Sbjct: 286 KRPSTTDASELHSAKRRCTGSGNTSIPPVASTP---PALSTPPVASTPPVASTPPA---A 339

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
           STP  A TP  A +PPA +   +   P  A TPP+ S     S P +A+T L+A+
Sbjct: 340 STPPAASTPPAASTPPAASTPLVASTPPAASTPPAASTPPVASTPPVASTPLAAS 394

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 36/92 (39%), Positives = 46/92 (50%), Gaps = 12/92 (13%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKP-------PTATPAPTAQPPAAATPP---TATPPTATPPAAVPAP 294
           +T  +A  P AA T P       P+  PAP+  P  + T P    +TPP A+ P   P  
Sbjct: 424 STPPVASTPPAASTPPVANTPPAPSTPPAPSTPPAPSTTRPQKAASTPPVASTP---PVA 480

Query: 293 ATPAPASSPAT--SPPAPTPASTPSTAPTPST 204
           +TP  AS+P    +PPAP     PST P PST
Sbjct: 481 STPLVASTPPVPITPPAPITPPAPSTPPAPST 512

[67][TOP]
>UniRef100_A7SXG9 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SXG9_NEMVE
          Length = 403

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 46/84 (54%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           APTAAPT  PT  PAP   P PA A  P   P  AT PA  P P  PAPA +PA +PPAP
Sbjct: 292 APTAAPTPAPTPAPAPAPTPAPAPAPTPAPAPAPATTPAPAPVPPAPAPAPAPAPAPPAP 351

Query: 245 TPASTPSTAPTPSTAGSPPAPTPD 174
             A  P TAP    AGSPP  TP+
Sbjct: 352 PVAPAPQTAPL---AGSPPESTPE 372

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 54/112 (48%), Positives = 64/112 (57%), Gaps = 5/112 (4%)
 Frame = -3

Query: 449 LLATSCLAQAPTAAP-TKPPTATPAP--TAQPPAAATP-PTATPPTATPPAAVPAPATPA 282
           +L +  + Q  TAAP T+P   T AP  TA P AA TP PT  P  A  PA  PAP TPA
Sbjct: 262 VLPSVTILQTTTAAPSTQPAETTKAPPNTAAPTAAPTPAPTPAPAPAPTPAPAPAP-TPA 320

Query: 281 PASSPATSP-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           PA +PAT+P PAP P   P+ AP P+ A +PPAP    + P P  A    SP
Sbjct: 321 PAPAPATTPAPAPVP---PAPAPAPAPAPAPPAP---PVAPAPQTAPLAGSP 366

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 42/92 (45%), Positives = 50/92 (54%), Gaps = 1/92 (1%)
 Frame = -3

Query: 392 TATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-TPAPASSPATSPPAPTPASTPSTAP 216
           T T AP+ QP       T  PP    P A P PA TPAPA +P    PAP PA TP+ AP
Sbjct: 271 TTTAAPSTQPAET----TKAPPNTAAPTAAPTPAPTPAPAPAPT---PAPAPAPTPAPAP 323

Query: 215 TPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            P+T  + PAP P +  P P+ A  PP+P  A
Sbjct: 324 APATTPA-PAPVPPAPAPAPAPAPAPPAPPVA 354

[68][TOP]
>UniRef100_B8HBY3 Peptidase M23 n=1 Tax=Arthrobacter chlorophenolicus A6
           RepID=B8HBY3_ARTCA
          Length = 487

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 54/126 (42%), Positives = 66/126 (52%), Gaps = 14/126 (11%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATP-----PTATP--PTATPPAAVPAPATPAPASSP- 267
           AP A PT  PT TP P+  P    TP     PT TP  P+ TP     AP +PAP+ SP 
Sbjct: 357 APAATPTPTPTPTPTPSPSPSPTQTPRPTPTPTPTPSAPSTTPSPTPTAPTSPAPSPSPT 416

Query: 266 --ATSPPAPTPASTPSTAPTPSTAGSPPAPT---PDSLGPGPSGADT-PPSPSAAFSYSK 105
             +T  P PTP  TP+  PTP+   S P PT   P S  P P+   T  P+P+AA   S 
Sbjct: 417 PTSTPVPTPTPVPTPTPTPTPTPTASSPTPTAPPPSSATPSPAPTSTVTPTPTAA-PTST 475

Query: 104 PIIAAT 87
           P+ +AT
Sbjct: 476 PLPSAT 481

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 49/116 (42%), Positives = 64/116 (55%), Gaps = 9/116 (7%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP---ATPAPASSPATSP- 255
           +P+ +PT+ P  TP PT  P A +T P+ TP   T PA  P+P   +TP P  +P  +P 
Sbjct: 373 SPSPSPTQTPRPTPTPTPTPSAPSTTPSPTPTAPTSPAPSPSPTPTSTPVPTPTPVPTPT 432

Query: 254 PAPTPASTPS----TAPTPSTAGSPPAPTPDSLGPGPSGADT-PPSPSAAFSYSKP 102
           P PTP  T S    TAP PS+A   PAPT  ++ P P+ A T  P PSA    + P
Sbjct: 433 PTPTPTPTASSPTPTAPPPSSATPSPAPT-STVTPTPTAAPTSTPLPSATLPVTYP 487

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 56/138 (40%), Positives = 66/138 (47%), Gaps = 20/138 (14%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPTATP---------PTATP---PAAVPAPA--- 291
           Q P+ +PT  PT TP+PTA  PAA   PT TP         PT TP   P   P P+   
Sbjct: 339 QVPSPSPTPTPTPTPSPTA--PAATPTPTPTPTPTPSPSPSPTQTPRPTPTPTPTPSAPS 396

Query: 290 -TPAPASSPATSP---PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPSPS 126
            TP+P  +  TSP   P+PTP STP   PTP    +P P PTP +  P P    T P PS
Sbjct: 397 TTPSPTPTAPTSPAPSPSPTPTSTPVPTPTPVPTPTPTPTPTPTASSPTP----TAPPPS 452

Query: 125 AAFSYSKPIIAATALSAA 72
           +A     P    T    A
Sbjct: 453 SATPSPAPTSTVTPTPTA 470

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 55/140 (39%), Positives = 69/140 (49%), Gaps = 21/140 (15%)
 Frame = -3

Query: 488 ASSAAVQIFLILGLLATSCLAQAPTAAPTKPP---------TATPAPTA---------QP 363
           ASS A    + +G+ A     Q  TAA T PP         + TP PT          Q 
Sbjct: 281 ASSGATVWTIPVGVGADPSAGQEETAATTTPPATASPSPSPSVTPGPTGTVLPPPGAPQV 340

Query: 362 PAAATPPTATP-PTATPPAAVPAPATPAPASSPATSP-PAPTPASTPSTAPTPSTAGSPP 189
           P+ +  PT TP P+ T PAA P P TP P  +P+ SP P  TP  TP+  PTPS   + P
Sbjct: 341 PSPSPTPTPTPTPSPTAPAATPTP-TPTPTPTPSPSPSPTQTPRPTPTPTPTPSAPSTTP 399

Query: 188 APTPDS-LGPGPSGADTPPS 132
           +PTP +   P PS + TP S
Sbjct: 400 SPTPTAPTSPAPSPSPTPTS 419

 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 33/75 (44%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPP 252
           A +P+  PT  P  TP P   P    TP PTA+ PT T P   P+ ATP+PA    TS  
Sbjct: 410 APSPSPTPTSTPVPTPTPVPTPTPTPTPTPTASSPTPTAPP--PSSATPSPA---PTSTV 464

Query: 251 APTPASTPSTAPTPS 207
            PTP + P++ P PS
Sbjct: 465 TPTPTAAPTSTPLPS 479

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 33/75 (44%), Positives = 39/75 (52%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
           TS     PT  PT  PT TP PTA  P    PP   P +ATP  A  +  TP P ++P T
Sbjct: 418 TSTPVPTPTPVPTPTPTPTPTPTASSPTPTAPP---PSSATPSPAPTSTVTPTPTAAP-T 473

Query: 260 SPPAPTPASTPSTAP 216
           S P P+ A+ P T P
Sbjct: 474 STPLPS-ATLPVTYP 487

[69][TOP]
>UniRef100_B4D3G3 Preprotein translocase, SecG subunit n=1 Tax=Chthoniobacter flavus
           Ellin428 RepID=B4D3G3_9BACT
          Length = 240

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 50/112 (44%), Positives = 59/112 (52%), Gaps = 12/112 (10%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPA------AATPPTATPPTATPPAAVPAPATPAPASSP 267
           A   T A  KP  ATPAPT + PA      AATP     P A  PA  PAPATPAP + P
Sbjct: 121 APVTTPASEKPAAATPAPTTEKPATENKPAAATPAPENKPAAAAPAPAPAPATPAPEAKP 180

Query: 266 ATSP-PAPTPASTPSTAPTPSTA-----GSPPAPTPDSLGPGPSGADTPPSP 129
           A +P P   PA+TP+ AP P+ A        PAP P+S  P    + TP +P
Sbjct: 181 AATPAPEAKPAATPNPAPAPAPATDAKPAPAPAPQPESATPSKPESTTPATP 232

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 52/125 (41%), Positives = 66/125 (52%), Gaps = 15/125 (12%)
 Frame = -3

Query: 449 LLATSCLAQAPTAAPTKPPTATPAPTAQ-------PPAAATPPTATP-PTATPPAAV--P 300
           L++   LA   T AP    TATPAPT +        PA+  P  ATP PT   PA    P
Sbjct: 91  LMSVPKLAAPATPAPAAG-TATPAPTDKNLPAPVTTPASEKPAAATPAPTTEKPATENKP 149

Query: 299 APATPAPASSPATSPPAPTPA-STPSTAPTPSTAGSP---PAPTPDSLGPGPSGA-DTPP 135
           A ATPAP + PA + PAP PA +TP+    P+   +P   PA TP+   P P+ A D  P
Sbjct: 150 AAATPAPENKPAAAAPAPAPAPATPAPEAKPAATPAPEAKPAATPNP-APAPAPATDAKP 208

Query: 134 SPSAA 120
           +P+ A
Sbjct: 209 APAPA 213

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 41/82 (50%), Positives = 45/82 (54%), Gaps = 3/82 (3%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPA-PASSPATSP 255
           A AP  AP     ATPAP A+P  AATP     P ATP PA  PAPAT A PA +PA  P
Sbjct: 162 AAAPAPAPAP---ATPAPEAKP--AATPAPEAKPAATPNPAPAPAPATDAKPAPAPAPQP 216

Query: 254 PAPTPASTPSTAP-TPSTAGSP 192
            + TP+   ST P TP     P
Sbjct: 217 ESATPSKPESTTPATPKPEDKP 238

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 40/95 (42%), Positives = 47/95 (49%), Gaps = 5/95 (5%)
 Frame = -3

Query: 443 ATSCLAQAPTAAP-TKPPTATPAPTAQP--PAAATPPTATPPTATPPAAVPAPA-TPAPA 276
           AT     A T AP  KP  A PAP   P  PA    P ATP     PAA P PA  PAPA
Sbjct: 144 ATENKPAAATPAPENKPAAAAPAPAPAPATPAPEAKPAATPAPEAKPAATPNPAPAPAPA 203

Query: 275 SSPATSPPAPTPASTPSTA-PTPSTAGSPPAPTPD 174
           +    + PAP PA  P +A P+   + +P  P P+
Sbjct: 204 TD---AKPAPAPAPQPESATPSKPESTTPATPKPE 235

 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 33/115 (28%), Positives = 45/115 (39%)
 Frame = -3

Query: 467 IFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT 288
           IF +L +L +    +      T        P    PA   P   T   A     +PAP T
Sbjct: 65  IFFVLTVLLSWLYVKETNQRSTLQKRLMSVPKLAAPATPAPAAGTATPAPTDKNLPAPVT 124

Query: 287 PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
              +  PA + PAPT    P+T   P+ A   P   P +  P P+ A   P+P A
Sbjct: 125 TPASEKPAAATPAPT-TEKPATENKPAAATPAPENKPAAAAPAPAPAPATPAPEA 178

[70][TOP]
>UniRef100_C0PQY2 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=C0PQY2_PICSI
          Length = 165

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 69/174 (39%), Positives = 88/174 (50%), Gaps = 28/174 (16%)
 Frame = -3

Query: 491 MASSAAVQ--IFLILGLLATSCLAQAPTAAPTK------------PPTATPAPTAQPPAA 354
           MA SAA+   +FL+ G L +S +AQ P A+PTK            PPT T AP   P   
Sbjct: 1   MARSAAMTMVLFLLAGFLVSS-MAQTPLASPTKSPTTPAPTTTAAPPTTTAAP---PTTT 56

Query: 353 ATPPTATPP--TATPPAAVPAP-ATPAPASSPATSPPAPT-----------PASTPSTAP 216
           ATPP +TPP   + PP A P P ATP P ++P  +PP+P            PA+TP   P
Sbjct: 57  ATPPVSTPPPVASPPPVATPPPVATPPPVATPVATPPSPVLVPSPAVATPPPAATPIVTP 116

Query: 215 TPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAALFAIAF 54
           T ST    PA TP +  P  S A +P S S A S +  +     L+AAL  + F
Sbjct: 117 TAST----PAVTP-TAAPIASPAVSPSSTSGA-SVASTLEKTAILAAALAGVFF 164

[71][TOP]
>UniRef100_B4LTN2 GJ19702 n=1 Tax=Drosophila virilis RepID=B4LTN2_DROVI
          Length = 825

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 67/174 (38%), Positives = 83/174 (47%), Gaps = 29/174 (16%)
 Frame = -3

Query: 497  PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKP------PTATPAPTAQP-PAAATPPT 339
            P+ A + A  +  I    A    A A TAAP  P      PT  PAPTA P PAAAT PT
Sbjct: 484  PEAAPAVAAAVAPITPPAAGPGAAPAQTAAPITPPAAVLAPTVAPAPTAGPAPAAATAPT 543

Query: 338  ATPPTATPPAAVPA-----------------PATPA--PASSPATSPPAPTPASTPSTAP 216
            A P   TPPAA PA                 PA PA  PA +PA +P    P + P+ AP
Sbjct: 544  AAPALITPPAAAPAIAATAQPVAAQAQIVTQPAAPASPPAVTPAVAPQTGAPTAAPAAAP 603

Query: 215  TPSTAGSPPAPTPDSLGPGPSGADTP---PSPSAAFSYSKPIIAATALSAALFA 63
            T +   +P AP+  +    P+ A+ P   P+P AA + S P  A  A +AA  A
Sbjct: 604  TAAATTAPVAPSAAAAASTPASANPPTAGPTP-AASTASAPAPAPAAPTAAAAA 656

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 53/127 (41%), Positives = 65/127 (51%), Gaps = 14/127 (11%)
 Frame = -3

Query: 428 AQAPTAAPT--KPPTATP--APTAQPPAAATPPTATPPT-ATPPAAVP--APATPAPASS 270
           A APTAAP    PP A P  A TAQP AA       P   A+PPA  P  AP T AP ++
Sbjct: 539 ATAPTAAPALITPPAAAPAIAATAQPVAAQAQIVTQPAAPASPPAVTPAVAPQTGAPTAA 598

Query: 269 PATSPPAPTPASTPSTAPTPSTAGSPPA-PTPDSLGPGPSG------ADTPPSPSAAFSY 111
           PA +P A   A+T   AP+ + A S PA   P + GP P+       A  P +P+AA + 
Sbjct: 599 PAAAPTA--AATTAPVAPSAAAAASTPASANPPTAGPTPAASTASAPAPAPAAPTAAAAA 656

Query: 110 SKPIIAA 90
            K   AA
Sbjct: 657 QKTAAAA 663

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 44/115 (38%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAPTPAST 231
           P  P  A   P    PAAA PP A+P  A   AA  AP TP PA+ P  +P     P + 
Sbjct: 459 PATPAPAAAVPPVASPAAAVPPAASPEAAPAVAAAVAPITP-PAAGPGAAPAQTAAPITP 517

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS--YSKPIIAATALSAA 72
           P+    P+ A   PAPT    GP P+ A  P +  A  +   + P IAATA   A
Sbjct: 518 PAAVLAPTVA---PAPT---AGPAPAAATAPTAAPALITPPAAAPAIAATAQPVA 566

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 39/110 (35%), Positives = 45/110 (40%), Gaps = 11/110 (10%)
 Frame = -3

Query: 419 PTAAPTKPPTATPA--------PTAQPPAAATPPTATPPTATP---PAAVPAPATPAPAS 273
           P  A   PP A+PA        P A P  AA     TPP A P   PA   AP TP  A 
Sbjct: 462 PAPAAAVPPVASPAAAVPPAASPEAAPAVAAAVAPITPPAAGPGAAPAQTAAPITPPAAV 521

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
              T  PAPT    P+ A  P+ A  P   TP +  P  +    P +  A
Sbjct: 522 LAPTVAPAPTAGPAPAAATAPTAA--PALITPPAAAPAIAATAQPVAAQA 569

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 39/106 (36%), Positives = 47/106 (44%), Gaps = 11/106 (10%)
 Frame = -3

Query: 413 AAPTKPPTATPA-------PTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP 255
           AAP  PP  TPA       PTA P AA T    T P A  P+A  A +TPA A+ P   P
Sbjct: 576 AAPASPPAVTPAVAPQTGAPTAAPAAAPTAAATTAPVA--PSAAAAASTPASANPPTAGP 633

Query: 254 -PAPTPASTPS---TAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            PA + AS P+    APT + A    A   +      +     P P
Sbjct: 634 TPAASTASAPAPAPAAPTAAAAAQKTAAAANGKKQEAAQKSKQPKP 679

[72][TOP]
>UniRef100_C6TDP6 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TDP6_SOYBN
          Length = 233

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 48/105 (45%), Positives = 58/105 (55%), Gaps = 3/105 (2%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPP 252
           A +P AA   PP ++P   + P  AA P P  TPP ATPPAA P  ATP PA +P +SPP
Sbjct: 59  ASSPNAATATPPVSSPTVASPPSKAAAPAPATTPPVATPPAATPPAATP-PAVTPVSSPP 117

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPPSPSA 123
           AP P S+P   P P    SPPA  P +  P   PS     P+P +
Sbjct: 118 APVPVSSP---PAPVPVSSPPALAPTTPAPVVAPSAEVPAPAPKS 159

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 59/145 (40%), Positives = 76/145 (52%), Gaps = 26/145 (17%)
 Frame = -3

Query: 458 ILGLLATSCLAQAPTAAPT---------------KPPTATPAPTAQPPAA------ATPP 342
           I+G++  +   Q+P AAPT               K P    +PT+ PPA+      ATPP
Sbjct: 11  IIGIVVAAVGGQSPAAAPTTSSASPATAPSKPKPKSPAPVASPTSSPPASSPNAATATPP 70

Query: 341 TATPPTATPP--AAVPAPATPAP-ASSPATSPPAPT-PASTP-STAPTPSTAGSPPAPTP 177
            ++P  A+PP  AA PAPAT  P A+ PA +PPA T PA TP S+ P P    SPPAP P
Sbjct: 71  VSSPTVASPPSKAAAPAPATTPPVATPPAATPPAATPPAVTPVSSPPAPVPVSSPPAPVP 130

Query: 176 DSLGPGPSGADTPPSPSAAFSYSKP 102
             +   P+ A T P+P  A S   P
Sbjct: 131 --VSSPPALAPTTPAPVVAPSAEVP 153

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 47/106 (44%), Positives = 52/106 (49%), Gaps = 5/106 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP--APATPAPASSPATSPPA 249
           +PT A      A PAP   PP A TPP ATPP ATPPA  P  +P  P P SSP    P 
Sbjct: 73  SPTVASPPSKAAAPAPATTPPVA-TPPAATPPAATPPAVTPVSSPPAPVPVSSPPAPVPV 131

Query: 248 PTPASTPSTAPTPSTAGSP--PAPTPDS-LGPGPSGADTPPSPSAA 120
            +P +   T P P  A S   PAP P S      S   T P+PS A
Sbjct: 132 SSPPALAPTTPAPVVAPSAEVPAPAPKSKKKTKKSKKHTAPAPSPA 177

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 58/155 (37%), Positives = 72/155 (46%), Gaps = 30/155 (19%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATP--------PTATPPAAVP-------AP 294
           A AP  A T PP ATP P A PP AATPP  TP        P ++PPA VP       AP
Sbjct: 83  AAAPAPATT-PPVATP-PAATPP-AATPPAVTPVSSPPAPVPVSSPPAPVPVSSPPALAP 139

Query: 293 ATPAPASSPATSPPAPTPASTPST---------APTPSTAGSP------PAPTPDSLGPG 159
            TPAP  +P+   PAP P S   T         AP+P+  G P      P  + D+  PG
Sbjct: 140 TTPAPVVAPSAEVPAPAPKSKKKTKKSKKHTAPAPSPALLGPPAPPVGAPGSSQDASSPG 199

Query: 158 PSGADTPPSPSAAFSYSKPIIAATALSAALFAIAF 54
           P+ ++   S +      K +I   ALS A   + F
Sbjct: 200 PAVSE-DESGAETIRCLKKVIGCLALSWATLVLFF 233

 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 41/104 (39%), Positives = 53/104 (50%), Gaps = 14/104 (13%)
 Frame = -3

Query: 368 QPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA--------------PTPAST 231
           Q PAAA P T++   AT P+  P P +PAP +SP +SPPA              PT AS 
Sbjct: 22  QSPAAA-PTTSSASPATAPSK-PKPKSPAPVASPTSSPPASSPNAATATPPVSSPTVASP 79

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
           PS A  P+ A +PP  TP +  P    A TPP+ +   S   P+
Sbjct: 80  PSKAAAPAPATTPPVATPPAATP---PAATPPAVTPVSSPPAPV 120

[73][TOP]
>UniRef100_B4FBV0 Putative uncharacterized protein n=2 Tax=Zea mays
           RepID=B4FBV0_MAIZE
          Length = 260

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 63/167 (37%), Positives = 85/167 (50%), Gaps = 24/167 (14%)
 Frame = -3

Query: 485 SSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT---- 318
           ++A+ Q+   L  +++  LA A   A   PPT  P+ T   P  A+PPTA PP A     
Sbjct: 87  TAASPQLAATLAPVSSPPLAAAAPPASATPPTTPPSATQTQPPVASPPTAMPPAAALPPA 146

Query: 317 --PPAAVPAPATPA----PASSPATSP-PAP-TPASTPSTAPTPSTAGSP-PAPTPDSLG 165
             PPA  P P   A    PA+ PAT+P PAP +PA TPS APTPS   +P P+PT ++  
Sbjct: 147 TLPPAMAPTPLLAAPVMPPAAPPATAPAPAPVSPAPTPSVAPTPSPTEAPAPSPTTEAPV 206

Query: 164 PGPSGADTP-----------PSPSAAFSYSKPIIAATALSAALFAIA 57
           P PS A  P           P P+ A   S    + TA++A +  +A
Sbjct: 207 PTPSPALAPLSSVSVSPSLSPGPALAQDESAAPGSRTAVAALVSLVA 253

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 58/146 (39%), Positives = 70/146 (47%), Gaps = 22/146 (15%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPTKPPTATPAPTAQPP-AAATPP------------------TATPPT 324
           LA    A  PT A +    AT AP + PP AAA PP                   A+PPT
Sbjct: 76  LAPQASAAPPTTAASPQLAATLAPVSSPPLAAAAPPASATPPTTPPSATQTQPPVASPPT 135

Query: 323 ATPPAAVPAPAT--PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG 150
           A PPAA   PAT  PA A +P  + P   PA+ P+TAP P+     PAPTP S+ P PS 
Sbjct: 136 AMPPAAALPPATLPPAMAPTPLLAAPVMPPAAPPATAPAPAPVS--PAPTP-SVAPTPSP 192

Query: 149 ADTP-PSPSAAFSYSKPIIAATALSA 75
            + P PSP+       P  A   LS+
Sbjct: 193 TEAPAPSPTTEAPVPTPSPALAPLSS 218

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 51/161 (31%), Positives = 70/161 (43%), Gaps = 31/161 (19%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTAAPTKPPTAT---------------PAPTAQPP---------AA 354
           L+L LL  SC AQ+P A+   P +A+               P  +AQPP         A+
Sbjct: 8   LLLSLLIVSCAAQSPYASKAPPLSASAPGGSVAPPTTAVSAPQASAQPPTTVAASGPQAS 67

Query: 353 ATPPT----ATPPTATPPAAVPAP---ATPAPASSPATSPPAPTPASTPSTAPTPSTAGS 195
           A  PT    A   +A PP    +P   AT AP SSP  +  AP  ++TP T P  +T   
Sbjct: 68  AAAPTKAALAPQASAAPPTTAASPQLAATLAPVSSPPLAAAAPPASATPPTTPPSATQTQ 127

Query: 194 PPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
           PP  +P +    P  A  PP+         P++AA  +  A
Sbjct: 128 PPVASPPT--AMPPAAALPPATLPPAMAPTPLLAAPVMPPA 166

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 49/146 (33%), Positives = 64/146 (43%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPP 312
           M  +AA+    +   +A + L  AP   P  PP   PAP    P +  P  +  PT +P 
Sbjct: 137 MPPAAALPPATLPPAMAPTPLLAAPVMPPAAPPATAPAPA---PVSPAPTPSVAPTPSP- 192

Query: 311 AAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
                  T APA SP T  P PTP  +P+ AP  S + SP      SL PGP+ A     
Sbjct: 193 -------TEAPAPSPTTEAPVPTP--SPALAPLSSVSVSP------SLSPGPALAQ---D 234

Query: 131 PSAAFSYSKPIIAATALSAALFAIAF 54
            SAA      + A  +L AA   + F
Sbjct: 235 ESAAPGSRTAVAALVSLVAAGLVVLF 260

[74][TOP]
>UniRef100_B9QEP3 Chloride channel protein k, putative n=1 Tax=Toxoplasma gondii VEG
           RepID=B9QEP3_TOXGO
          Length = 1733

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 38/102 (37%), Positives = 67/102 (65%), Gaps = 2/102 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+++P  P +A  + T+  P++   P++ PP++ P ++ P+P++P  +S P+ SPP  +P
Sbjct: 227 PSSSPPSPSSAPSSSTSPSPSSPPSPSSPPPSSPPSSSPPSPSSPPSSSPPSPSPPPSSP 286

Query: 239 ASTPSTAPTPSTA--GSPPAPTPDSLGPGPSGADTPPSPSAA 120
            S+ ST+P+PS+A   SPP+ +P S  P PS +  PPSP ++
Sbjct: 287 PSSSSTSPSPSSAPSSSPPSSSPSSSSPPPSSSPPPPSPPSS 328

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 45/120 (37%), Positives = 80/120 (66%), Gaps = 6/120 (5%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA---TPAPAS 273
           ++S  + +P  + + PP++ P+P++ P ++ +P  ++PP+++PP+   AP+   +P+P+S
Sbjct: 189 SSSPSSSSPPPSSSPPPSSPPSPSSAPSSSTSPSPSSPPSSSPPSPSSAPSSSTSPSPSS 248

Query: 272 SPATSPPAPTPASTPSTA-PTPST--AGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P  SP +P P+S PS++ P+PS+  + SPP+P+P    P PS + T PSPS+A S S P
Sbjct: 249 PP--SPSSPPPSSPPSSSPPSPSSPPSSSPPSPSPPPSSP-PSSSSTSPSPSSAPSSSPP 305

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 49/144 (34%), Positives = 85/144 (59%), Gaps = 21/144 (14%)
 Frame = -3

Query: 446 LATSCLAQAPTAAP------------TKPPTATPAPTAQPPAAATPPTATPPTATPPAAV 303
           L+ S L   PT+ P            + P +++ +P++ P +++ PP+++PP ++PP+  
Sbjct: 153 LSWSALVLGPTSEPFVHADLKMRPFLSPPSSSSSSPSSSPSSSSPPPSSSPPPSSPPSPS 212

Query: 302 PAPAT---PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTP----DSLGPGPSG-- 150
            AP++   P+P+S P++SPP+P+ A + ST+P+PS+  SP +P P     S  P PS   
Sbjct: 213 SAPSSSTSPSPSSPPSSSPPSPSSAPSSSTSPSPSSPPSPSSPPPSSPPSSSPPSPSSPP 272

Query: 149 ADTPPSPSAAFSYSKPIIAATALS 78
           + +PPSPS   S S P  ++T+ S
Sbjct: 273 SSSPPSPSPPPS-SPPSSSSTSPS 295

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 36/113 (31%), Positives = 68/113 (60%), Gaps = 4/113 (3%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS---- 273
           +S  + + + +P+ PP+ +  P + PP+++ P  ++PP+++PP+  P P++P  +S    
Sbjct: 235 SSAPSSSTSPSPSSPPSPSSPPPSSPPSSSPPSPSSPPSSSPPSPSPPPSSPPSSSSTSP 294

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
           SP+++P +  P+S+PS++  P ++  PP   P S  P  S   + PSPSA  S
Sbjct: 295 SPSSAPSSSPPSSSPSSSSPPPSSSPPPPSPPSSSPPSSSSPSSSPSPSADLS 347

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 36/148 (24%), Positives = 78/148 (52%), Gaps = 13/148 (8%)
 Frame = -3

Query: 503  LHPKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPT 324
            +HP    S++  + +     +   L  +P + P  P + +P+ +   P   +P +++  +
Sbjct: 561  MHPSSPYSSSPSVPVPPSSPSMPLLPSSPPSVPVPPSSPSPSSSLSAPVPPSPSSSSSHS 620

Query: 323  ATPPAAVP----APATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGP 156
            ++ P+ +P     P++P+P+S+ + S P PT +S+P ++P+PS+   P + +  S+ P P
Sbjct: 621  SSSPSVLPLPPHVPSSPSPSSASSPSMPLPTSSSSPPSSPSPSSPSVPLSSSSPSVPPSP 680

Query: 155  SG--------ADTPP-SPSAAFSYSKPI 99
            S         + +P  SP +A S+S+ +
Sbjct: 681  SSPVSVLFSRSSSPSFSPDSAPSFSESL 708

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 32/92 (34%), Positives = 63/92 (68%), Gaps = 5/92 (5%)
 Frame = -3

Query: 422 APTAAPTK-PPTATPAPTAQPPAAATPPT-ATPPTATPPAAVPAPATPAPASSPAT-SPP 252
           +P++ P+  PP+ +P P++ P +++T P+ ++ P+++PP++ P+ ++P P+SSP   SPP
Sbjct: 267 SPSSPPSSSPPSPSPPPSSPPSSSSTSPSPSSAPSSSPPSSSPSSSSPPPSSSPPPPSPP 326

Query: 251 APTP--ASTPSTAPTPSTAGSPPAPTPDSLGP 162
           + +P  +S+PS++P+PS   S  A  P +  P
Sbjct: 327 SSSPPSSSSPSSSPSPSADLSERAQGPANEAP 358

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 38/105 (36%), Positives = 59/105 (56%), Gaps = 4/105 (3%)
 Frame = -3

Query: 398 PPTATPAPT--AQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA--PTPAST 231
           PP++   P   + PP+   PP++  P+++  A  P P +P+ +SS ++S P+  P P   
Sbjct: 576 PPSSPSMPLLPSSPPSVPVPPSSPSPSSSLSA--PVPPSPSSSSSHSSSSPSVLPLPPHV 633

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPII 96
           PS +P+PS+A SP  P P S    PS + +P SPS   S S P +
Sbjct: 634 PS-SPSPSSASSPSMPLPTSSSSPPS-SPSPSSPSVPLSSSSPSV 676

[75][TOP]
>UniRef100_B9Q1D7 Chloride channel, putative n=1 Tax=Toxoplasma gondii GT1
           RepID=B9Q1D7_TOXGO
          Length = 1756

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 46/136 (33%), Positives = 83/136 (61%), Gaps = 23/136 (16%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT---PAPASS 270
           +S  + + + +P+ PP+++P P++ P +++ PP+++PP ++PP+   AP++   P+P+S 
Sbjct: 189 SSSPSTSTSPSPSSPPSSSP-PSSSPSSSSPPPSSSPPPSSPPSPSSAPSSSTSPSPSSP 247

Query: 269 PATSPPAPTPASTPSTAPTPST--------------------AGSPPAPTPDSLGPGPSG 150
           P++SPP+P+ A + ST+P+PS+                    + SPP+P+P    P PS 
Sbjct: 248 PSSSPPSPSSAPSSSTSPSPSSPPPSSPPSSSSTSPSPSSAPSSSPPSPSPPPSSP-PSS 306

Query: 149 ADTPPSPSAAFSYSKP 102
           + T PSPS+A S S P
Sbjct: 307 SSTSPSPSSAPSSSPP 322

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 40/115 (34%), Positives = 79/115 (68%), Gaps = 8/115 (6%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATP-APTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           +S  + + + +P+ PP+++P +P++ P ++ +P  ++PP ++PP++  +  +P+P+S+P+
Sbjct: 233 SSAPSSSTSPSPSSPPSSSPPSPSSAPSSSTSPSPSSPPPSSPPSS--SSTSPSPSSAPS 290

Query: 263 TSPPAPTPA-----STPSTAPTPSTA--GSPPAPTPDSLGPGPSGADTPPSPSAA 120
           +SPP+P+P      S+ ST+P+PS+A   SPP+ +P S  P PS +  PPSP ++
Sbjct: 291 SSPPSPSPPPSSPPSSSSTSPSPSSAPSSSPPSSSPSSSSPPPSSSPPPPSPPSS 345

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 48/142 (33%), Positives = 82/142 (57%), Gaps = 27/142 (19%)
 Frame = -3

Query: 446 LATSCLAQAPTAAP------------TKPPTATPAPTAQPPAAATPPTATPPTATPPAAV 303
           L+ S L   PT+ P            + P +++ +P++ P  + +P  ++PP+++PP++ 
Sbjct: 153 LSWSALVLGPTSEPFVHADLKMRPFLSPPSSSSSSPSSSPSTSTSPSPSSPPSSSPPSSS 212

Query: 302 PAPATPAPASSPA-TSPPAPTPASTPSTAPTPST--AGSPP----------APTPDSLGP 162
           P+ ++P P+SSP  +SPP+P+ A + ST+P+PS+  + SPP          +P+P S  P
Sbjct: 213 PSSSSPPPSSSPPPSSPPSPSSAPSSSTSPSPSSPPSSSPPSPSSAPSSSTSPSPSSPPP 272

Query: 161 G--PSGADTPPSPSAAFSYSKP 102
              PS + T PSPS+A S S P
Sbjct: 273 SSPPSSSSTSPSPSSAPSSSPP 294

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 38/115 (33%), Positives = 72/115 (62%), Gaps = 12/115 (10%)
 Frame = -3

Query: 422 APTAAPTK---------PPTATPAPTAQPPAAATPPTATPPTATPPAAVP---APATPAP 279
           +P++AP+          PP++ P+ ++  P+ ++ P+++PP+ +PP + P   +  +P+P
Sbjct: 254 SPSSAPSSSTSPSPSSPPPSSPPSSSSTSPSPSSAPSSSPPSPSPPPSSPPSSSSTSPSP 313

Query: 278 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
           +S+P++SPP+ +P+   S++P PS++  PP+P P S  P  S   + PSPSA  S
Sbjct: 314 SSAPSSSPPSSSPS---SSSPPPSSSPPPPSP-PSSSPPSSSSPSSSPSPSADLS 364

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 35/134 (26%), Positives = 71/134 (52%), Gaps = 4/134 (2%)
 Frame = -3

Query: 503 LHPKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPT 324
           +HP    S++  + +     +   L  +P + P  P + +P+ +   P   +P +++  +
Sbjct: 578 VHPSSPYSSSPSVPVPPSSPSMPLLPSSPPSVPVPPSSPSPSSSLSAPVPPSPSSSSSHS 637

Query: 323 ATPPAAVP----APATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGP 156
           ++ P+ +P     P++P+P+S+ + S P PT +S+P  +P+PS+    P+P+  S+    
Sbjct: 638 SSSPSVLPLPPHVPSSPSPSSASSPSMPLPTLSSSPPPSPSPSS----PSPSSPSVPLSS 693

Query: 155 SGADTPPSPSAAFS 114
           S    PPSPS+  S
Sbjct: 694 SSPSVPPSPSSPVS 707

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 34/99 (34%), Positives = 68/99 (68%), Gaps = 5/99 (5%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTK-PPTATPAPTAQPPAAATPPT-ATPPTATPPAAVPAPATPAPASS 270
           ++S  + +P++AP+  PP+ +P P++ P +++T P+ ++ P+++PP++ P+ ++P P+SS
Sbjct: 277 SSSSTSPSPSSAPSSSPPSPSPPPSSPPSSSSTSPSPSSAPSSSPPSSSPSSSSPPPSSS 336

Query: 269 PAT-SPPAPTP--ASTPSTAPTPSTAGSPPAPTPDSLGP 162
           P   SPP+ +P  +S+PS++P+PS   S  A  P +  P
Sbjct: 337 PPPPSPPSSSPPSSSSPSSSPSPSADLSERAQGPANEAP 375

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 39/109 (35%), Positives = 60/109 (55%), Gaps = 8/109 (7%)
 Frame = -3

Query: 398 PPTATPAPT--AQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA--PTPAST 231
           PP++   P   + PP+   PP++  P+++  A  P P +P+ +SS ++S P+  P P   
Sbjct: 593 PPSSPSMPLLPSSPPSVPVPPSSPSPSSSLSA--PVPPSPSSSSSHSSSSPSVLPLPPHV 650

Query: 230 PSTAPTPSTAGSPPAPTPD-SLGPGPS---GADTPPSPSAAFSYSKPII 96
           PS+ P+PS+A SP  P P  S  P PS    + +P SPS   S S P +
Sbjct: 651 PSS-PSPSSASSPSMPLPTLSSSPPPSPSPSSPSPSSPSVPLSSSSPSV 698

[76][TOP]
>UniRef100_Q18DZ3 Probable cell surface glycoprotein n=1 Tax=Haloquadratum walsbyi
           DSM 16790 RepID=Q18DZ3_HALWD
          Length = 1358

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 49/108 (45%), Positives = 62/108 (57%), Gaps = 9/108 (8%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATPPAAVPAPATPAPASSPATSP-P 252
           +PT+ PT  PT +P PT  PPA ATP PT TP PT  P    P  + P P ++P  +P P
Sbjct: 319 SPTSTPTPSPTPSPTPTPTPPATATPTPTPTPSPTPAPTNTPPPTSAPTPTATPTPTPTP 378

Query: 251 APTPASTPSTAPTPS---TAGSPPAPTPDSLGPGPSGADTP---PSPS 126
            PTP +TP+  PTP+   TA   P PTP +  P P+   TP   P+PS
Sbjct: 379 TPTPTATPTPTPTPTPTPTATPTPTPTP-TPSPTPTATPTPTPTPTPS 425

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 49/114 (42%), Positives = 64/114 (56%), Gaps = 7/114 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPA-TPAPASSPATSP-P 252
           +PT +PT  PT TP PT  P  + TP PT TP     P + P P+ TP+P S+P  SP P
Sbjct: 259 SPTPSPTPTPTQTPTPTPLPTPSPTPTPTQTPTPTLTPTSTPTPSPTPSPTSTPTPSPTP 318

Query: 251 APTPASTPSTAPTPSTAGSPPA---PTP-DSLGPGPSGADTPPSPSAAFSYSKP 102
           +PT   TPS  P+P+   +PPA   PTP  +  P P+  +TPP  SA    + P
Sbjct: 319 SPTSTPTPSPTPSPTPTPTPPATATPTPTPTPSPTPAPTNTPPPTSAPTPTATP 372

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 47/113 (41%), Positives = 61/113 (53%), Gaps = 6/113 (5%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPA---TPAPASSPATSP 255
           +PT  PT P TATP PT  P     P    PPT+ P P A P P    TP P ++P  +P
Sbjct: 331 SPTPTPTPPATATPTPTPTPSPTPAPTNTPPPTSAPTPTATPTPTPTPTPTPTATPTPTP 390

Query: 254 -PAPTPASTPSTAPTPSTAGSPPA-PTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P PTP +TP+  PTP+ + +P A PTP    P P+ + TP +   A + S P
Sbjct: 391 TPTPTPTATPTPTPTPTPSPTPTATPTPT---PTPTPSPTPTATPTATATSTP 440

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 52/113 (46%), Positives = 65/113 (57%), Gaps = 15/113 (13%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP-PTATP---PTATPPA-AVPAPA-TPAPASSPATS 258
           PT +PT  PT+TP P+  P   +TP P+ TP   PT TPPA A P P  TP+P  +P  +
Sbjct: 300 PTPSPTPSPTSTPTPSPTPSPTSTPTPSPTPSPTPTPTPPATATPTPTPTPSPTPAPTNT 359

Query: 257 PP---APTPASTPSTAPTPS---TAGSPPAPTPDSLGPGPSGADTP---PSPS 126
           PP   APTP +TP+  PTP+   TA   P PTP    P P+   TP   P+PS
Sbjct: 360 PPPTSAPTPTATPTPTPTPTPTPTATPTPTPTPT---PTPTATPTPTPTPTPS 409

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 47/109 (43%), Positives = 57/109 (52%), Gaps = 3/109 (2%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATP---PTATPPTATPPAAVPAPATPAPAS 273
           AT+     PT +PT  PT TP PT+ P   ATP   PT TP     P   P P TP P +
Sbjct: 340 ATATPTPTPTPSPTPAPTNTPPPTSAPTPTATPTPTPTPTPTPTATPTPTPTP-TPTPTA 398

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           +P T  P PTP+ TP+  PTP T    P+PTP +  P  +   TP  PS
Sbjct: 399 TP-TPTPTPTPSPTPTATPTP-TPTPTPSPTPTAT-PTATATSTPTPPS 444

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 41/102 (40%), Positives = 58/102 (56%), Gaps = 4/102 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAP-ATPAPASSPATSP-PA 249
           PT +PT  PT TP PT  P +  TP     PT+TP P+  P+P +TP P+ +P+ +P P 
Sbjct: 278 PTPSPTPTPTQTPTPTLTPTSTPTPSPTPSPTSTPTPSPTPSPTSTPTPSPTPSPTPTPT 337

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSPS 126
           P   +TP+  PTPS   +P    P +  P P+   TP P+P+
Sbjct: 338 PPATATPTPTPTPSPTPAPTNTPPPTSAPTPTATPTPTPTPT 379

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 51/137 (37%), Positives = 68/137 (49%), Gaps = 14/137 (10%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP---PAAVPAPA-TPAPA 276
           AT+      T   T  PT TP PT  P  + TP     PT TP   P+  P P  TP P 
Sbjct: 234 ATATATITSTPVSTSTPTQTPTPTPSPTPSPTPTPTQTPTPTPLPTPSPTPTPTQTPTPT 293

Query: 275 SSPATSP---PAPTPASTPSTAPTPSTAGSP-PAPTPD-SLGPGPSGADTP-----PSPS 126
            +P ++P   P P+P STP+ +PTPS   +P P+PTP  +  P P    TP     PSP+
Sbjct: 294 LTPTSTPTPSPTPSPTSTPTPSPTPSPTSTPTPSPTPSPTPTPTPPATATPTPTPTPSPT 353

Query: 125 AAFSYSKPIIAATALSA 75
            A + + P  +A   +A
Sbjct: 354 PAPTNTPPPTSAPTPTA 370

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 50/98 (51%), Positives = 56/98 (57%), Gaps = 11/98 (11%)
 Frame = -3

Query: 422 APTAAPTK--PPTATPAPTAQPPAAATP---PTATP-PTATP---PAAVPAPATPAPASS 270
           +PT APT   PPT+ P PTA P    TP   PTATP PT TP   P A P P TP P  S
Sbjct: 351 SPTPAPTNTPPPTSAPTPTATPTPTPTPTPTPTATPTPTPTPTPTPTATPTP-TPTPTPS 409

Query: 269 PA-TSPPAPTPASTPSTAPTPS-TAGSPPAPTPDSLGP 162
           P  T+ P PTP  TPS  PT + TA +   PTP S+ P
Sbjct: 410 PTPTATPTPTPTPTPSPTPTATPTATATSTPTPPSVEP 447

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 53/133 (39%), Positives = 66/133 (49%), Gaps = 23/133 (17%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQ--PPAAATPP-TATPPTATPPAAVPAPATPAPASSPATSP- 255
           +PTA PT  PTAT  PTA   P A AT   T+TP + + P   P P TP+P  SP  +P 
Sbjct: 211 SPTATPTATPTATATPTATSTPTATATATITSTPVSTSTPTQTPTP-TPSPTPSPTPTPT 269

Query: 254 --PAPTPASTPSTAPTPSTAGSP---------PAPTPD-------SLGPGPSGADTP-PS 132
             P PTP  TPS  PTP+   +P         P+PTP        S  P P+   TP P+
Sbjct: 270 QTPTPTPLPTPSPTPTPTQTPTPTLTPTSTPTPSPTPSPTSTPTPSPTPSPTSTPTPSPT 329

Query: 131 PSAAFSYSKPIIA 93
           PS   + + P  A
Sbjct: 330 PSPTPTPTPPATA 342

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 49/131 (37%), Positives = 61/131 (46%), Gaps = 12/131 (9%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSP 267
           AT      PTA  T   T+TP  T+ P    TP  +  P+ TP P   P P TP P  SP
Sbjct: 224 ATPTATSTPTATATATITSTPVSTSTPTQTPTPTPSPTPSPTPTPTQTPTP-TPLPTPSP 282

Query: 266 ATSP-----PAPTPASTPSTAPTPSTAGSP-PAPTPD-----SLGPGPSGADTPPSPSAA 120
             +P     P  TP STP+ +PTPS   +P P+PTP      +  P PS   TP  P+ A
Sbjct: 283 TPTPTQTPTPTLTPTSTPTPSPTPSPTSTPTPSPTPSPTSTPTPSPTPSPTPTPTPPATA 342

Query: 119 FSYSKPIIAAT 87
                P  + T
Sbjct: 343 TPTPTPTPSPT 353

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 48/119 (40%), Positives = 57/119 (47%), Gaps = 6/119 (5%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATP-PTATPPAAVPAPATPAPASSPA 264
           T      PT  PT  PTATP PT   P     PTATP PT TP  +    ATP P  +P 
Sbjct: 367 TPTATPTPTPTPTPTPTATPTPT---PTPTPTPTATPTPTPTPTPSPTPTATPTPTPTPT 423

Query: 263 TSP-PAPTPASTPSTAPT-PSTAGSPPAPTPD---SLGPGPSGADTPPSPSAAFSYSKP 102
            SP P  TP +T ++ PT PS   + P  T D   S     SG+ T  S   + S +KP
Sbjct: 424 PSPTPTATPTATATSTPTPPSVEPTTPVDTEDENESDSDSSSGSST-DSSGGSNSNNKP 481

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 50/134 (37%), Positives = 61/134 (45%), Gaps = 14/134 (10%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATP-PTATP-----PTATPPAAVPAPATPA 282
           AT      PT  PT  PT TP PT  P   ATP PT TP     PTATP A   A +TP 
Sbjct: 384 ATPTPTPTPTPTPTATPTPTPTPTPSPTPTATPTPTPTPTPSPTPTATPTAT--ATSTPT 441

Query: 281 PASSPATSP-----PAPTPASTPSTAPTPSTAGSPPAPTPD--SLGPGPSGADTP-PSPS 126
           P S   T+P        + + + S + T S+ GS     PD  S    P+   TP P PS
Sbjct: 442 PPSVEPTTPVDTEDENESDSDSSSGSSTDSSGGSNSNNKPDKQSTPKAPTPTPTPTPIPS 501

Query: 125 AAFSYSKPIIAATA 84
                 +P + +TA
Sbjct: 502 -----ERPTVGSTA 510

[77][TOP]
>UniRef100_Q9FPQ6 Vegetative cell wall protein gp1 n=1 Tax=Chlamydomonas reinhardtii
           RepID=GP1_CHLRE
          Length = 555

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 55/129 (42%), Positives = 71/129 (55%), Gaps = 2/129 (1%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           A T  P  PP+  P+P   PP   TPP+ +PP+  PP+  P P +PAP S   + PP+P 
Sbjct: 282 ANTPMPPSPPSPPPSPA--PPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPA 339

Query: 242 PASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAAFSYSKPIIAATALSAAL 69
           P  TPS +P+PS + SP P+P+P S  P PS   +P P PS       P   A  L  A 
Sbjct: 340 P-PTPSPSPSPSPSPSPSPSPSP-SPSPSPSPIPSPSPKPS-------PSPVAVKLVWAD 390

Query: 68  FAIAF*DLS 42
            AIAF DL+
Sbjct: 391 DAIAFDDLN 399

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 43/99 (43%), Positives = 59/99 (59%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
           P+ AP  P   +PAP + P  A  PP+  PP+  PP+ A P+PA P+PA  P+ +PP+P 
Sbjct: 61  PSPAPPSPGPPSPAPPSPPSPA--PPSPAPPSPAPPSPAPPSPAPPSPAP-PSPAPPSPA 117

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P S PS AP   +  +PP+P+P S  P    +  PPSPS
Sbjct: 118 PPSPPSPAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPS 156

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 41/100 (41%), Positives = 59/100 (59%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV-PAPATPAPASSPATSPPAPT 243
           P+ AP  P   +PAP +  P +  PP+  PP+  PP+   PAP +P+P + P+ SPP+P 
Sbjct: 84  PSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSPSPPSPA 143

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPS-GADTPPSPS 126
           P   PS AP   +   PP+P+P  + P P+  + TPPSPS
Sbjct: 144 PPLPPSPAPPSPSPPVPPSPSP-PVPPSPAPPSPTPPSPS 182

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 38/96 (39%), Positives = 56/96 (58%), Gaps = 1/96 (1%)
 Frame = -3

Query: 410 APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV-PAPATPAPASSPATSPPAPTPAS 234
           +P  P  A P+P    PA  +PP+  PP+ +PPA   P+P +PAP   P+ +PP+P+P  
Sbjct: 100 SPAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPV 159

Query: 233 TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            PS +P    + +PP+PTP S  P    +  PPSP+
Sbjct: 160 PPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPA 195

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTA---TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           P+ AP  PP+    +PAP +  P +  PP+  PP+  PP+  PAP +PAP S P+ +PP+
Sbjct: 71  PSPAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPS--PAPPSPAPPSPPSPAPPS 128

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P+P + PS +P       PP+P P S  P    + +PP P
Sbjct: 129 PSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVP 168

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 44/104 (42%), Positives = 56/104 (53%), Gaps = 5/104 (4%)
 Frame = -3

Query: 419 PTAAPTKPPT-ATPAPTAQPPAAATPPTATPPTATPPA----AVPAPATPAPASSPATSP 255
           P+ +P  PP+ A P+PT   P+   PP+  PP+  PP     A P+PA P P S    SP
Sbjct: 161 PSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPSP 220

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
           P+P P S PS AP   +  +PP+P P S  P PS A   P P A
Sbjct: 221 PSPAPPSPPSPAPPSPSPPAPPSPVPPSPAP-PSPAPPSPKPPA 263

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 47/131 (35%), Positives = 65/131 (49%), Gaps = 14/131 (10%)
 Frame = -3

Query: 476 AVQIFLILGLLATSCLAQA---------PTAAPTKPPTATPAPTAQPPAAATPPTATPPT 324
           AV + +++     S  AQ          P+ AP  P   +PAP +  P +  PP+  PP+
Sbjct: 13  AVNVLMVVLAFVASANAQCVPGGIFNCPPSPAPPSPAPPSPAPPSPAPPSPAPPSPGPPS 72

Query: 323 ATPPA----AVPAPATPAPAS-SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG 159
             PP+    A P+PA P+PA  SPA   PAP   + PS AP      SPP+P P S  P 
Sbjct: 73  PAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPP 132

Query: 158 PSGADTPPSPS 126
              + +PPSP+
Sbjct: 133 APPSPSPPSPA 143

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 44/103 (42%), Positives = 58/103 (56%), Gaps = 5/103 (4%)
 Frame = -3

Query: 419 PTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPAAV-PAPATPAPASSPATSPPAP 246
           P+ AP  P P   P+P+   P +  PP+ TPP+ +PP    PAP +PAP   P+ +PP+P
Sbjct: 148 PSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSP 207

Query: 245 TPASTPSTAPT--PSTAG-SPPAPTPDSLGPGPSGADTPPSPS 126
            P   PS AP   PS A  SPP+P P S  P    +  PPSP+
Sbjct: 208 APPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSPA 250

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 42/109 (38%), Positives = 57/109 (52%), Gaps = 3/109 (2%)
 Frame = -3

Query: 419 PTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS--PATSPPA 249
           P+ AP  P P A P+P+   PA   PP+  PP+ +PP   P+P+ P P S   P+ +PP+
Sbjct: 122 PSPAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVP-PSPSPPVPPSPAPPSPTPPS 180

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           P+P   PS AP       PP+P P S  P    +  PPSP +    S P
Sbjct: 181 PSPPVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAPPSPP 229

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 43/102 (42%), Positives = 55/102 (53%), Gaps = 5/102 (4%)
 Frame = -3

Query: 419 PTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPA----AVPAPATPAPASSPATSP 255
           P+  P  P P   P+P    PA   PP+  PP+  PP     A P+P +PAP S P+ +P
Sbjct: 174 PSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAP 233

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P+P+P + PS  P PS A  PP+P P S  P P     PPSP
Sbjct: 234 PSPSPPAPPSPVP-PSPA--PPSPAPPS--PKPPAPPPPPSP 270

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 47/130 (36%), Positives = 63/130 (48%), Gaps = 26/130 (20%)
 Frame = -3

Query: 419 PTAAPTKPPT------ATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAP------- 279
           P+ AP  PP+      + PAP +  P +  PP+  PP+  PPA  P P+ P P       
Sbjct: 221 PSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPF 280

Query: 278 -ASSPAT-SPPAPTPASTPSTAPTP-----------STAGSPPAPTPDSLGPGPSGADTP 138
            A++P   SPP+P P+  P T PTP           S A  PP+P P S  P P  +  P
Sbjct: 281 PANTPMPPSPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAP 340

Query: 137 PSPSAAFSYS 108
           P+PS + S S
Sbjct: 341 PTPSPSPSPS 350

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 41/100 (41%), Positives = 52/100 (52%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAP 246
           P+ AP  P   +PAP + P PA  +P    PP+ +PP+ A P P +PAP S     PP+P
Sbjct: 104 PSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSP 163

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           +P   PS AP   T  SP  P P S  P       PPSP+
Sbjct: 164 SPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSPA 203

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 43/112 (38%), Positives = 59/112 (52%), Gaps = 13/112 (11%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAP 246
           AP + P+  P + P+P    P+   PP+  PP+  PP+ A P+P  PAP   P+  PP P
Sbjct: 216 APPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPP 275

Query: 245 T----PAST--------PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
                PA+T        P  +P P T  +PP+P+P S  P PS A  PPSP+
Sbjct: 276 PRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSPPSPVP-PSPAPVPPSPA 326

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 42/106 (39%), Positives = 52/106 (49%), Gaps = 8/106 (7%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV------PAPATPAPASS--PA 264
           P+ AP  PP+  P P+   PA  +PP+  PP+ +PPA        PAP +PAP S   PA
Sbjct: 205 PSPAPPVPPSPAP-PSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPA 263

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             PP   P   P   P P+    PP+P      P P    TPPSPS
Sbjct: 264 PPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPS 309

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 37/99 (37%), Positives = 52/99 (52%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV-PAPATPAPASSPATSPPAPT 243
           P+ AP  PP+  P P+  PP   +P   +PP+  PP+   PAP +P+P + P+  PP+P 
Sbjct: 192 PSPAPPVPPSPAP-PSPAPPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSPA 250

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P S    +P P     PP+P P      P  A+TP  PS
Sbjct: 251 PPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPS 289

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 36/96 (37%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = -3

Query: 410 APTKPPTATPAPTAQPPAAATPPTATPPTATPP-AAVPAPATPAPASSPATSPPAPTPAS 234
           +P  P   +PAP +  P A  PP+ +PP+  PP    PAP +P+P   P+ SPP P   +
Sbjct: 115 SPAPPSPPSPAPPSPSPPA--PPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPA 172

Query: 233 TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            PS  P   +   PP+P P S  P    +  PPSP+
Sbjct: 173 PPSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSPA 208

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 45/108 (41%), Positives = 56/108 (51%), Gaps = 1/108 (0%)
 Frame = -3

Query: 419 PTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           P+ AP  P P   P+P    PA   PP+  PP+   PA  P+P +PAP   P+ SPPAP 
Sbjct: 187 PSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAP-PSPPSPAP---PSPSPPAPP 242

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
               PS AP PS A  PP+P P +  P PS    PP P   F  + P+
Sbjct: 243 SPVPPSPAP-PSPA--PPSPKPPAPPPPPS-PPPPPPPRPPFPANTPM 286

[78][TOP]
>UniRef100_Q9ZT17 Classical arabinogalactan protein 3 n=1 Tax=Arabidopsis thaliana
           RepID=AGP3_ARATH
          Length = 139

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 52/146 (35%), Positives = 71/146 (48%), Gaps = 8/146 (5%)
 Frame = -3

Query: 473 VQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP 294
           +Q  + LGL A SCLAQAP  AP      T  P  + P+    PTA PP        P  
Sbjct: 6   LQALIFLGLFAASCLAQAPAPAPI-----TFLPPVESPSPVVTPTAEPP-------APVA 53

Query: 293 ATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA--- 123
           + P PA+ P   P  P   S P+T+PT S   SPP P   +L PGPSG    P+P+    
Sbjct: 54  SPPIPANEPTPVPTTPPTVSPPTTSPTTSPVASPPKPY--ALAPGPSGPTPAPAPAPRAD 111

Query: 122 -----AFSYSKPIIAATALSAALFAI 60
                +   +K  + +T ++ AL+A+
Sbjct: 112 GPVADSALTNKAFLVSTVIAGALYAV 137

[79][TOP]
>UniRef100_UPI0000F1FA8B PREDICTED: hypothetical protein n=1 Tax=Danio rerio
            RepID=UPI0000F1FA8B
          Length = 1333

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 60/159 (37%), Positives = 77/159 (48%), Gaps = 19/159 (11%)
 Frame = -3

Query: 491  MASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQP---PAAATPPTATPPTA 321
            MASS        L  +  S +A A  A PT  PTA P P A P   PAA   P A PPTA
Sbjct: 886  MASSTESASSAALYPVTPSQIAPATAATPTTTPTAIPVPAAAPIPAPAATPAPPAAPPTA 945

Query: 320  TPPAAVP--APATPAPASSPATSPP------AP---TPASTPSTAPTPSTAGSPPA---- 186
             P  A P  APAT  P ++PAT+PP      AP    PA+ P+TAP P+   + P+    
Sbjct: 946  APATAPPTAAPATAPPTAAPATAPPPAVLATAPLPAVPATAPATAPPPADPVTAPSAAAA 1005

Query: 185  -PTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
               P +  P P+   T  +P  A   + P+ A +  +AA
Sbjct: 1006 VTAPPAAAPVPATTPTAAAPPVAAPPAAPVFATSPTAAA 1044

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 55/136 (40%), Positives = 66/136 (48%), Gaps = 20/136 (14%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAA------------TPPTATPPTATPPAAV-PAPATPAP 279
            P AAP   P ATPAP A PP AA             PPTA P TA PPA +  AP    P
Sbjct: 924  PAAAPIPAPAATPAPPAAPPTAAPATAPPTAAPATAPPTAAPATAPPPAVLATAPLPAVP 983

Query: 278  ASSPATSPPAPTPASTPSTA---PTPSTAGSPPAPTPDSLGPGPSGADTPP----SPSAA 120
            A++PAT+PP   P + PS A     P  A   PA TP +  P  +     P    SP+AA
Sbjct: 984  ATAPATAPPPADPVTAPSAAAAVTAPPAAAPVPATTPTAAAPPVAAPPAAPVFATSPTAA 1043

Query: 119  FSYSKPIIAATALSAA 72
               + P+ A T  +AA
Sbjct: 1044 APPAAPVSATTPTAAA 1059

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 52/133 (39%), Positives = 66/133 (49%), Gaps = 7/133 (5%)
 Frame = -3

Query: 449  LLATSCLAQAPTAAPTKPPTATPA-PTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS 273
            + ATS  A AP AAP    T T A P A P  A TP  A PP    PA  P  A+P  A 
Sbjct: 1125 VFATSPTAAAPPAAPVSATTPTAAAPPADPVPATTPTAAAPPADPVPATSPTAASPFAAP 1184

Query: 272  SPATSPPA------PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSY 111
             PAT+P A      P PA+TP+ A  P+ A +PPA  P +  P  +    PP+ + A   
Sbjct: 1185 VPATTPTAATPPATPVPATTPTAAAHPAPAIAPPAAAPTTALPAAAPITAPPTAAPAALA 1244

Query: 110  SKPIIAATALSAA 72
            + P  A+ A + A
Sbjct: 1245 TAPATASPATAPA 1257

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 60/136 (44%), Positives = 72/136 (52%), Gaps = 10/136 (7%)
 Frame = -3

Query: 449  LLATSCLAQAPTAAP-TKPPTATP--APTAQ-----PPAAATPPTATPPTATPPAAVPAP 294
            +LAT+ L   P  AP T PP A P  AP+A      PPAAA  P  TP  A PP A P P
Sbjct: 973  VLATAPLPAVPATAPATAPPPADPVTAPSAAAAVTAPPAAAPVPATTPTAAAPPVAAP-P 1031

Query: 293  ATPAPASSP--ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            A P  A+SP  A  P AP  A+TP+ A  P  A   PA TP +  P P+      SP+AA
Sbjct: 1032 AAPVFATSPTAAAPPAAPVSATTPTAAAPP--ADPVPATTPTATAP-PAAPVFATSPTAA 1088

Query: 119  FSYSKPIIAATALSAA 72
             S + P+ A T  +AA
Sbjct: 1089 ASPAAPVSATTPTAAA 1104

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 63/165 (38%), Positives = 82/165 (49%), Gaps = 20/165 (12%)
 Frame = -3

Query: 497  PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT 318
            P +A+  A  +F      ATS  A AP AAP    T T A     P  AT PTAT P A 
Sbjct: 1025 PPVAAPPAAPVF------ATSPTAAAPPAAPVSATTPTAAAPPADPVPATTPTATAPPAA 1078

Query: 317  P-----PAAVPAPATPAPASSP-ATSPPA-PTPASTP-STAP-------TPSTAGSPP-- 189
            P     P A  +PA P  A++P A +PPA P PA+TP +TAP       T  TA +PP  
Sbjct: 1079 PVFATSPTAAASPAAPVSATTPTAAAPPADPVPATTPTATAPPAAPVFATSPTAAAPPAA 1138

Query: 188  ---APTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAALFA 63
               A TP +  P P+      +P+AA   + P+ A +  +A+ FA
Sbjct: 1139 PVSATTPTAAAP-PADPVPATTPTAAAPPADPVPATSPTAASPFA 1182

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 56/144 (38%), Positives = 70/144 (48%), Gaps = 23/144 (15%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTAT----PAPTAQPPAAA-------TPPTATPPTATPPAAVPA 297
            AT+  A  P A P    T T    PAP   PPAAA         P   PPTA P A   A
Sbjct: 1187 ATTPTAATPPATPVPATTPTAAAHPAPAIAPPAAAPTTALPAAAPITAPPTAAPAALATA 1246

Query: 296  PATPAPASSPATSPPAPTPAST----PSTAP---TPSTAGSPPAP-----TPDSLGPGPS 153
            PAT +PA++PAT+ PA  P +T    P+TAP    P+TA    AP     TP + G  P 
Sbjct: 1247 PATASPATAPATASPAAAPPATAPAAPATAPPAAAPTTAPPAAAPTTALVTPAAPGTAPP 1306

Query: 152  GADTPPSPSAAFSYSKPIIAATAL 81
             A T PS +A  +++    + T L
Sbjct: 1307 AAATAPSTAAPATFTSTTGSPTDL 1330

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 60/144 (41%), Positives = 72/144 (50%), Gaps = 20/144 (13%)
 Frame = -3

Query: 443  ATSCLAQAPTAAP---TKP----PTATPAPTAQPPAAA------TPPTATPPTATPPAA- 306
            ATS  A +P AAP   T P    P ATP P   P AAA       PP A P TA P AA 
Sbjct: 1172 ATSPTAASPFAAPVPATTPTAATPPATPVPATTPTAAAHPAPAIAPPAAAPTTALPAAAP 1231

Query: 305  VPAPATPAP---ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP---GPSGAD 144
            + AP T AP   A++PAT+ PA  PA+    A  P+TA + PA  P +  P    P+ A 
Sbjct: 1232 ITAPPTAAPAALATAPATASPATAPATASPAAAPPATAPAAPATAPPAAAPTTAPPAAAP 1291

Query: 143  TPPSPSAAFSYSKPIIAATALSAA 72
            T    + A   + P  AATA S A
Sbjct: 1292 TTALVTPAAPGTAPPAAATAPSTA 1315

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 50/128 (39%), Positives = 64/128 (50%), Gaps = 5/128 (3%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSP 267
            AT+  A AP AAP    + T A +   P +AT PTA  P A P PA  P    P  A   
Sbjct: 1067 ATTPTATAPPAAPVFATSPTAAASPAAPVSATTPTAAAPPADPVPATTPTATAPPAAPVF 1126

Query: 266  ATSPPAPTPASTPSTAPTPSTAGSP----PAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
            ATSP A  P + P +A TP+ A  P    PA TP +  P P+      SP+AA  ++ P+
Sbjct: 1127 ATSPTAAAPPAAPVSATTPTAAAPPADPVPATTPTAAAP-PADPVPATSPTAASPFAAPV 1185

Query: 98   IAATALSA 75
             A T  +A
Sbjct: 1186 PATTPTAA 1193

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 62/172 (36%), Positives = 77/172 (44%), Gaps = 25/172 (14%)
 Frame = -3

Query: 497  PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQP--------PAAATPP 342
            P  A+S          + AT+  A AP A P   P  TP  TA P        P AA PP
Sbjct: 1079 PVFATSPTAAASPAAPVSATTPTAAAPPADPV--PATTPTATAPPAAPVFATSPTAAAPP 1136

Query: 341  ----TATPPTATPPAAVPAPAT----------PAPASSPATSPP--APTPASTPSTAPTP 210
                +AT PTA  P A P PAT          P PA+SP  + P  AP PA+TP+ A  P
Sbjct: 1137 AAPVSATTPTAAAPPADPVPATTPTAAAPPADPVPATSPTAASPFAAPVPATTPTAATPP 1196

Query: 209  STAGSPPAPTPDSLG-PGPSGADTPPSPSAAFSYSKPIIAATALSAALFAIA 57
            +T    PA TP +   P P+ A    +P+ A   + PI A    + A  A A
Sbjct: 1197 AT--PVPATTPTAAAHPAPAIAPPAAAPTTALPAAAPITAPPTAAPAALATA 1246

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 60/151 (39%), Positives = 73/151 (48%), Gaps = 32/151 (21%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATP---PTATPPTATPPAAVPAPATPAPASSP-AT 261
            A +  AA T PP A P P   P AAA P   P A P  AT P A   PA P  A++P A 
Sbjct: 999  APSAAAAVTAPPAAAPVPATTPTAAAPPVAAPPAAPVFATSPTAAAPPAAPVSATTPTAA 1058

Query: 260  SPPA-PTPASTPS-TAP--------TPSTAGSPPAP----TPDSLGP--GPSGADTP--- 138
            +PPA P PA+TP+ TAP        +P+ A SP AP    TP +  P   P  A TP   
Sbjct: 1059 APPADPVPATTPTATAPPAAPVFATSPTAAASPAAPVSATTPTAAAPPADPVPATTPTAT 1118

Query: 137  ---------PSPSAAFSYSKPIIAATALSAA 72
                      SP+AA   + P+ A T  +AA
Sbjct: 1119 APPAAPVFATSPTAAAPPAAPVSATTPTAAA 1149

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 50/125 (40%), Positives = 63/125 (50%), Gaps = 7/125 (5%)
 Frame = -3

Query: 443  ATSCLAQAPTAAP---TKPPTATP--APT-AQPPAAATPPTATPPTATPPAAV-PAPATP 285
            AT+  A AP A P   T P  A+P  AP  A  P AATPP    P  TP AA  PAPA  
Sbjct: 1157 ATTPTAAAPPADPVPATSPTAASPFAAPVPATTPTAATPPATPVPATTPTAAAHPAPAIA 1216

Query: 284  APASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSK 105
             PA++P T+ PA  P + P TA   + A +P   +P +     S A  PP+ + A   + 
Sbjct: 1217 PPAAAPTTALPAAAPITAPPTAAPAALATAPATASPATAPATASPAAAPPATAPAAPATA 1276

Query: 104  PIIAA 90
            P  AA
Sbjct: 1277 PPAAA 1281

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 52/150 (34%), Positives = 71/150 (47%), Gaps = 15/150 (10%)
 Frame = -3

Query: 494  KMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATP----- 330
            K A      + L   L+A+S   ++ ++A   P T    P+   PA A  PT TP     
Sbjct: 870  KTAEMRGSNLALAASLMASS--TESASSAALYPVT----PSQIAPATAATPTTTPTAIPV 923

Query: 329  PTATP---PAAVPAPATPAPASSPATSPPAPTPA-----STPSTAPTPSTAGSPPAPTPD 174
            P A P   PAA PAP    P ++PAT+PP   PA     + P+TAP P+   + P P   
Sbjct: 924  PAAAPIPAPAATPAPPAAPPTAAPATAPPTAAPATAPPTAAPATAPPPAVLATAPLPAVP 983

Query: 173  SLGP--GPSGADTPPSPSAAFSYSKPIIAA 90
            +  P   P  AD   +PSAA + + P  AA
Sbjct: 984  ATAPATAPPPADPVTAPSAAAAVTAPPAAA 1013

[80][TOP]
>UniRef100_Q1EPA3 Protein kinase family protein n=1 Tax=Musa acuminata
           RepID=Q1EPA3_MUSAC
          Length = 648

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 47/112 (41%), Positives = 62/112 (55%), Gaps = 6/112 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P  AP  P  + P P   PP A+TPP   PP+A+PP A   P  P  A+ P T+ P P P
Sbjct: 72  PPPAPPPPSVSPPPPALSPPPASTPP--RPPSASPPPAAAPPPPPPSATPPPTNSPPPPP 129

Query: 239 AST--PSTAPTPSTAGSPPAPTP-DSLG---PGPSGADTPPSPSAAFSYSKP 102
           ++T  P+ +P P  + SPPAP P +S G   P P    +PPSPS + S+  P
Sbjct: 130 SATPPPTISPPPPGSQSPPAPAPSNSTGGTPPAPPKPPSPPSPSPSASHRAP 181

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 48/120 (40%), Positives = 63/120 (52%), Gaps = 17/120 (14%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPP----TATPPTATPPAAV--PAPA-TPAPASSP- 267
           AP   P  PP A+P P   PP A  PP    T+ PP A PP +V  P PA +P PAS+P 
Sbjct: 38  APPPTPPSPPPASPPPPTPPPPADVPPPPVVTSPPPPAPPPPSVSPPPPALSPPPASTPP 97

Query: 266 ---------ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
                    A +PP P P++TP   PT S    P A  P ++ P P G+ +PP+P+ + S
Sbjct: 98  RPPSASPPPAAAPPPPPPSATP--PPTNSPPPPPSATPPPTISPPPPGSQSPPAPAPSNS 155

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/113 (43%), Positives = 59/113 (52%), Gaps = 14/113 (12%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTA--QPPAAATPP---TATPPT--ATPPAAVPAPATPAPASSP-- 267
           P+ + T P T+ P PT+   PPA+ +PP    A PPT  + PPA+ P P  P PA  P  
Sbjct: 6   PSPSATPPSTSPPPPTSLSPPPASNSPPPAPNAPPPTPPSPPPASPPPPTPPPPADVPPP 65

Query: 266 --ATSPPAPTPASTPSTAPTPSTAGSPPA---PTPDSLGPGPSGADTPPSPSA 123
              TSPP P P   PS +P P     PPA   P P S  P P+ A  PP PSA
Sbjct: 66  PVVTSPPPPAPPP-PSVSPPPPALSPPPASTPPRPPSASPPPAAAPPPPPPSA 117

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 40/104 (38%), Positives = 50/104 (48%), Gaps = 9/104 (8%)
 Frame = -3

Query: 404 TKPPTATPAPTAQPPAAATPPTAT---PPTATPPAAVPAPATPAPASSPATSPPAPTPAS 234
           + PP   P+P+A PP+ + PP  +   PP +  P   P    P P S P  SPP PTP  
Sbjct: 2   SSPP---PSPSATPPSTSPPPPTSLSPPPASNSPPPAPNAPPPTPPSPPPASPPPPTPPP 58

Query: 233 TPSTAPTP-STAGSPPAPTPDSLGP-----GPSGADTPPSPSAA 120
                P P  T+  PPAP P S+ P      P  A TPP P +A
Sbjct: 59  PADVPPPPVVTSPPPPAPPPPSVSPPPPALSPPPASTPPRPPSA 102

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 42/103 (40%), Positives = 55/103 (53%), Gaps = 4/103 (3%)
 Frame = -3

Query: 428 AQAPTAA--PTKPPTATPAPTAQPPAAATPPTATPP--TATPPAAVPAPATPAPASSPAT 261
           A  P AA  P  PP+ATP PT  PP    PP+ATPP   + PP    +P  PAP++S   
Sbjct: 102 ASPPPAAAPPPPPPSATPPPTNSPP---PPPSATPPPTISPPPPGSQSPPAPAPSNSTGG 158

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
           +PPAP     P + P+PS + S  AP    + P  +G+  P S
Sbjct: 159 TPPAP---PKPPSPPSPSPSASHRAPA-YPISPSSNGSGIPTS 197

[81][TOP]
>UniRef100_C7IZA4 Os02g0162200 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=C7IZA4_ORYSJ
          Length = 261

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 55/133 (41%), Positives = 72/133 (54%), Gaps = 4/133 (3%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           AT+     P A+ T PP  +PAP + PP++ +PP A+PP+ +   A  AP TP PASSP 
Sbjct: 136 ATATAPSPPPASSTAPPPTSPAPASPPPSSPSPPPASPPSPSSSGAA-APTTPPPASSP- 193

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS----PSAAFSYSKPII 96
             P  PTPAS     P PS A SPPAP P +  P   GA  P +    P AA   +   +
Sbjct: 194 --PSTPTPAS-----PAPS-ASSPPAP-PSANAPSAQGARNPSATSSPPPAANGAAHAAV 244

Query: 95  AATALSAALFAIA 57
           AA+ L+A +   A
Sbjct: 245 AASGLAAGIIGYA 257

[82][TOP]
>UniRef100_B8AI70 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8AI70_ORYSI
          Length = 261

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 55/133 (41%), Positives = 72/133 (54%), Gaps = 4/133 (3%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           AT+     P A+ T PP  +PAP + PP++ +PP A+PP+ +   A  AP TP PASSP 
Sbjct: 136 ATATAPSPPPASSTAPPPTSPAPASPPPSSPSPPPASPPSPSSSGAA-APTTPPPASSP- 193

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS----PSAAFSYSKPII 96
             P  PTPAS     P PS A SPPAP P +  P   GA  P +    P AA   +   +
Sbjct: 194 --PSTPTPAS-----PAPS-ASSPPAP-PSANAPSAQGARNPSATSSPPPAANGAAHAAV 244

Query: 95  AATALSAALFAIA 57
           AA+ L+A +   A
Sbjct: 245 AASGLAAGIIGYA 257

[83][TOP]
>UniRef100_B7ZXA1 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B7ZXA1_MAIZE
          Length = 662

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 57/118 (48%), Positives = 67/118 (56%), Gaps = 13/118 (11%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPA-----TPAPASSPAT 261
           AP A  T PP ATP+  A PPAA TPPT TPPT +PP+ A P P+      PAPAS+P T
Sbjct: 16  APPANATNPPPATPS--APPPAAPTPPTPTPPTPSPPSPAAPPPSPPSVPAPAPASTPVT 73

Query: 260 -SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS------GADTPPSPSAAFSYS 108
            S P+P+  S+P T  TPS     P+P P S G G S      G  TP S S   S+S
Sbjct: 74  PSAPSPSSPSSPGTPATPSPPSDTPSP-PSSGGGGRSPPSSGGGRSTPSSHSPPKSHS 130

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 54/124 (43%), Positives = 67/124 (54%), Gaps = 14/124 (11%)
 Frame = -3

Query: 431 LAQAPTAAPTKP-PTATPAPTAQPPAA---ATPPTA-TPPTATPPAAVPAPATPAPASSP 267
           ++ +PTAAP    P+A PA    PP A   A PP A TPPT TP    P P+ P+PA+ P
Sbjct: 1   MSSSPTAAPAPTTPSAPPANATNPPPATPSAPPPAAPTPPTPTP----PTPSPPSPAAPP 56

Query: 266 ATSP--PAPTPASTPST--APTPSTAGSP-----PAPTPDSLGPGPSGADTPPSPSAAFS 114
            + P  PAP PASTP T  AP+PS+  SP     P+P  D+  P  SG      PS+   
Sbjct: 57  PSPPSVPAPAPASTPVTPSAPSPSSPSSPGTPATPSPPSDTPSPPSSGGGGRSPPSSGGG 116

Query: 113 YSKP 102
            S P
Sbjct: 117 RSTP 120

[84][TOP]
>UniRef100_A8NVW6 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130
            RepID=A8NVW6_COPC7
          Length = 943

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 58/130 (44%), Positives = 74/130 (56%), Gaps = 13/130 (10%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAA-ATPPTATP-PTATP-PAAVPAPA---TPAPASSPA 264
            ++P+ APT   T  PAPT  P +  AT PT  P PT TP P + PAPA   TPAP S+PA
Sbjct: 784  ESPSPAPTSA-TPAPAPTLAPSSTLATIPTPAPGPTPTPAPTSTPAPAPTLTPAPTSTPA 842

Query: 263  TSP-PAPTPASTPSTAPTPS---TAGSPPAPTP---DSLGPGPSGADTPPSPSAAFSYSK 105
             +P P P P STP+ APTP+   T+   PAPTP    +  P P+   TP   SA+     
Sbjct: 843  PAPTPTPAPTSTPAPAPTPTPAPTSTPAPAPTPTPAPTSTPAPAPTPTPAPTSASAPPPA 902

Query: 104  PIIAATALSA 75
            P++  TA +A
Sbjct: 903  PVLPTTATAA 912

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 62/134 (46%), Positives = 74/134 (55%), Gaps = 24/134 (17%)
 Frame = -3

Query: 449  LLATSCLAQAPTAAPTKPPTATPAPTAQPPAAAT---PPTATP---PTATP-PAAVPAPA 291
            L  +S LA  PT AP   PT TPAPT+ P  A T    PT+TP   PT TP P + PAPA
Sbjct: 801  LAPSSTLATIPTPAPG--PTPTPAPTSTPAPAPTLTPAPTSTPAPAPTPTPAPTSTPAPA 858

Query: 290  ---TPAPASSPATSP-PAPTPASTPSTAPTPS---TAGSPPAPTP-------DSLGPGPS 153
               TPAP S+PA +P P P P STP+ APTP+   T+ S P P P        +L P P+
Sbjct: 859  PTPTPAPTSTPAPAPTPTPAPTSTPAPAPTPTPAPTSASAPPPAPVLPTTATAALRPAPA 918

Query: 152  GADTP---PSPSAA 120
               +P   P P AA
Sbjct: 919  HIPSPGLSPLPLAA 932

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 36/80 (45%), Positives = 42/80 (52%), Gaps = 5/80 (6%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAV-PAPATPAPASSPATSPP- 252
            APT+ P   PT TPAPT+ P  A TP P  T  +A PPA V P  AT A   +PA  P  
Sbjct: 864  APTSTPAPAPTPTPAPTSTPAPAPTPTPAPTSASAPPPAPVLPTTATAALRPAPAHIPSP 923

Query: 251  --APTPASTPSTAPTPSTAG 198
              +P P + P T  T  T G
Sbjct: 924  GLSPLPLAAPVTGRTGVTPG 943

[85][TOP]
>UniRef100_Q9LY91 Classical arabinogalactan protein 6 n=1 Tax=Arabidopsis thaliana
           RepID=AGP6_ARATH
          Length = 150

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 61/153 (39%), Positives = 78/153 (50%), Gaps = 7/153 (4%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPP 312
           MA    V + L L  +AT+  A AP+A+P K P+ T APT  P A    P+A  PT  P 
Sbjct: 1   MARQFVVLVLLTL-TIATAFAADAPSASPKKSPSPTAAPTKAPTATTKAPSA--PTKAPA 57

Query: 311 AAVPAPATPAP-ASSPATSPPAPT---PASTPSTAPTPSTAGSPPAPTPD--SLGPGPSG 150
           AA  + +  +P ASSPA   P P     AS+PS +    T  SPPAPTPD  S   GPS 
Sbjct: 58  AAPKSSSASSPKASSPAAEGPVPEDDYSASSPSDSAEAPTVSSPPAPTPDSTSAADGPSD 117

Query: 149 ADTPPSP-SAAFSYSKPIIAATALSAALFAIAF 54
             T  SP S A + +K  +  T  +   F  +F
Sbjct: 118 GPTAESPKSGAVTTAKFSVVGTVATVGFFFFSF 150

[86][TOP]
>UniRef100_Q9LM00 Putative arabinogalactan protein n=1 Tax=Pinus taeda
           RepID=Q9LM00_PINTA
          Length = 236

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 63/158 (39%), Positives = 69/158 (43%), Gaps = 40/158 (25%)
 Frame = -3

Query: 422 APTAAPTKP------PTATPAPTAQPPAAA------------TPPTATPPTATPPAAVPA 297
           AP  APTKP      PT  P PT +PPA A            TPP A PP ATPP A P 
Sbjct: 76  APAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPP 135

Query: 296 PATPAPASSPATSPPAPTPAST--------------PSTAPTPSTAGSPPAPTPDSLGPG 159
            A P PAS PA  PP   PA +               + APTPS   SPP+P   S GP 
Sbjct: 136 VAVP-PASPPAIPPPVQAPAPSHHKRKKKKKKHHHGSAPAPTPSALKSPPSPPLGSPGPS 194

Query: 158 PSG-----ADTPPS---PSAAFSYSKPIIAATALSAAL 69
            S      A TPPS    S A S    ++   A S  L
Sbjct: 195 TSADLFSPAPTPPSAGMKSFAASMGGTLVIVLASSLVL 232

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 63/188 (33%), Positives = 72/188 (38%), Gaps = 54/188 (28%)
 Frame = -3

Query: 458 ILGLLATSCLAQAPTAAPT------KPPTATP---------------------------- 381
           +L     +  A+ PT AP       KPPT TP                            
Sbjct: 30  VLATAPAAPTAKPPTTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVT 89

Query: 380 APTAQPP--------AAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPS 225
           APT  PP        A A  P + PP ATPP AVP  ATP  A+ P   PPA  PA  P 
Sbjct: 90  APTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPP 149

Query: 224 T-APTPS-----------TAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATAL 81
             AP PS             GS PAPTP +L   PS     P PS +     P  A T  
Sbjct: 150 VQAPAPSHHKRKKKKKKHHHGSAPAPTPSALKSPPSPPLGSPGPSTSADLFSP--APTPP 207

Query: 80  SAALFAIA 57
           SA + + A
Sbjct: 208 SAGMKSFA 215

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 50/140 (35%), Positives = 64/140 (45%), Gaps = 6/140 (4%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPA---AATPPTATPPTA 321
           MA +      L+   +A+ C  + P    T   TA  APTA+PP    AA   T  PPT 
Sbjct: 1   MAFNVFYVYMLVWLCIASFCNGEEPVV-DTVLATAPAAPTAKPPTTAPAAPVSTPKPPTT 59

Query: 320 TPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 141
           TP A   AP  PAP  +PA +P  P P   P TAPT +    PP   P ++ P  +    
Sbjct: 60  TPVAPAVAPTKPAPPVAPAVAPTKPAP---PVTAPTKA---PPPTTKPPAVAPAKAPVSA 113

Query: 140 PP---SPSAAFSYSKPIIAA 90
           PP    P A    + P +AA
Sbjct: 114 PPVATPPVAVPPVATPPVAA 133

[87][TOP]
>UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2B5_EHV86
          Length = 2332

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 40/98 (40%), Positives = 45/98 (45%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P + P  PP  TP P A PP    PP+  PP   PP   P P  P P   P   PP P+P
Sbjct: 796  PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSP 855

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              +P  +P PS   SPP PTP    P P      P PS
Sbjct: 856  PPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPS 893

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 40/98 (40%), Positives = 45/98 (45%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P + P  PP  TP P A PP    PP+  PP   PP   P P  P P   P   PP P+P
Sbjct: 974  PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSP 1033

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              +P  +P PS   SPP PTP    P P      P PS
Sbjct: 1034 PPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPS 1071

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 40/98 (40%), Positives = 45/98 (45%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P + P  PP  TP P A PP    PP+  PP   PP   P P  P P   P   PP P+P
Sbjct: 1065 PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSP 1124

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              +P  +P PS   SPP PTP    P P      P PS
Sbjct: 1125 PPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPS 1162

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 43/106 (40%), Positives = 51/106 (48%), Gaps = 5/106 (4%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA-----PATPAPASSP 267
            L   P   P+ PP+  P+P   PP    PP A PP A PPA  P+     P +P P+  P
Sbjct: 719  LPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPP 778

Query: 266  ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            +  PP P P + P   P PS   SPP PTP    P P     PPSP
Sbjct: 779  SPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPN-PPPPSP 823

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 50/127 (39%), Positives = 60/127 (47%), Gaps = 15/127 (11%)
 Frame = -3

Query: 437  SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTA----------TPPTATPPAAVPAPAT 288
            S L   PT  P  PP  +P   A PP +  PP A          +PP   PP  +P P  
Sbjct: 1663 SPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPN 1722

Query: 287  PAPASSPATSPPAPTPASTPSTAPTPSTAGS--PPAPTPDSLGPG---PSGADTPPSPSA 123
            P P   P  SPP+P P S P  +P PS   S  PP+P P SL P    PS + +PP PSA
Sbjct: 1723 PPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSA 1782

Query: 122  AFSYSKP 102
            + S   P
Sbjct: 1783 SPSPPPP 1789

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 40/113 (35%), Positives = 59/113 (52%), Gaps = 8/113 (7%)
 Frame = -3

Query: 407  PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP--------ATPAPASSPATSPP 252
            P+ PP   P+P++ PP+ + PP   PP   PP   P P        + P P+  P + PP
Sbjct: 1689 PSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPP 1748

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
            +P P+  P + P PS + SPP P+     P PS + +PP PSA+ S   P ++
Sbjct: 1749 SPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLS 1801

 Score = 84.0 bits (206), Expect = 7e-15
 Identities = 47/126 (37%), Positives = 69/126 (54%), Gaps = 3/126 (2%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPP-TATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA--PAS 273
            +TS     P+A+P+ PP +A+P+P     + + PP +T P+  PP A P+P  P+  P+ 
Sbjct: 1772 STSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSP 1831

Query: 272  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
             P +S P+P P S+  + P PS + SPP P+P    P P    TPP+P   F  S  IIA
Sbjct: 1832 PPPSSSPSPPPPSSSPSPPPPSLSPSPP-PSPPPSSPPPPSPPTPPAPPRPFLVSLDIIA 1890

Query: 92   ATALSA 75
                S+
Sbjct: 1891 TQPSSS 1896

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 40/97 (41%), Positives = 49/97 (50%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            PT  P  PP   P P + PP    PP  +PP   PP  +P P  P P S P + PP+P P
Sbjct: 806  PTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 865

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            +  PS  P P T   PPAP P +  P P  +  PP+P
Sbjct: 866  SPPPS--PPPPTP-PPPAPPPPAPPPSPPPSPPPPTP 899

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 40/97 (41%), Positives = 49/97 (50%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            PT  P  PP   P P + PP    PP  +PP   PP  +P P  P P S P + PP+P P
Sbjct: 984  PTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 1043

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            +  PS  P P T   PPAP P +  P P  +  PP+P
Sbjct: 1044 SPPPS--PPPPTP-PPPAPPPPAPPPSPPPSPPPPTP 1077

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 40/97 (41%), Positives = 49/97 (50%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            PT  P  PP   P P + PP    PP  +PP   PP  +P P  P P S P + PP+P P
Sbjct: 1075 PTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 1134

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            +  PS  P P T   PPAP P +  P P  +  PP+P
Sbjct: 1135 SPPPS--PPPPTP-PPPAPPPPAPPPSPPPSPPPPTP 1168

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 42/112 (37%), Positives = 57/112 (50%), Gaps = 3/112 (2%)
 Frame = -3

Query: 428  AQAPTAAPTK--PPTATPAPTAQPPAAATPPTATPPTA-TPPAAVPAPATPAPASSPATS 258
            A +P++ P    PP   P P   PP    PP   PP+  +PP   P P +P P+  P+  
Sbjct: 1696 APSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPP 1755

Query: 257  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            PP+P P S   + P PST+ SPP P+     P PS + +PP PS + S   P
Sbjct: 1756 PPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPP 1807

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 42/115 (36%), Positives = 64/115 (55%), Gaps = 6/115 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAAT--PPTATPPTATPPAAVPAPATPAPASSPATSPPA- 249
            P + P  PP + P P+  PP+ +   PP +T P+  PP+A P+P  P P++SP+  PP+ 
Sbjct: 1743 PPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSP--PPPSASPSPPPPSL 1800

Query: 248  ---PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
               P P ST  + P P  + SPP P+     P PS + +PP PS++ S   P ++
Sbjct: 1801 SPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPPPPSLS 1855

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 45/134 (33%), Positives = 60/134 (44%), Gaps = 7/134 (5%)
 Frame = -3

Query: 482  SAAVQIFLILGLLATSCL-------AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPT 324
            SA    + I GL+  SC        A +P+  P  PP  +P+P   PP  + PP+  PP+
Sbjct: 650  SAFAYDYGICGLVGDSCARVGSVDCAPSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPS 709

Query: 323  ATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
              PP  +P P  P P   P + PP+P P+  PS  P      +PP P P    P      
Sbjct: 710  PPPP--LPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPS 767

Query: 143  TPPSPSAAFSYSKP 102
             PPSP  +   S P
Sbjct: 768  PPPSPPPSPPPSPP 781

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 39/99 (39%), Positives = 48/99 (48%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
            +P   P+ PP+  P+P   PP +  PP   PP  +PP  +P P  P P S P   PP   
Sbjct: 1578 SPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLP 1637

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P  +P  +P PS   SPP   P S  P P    TPP PS
Sbjct: 1638 PPPSPPPSPPPSPPPSPPPSPPPSPSPLPP-PPTPPPPS 1675

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 39/102 (38%), Positives = 54/102 (52%)
 Frame = -3

Query: 407  PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTP 228
            P  PP   P P   PP+  +PP  +PP  +PP + P P+ P P+  P +  P+P P ST 
Sbjct: 1716 PLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPS-PPPSPPPPSPPPPSLSPSPPPPSTS 1774

Query: 227  STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
             + P PS + SPP P+     P PS + +PP PS + S   P
Sbjct: 1775 PSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPPP 1816

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 41/110 (37%), Positives = 61/110 (55%), Gaps = 4/110 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P  +P  PP  +P P + PP+   PP+  PP+  PP+  P+P  P P++SP+  PP+ +P
Sbjct: 1729 PPPSPPSPPPPSPPPPSPPPSP--PPSPPPPSPPPPSLSPSP--PPPSTSPSPPPPSASP 1784

Query: 239  ASTPSTA----PTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            +  P +A    P PS + SPP P+     P P  + +PP PSA+ S   P
Sbjct: 1785 SPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPP 1834

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 41/106 (38%), Positives = 47/106 (44%), Gaps = 9/106 (8%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA--- 249
            PT  P  PP   P P + PP    PP  +PP   PP  +P P  P P S P   PP    
Sbjct: 897  PTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPP 956

Query: 248  ------PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
                  P+P  +P  +P PS   SPP PTP    P P     PPSP
Sbjct: 957  PPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPN-PPPPSP 1001

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 38/109 (34%), Positives = 57/109 (52%), Gaps = 2/109 (1%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA--PASSPATSPPA 249
            +P      PP+  P+P   PP  + PP +  P+  PP+  P+P  P+  P+  P ++ P+
Sbjct: 1735 SPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPS 1794

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P P S   + P PST+ SPP P      P PS + +PP PS++ S   P
Sbjct: 1795 PPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPP 1843

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 41/101 (40%), Positives = 47/101 (46%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
            L   P+  P+ PP+  P+P   PP    PP A PP A PP+  P+P  P P   PA  PP
Sbjct: 849  LPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTP-PPPAPPPP 907

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             P P S P   P P     PP   P  L P P     PPSP
Sbjct: 908  NPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPP--VPPPPSP 946

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 43/110 (39%), Positives = 50/110 (45%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
            L   P+  P+ PP+  P+P   PP    PP A PP A PP+  P+P  P P   PA  PP
Sbjct: 1027 LPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTP-PPPAPPPP 1085

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
             P P S P   P P     PP   P  L P P     PPSP  +   S P
Sbjct: 1086 NPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPP--LPPPPSPPPSPPPSPP 1133

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 38/97 (39%), Positives = 47/97 (48%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP   P P   PP+    P  +PP + PP   P PA P PA  PA  PP+P P
Sbjct: 708 PSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAP-PPSPPP 766

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           +  PS  P+P  +  PP P P +  P       PPSP
Sbjct: 767 SPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSP 803

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 41/123 (33%), Positives = 56/123 (45%), Gaps = 21/123 (17%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAA-------ATPPTATPPTATPPAAVPAPATPAPAS 273
            L   P+  P+ PP+  P+P   PP +        TPP  +PP  +PP   P P +P P +
Sbjct: 1636 LPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPN 1695

Query: 272  SPATS--------------PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
            +P+ S              PP P P + P   P P +  SPP P+P    P PS   +PP
Sbjct: 1696 APSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPP 1755

Query: 134  SPS 126
             PS
Sbjct: 1756 PPS 1758

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 38/94 (40%), Positives = 46/94 (48%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTP 228
           P  PP+  P+P   PP +  PPT  PP   PPA  PAP    P S P + PP+P P+  P
Sbjct: 723 PLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAP----PPSPPPSPPPSPPPSPPP 778

Query: 227 STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           S  P      +PP PTP    P      TPP P+
Sbjct: 779 SPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPA 812

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 36/98 (36%), Positives = 44/98 (44%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  PP   P P   PP +  PP   PP  +PP  +P P  P P   P  SPP   P
Sbjct: 801  PSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPP 860

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             S P + P      +PP P P    P PS   +PP P+
Sbjct: 861  PSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPT 898

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 36/98 (36%), Positives = 44/98 (44%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  PP   P P   PP +  PP   PP  +PP  +P P  P P   P  SPP   P
Sbjct: 979  PSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPP 1038

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             S P + P      +PP P P    P PS   +PP P+
Sbjct: 1039 PSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPT 1076

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 36/98 (36%), Positives = 44/98 (44%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  PP   P P   PP +  PP   PP  +PP  +P P  P P   P  SPP   P
Sbjct: 1070 PSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPP 1129

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             S P + P      +PP P P    P PS   +PP P+
Sbjct: 1130 PSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPT 1167

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 42/104 (40%), Positives = 48/104 (46%), Gaps = 7/104 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATP-----PTATPPAAVPAPATPAPASSPATSP 255
            P + P  PP  +P P   PP    PP   P     P  +PP + P P  P PA  P   P
Sbjct: 698  PPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPP 757

Query: 254  PAPTPASTPS--TAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            PAP P+  PS   +P PS   SPP PTP    P P     PPSP
Sbjct: 758  PAPPPSPPPSPPPSPPPSPPPSPPPPTPPP--PAPPPPTPPPSP 799

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 42/99 (42%), Positives = 49/99 (49%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  PP   P PT  P     PP  TPP + PP  +P P TP P S P  SPP P+P
Sbjct: 2113 PSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPP--LPPPPTPPPQSPPLPSPPPPSP 2170

Query: 239  ASTPSTAP-TPSTAGSPPAPTPDSLGP-GPSGADTPPSP 129
             + P   P +PS    PP P P S  P  P  +  PPSP
Sbjct: 2171 PTPPPLPPPSPSPLPPPPIPPPPSPPPHPPPQSPLPPSP 2209

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 40/98 (40%), Positives = 48/98 (48%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
            P   P  PP   P P+  P P  + PP+  PPT  PPA  P    PAP  SP  SPP   
Sbjct: 713  PLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSP 772

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P S P + P P+    PPAP P +  P P  +  PP+P
Sbjct: 773  PPSPPPSPPPPTP--PPPAPPPPTPPPSPPPSPPPPTP 808

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 45/105 (42%), Positives = 51/105 (48%), Gaps = 8/105 (7%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAA---ATPPTATP-----PTATPPAAVPAPATPAPASSPA 264
            P + P  PP  TP P A PP A   A PP+  P     P  +PP + P P  P PA  P 
Sbjct: 734  PPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPP 793

Query: 263  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            T PP+P P+  P T P P  A  PP P P S  P P     PPSP
Sbjct: 794  TPPPSPPPSPPPPTPPPP--APPPPNPPPPS-PPPPLPLPPPPSP 835

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 42/109 (38%), Positives = 48/109 (44%), Gaps = 9/109 (8%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAA-------TPPTATPPTATPPAAVPAPATPAPASS 270
            A  P A P  PP + P PT  PPA         +PP   PP  +PP  +P P  P P   
Sbjct: 1149 APPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVP 1208

Query: 269  PATSPP--APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P  SPP   P P   P   P PS   SPP   P S  P P  +  PP+P
Sbjct: 1209 PPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPPTP 1257

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 39/103 (37%), Positives = 48/103 (46%), Gaps = 3/103 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP--PAAVPAPATPAPASSPATSPPAP 246
            P+  P  PP  +P P   PP    PP   PP+  P  P  +P P  P P S P + PP+P
Sbjct: 1181 PSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSP 1240

Query: 245  TPASTPSTAPTPST-AGSPPAPTPDSLGPGPSGADTPPSPSAA 120
             P+  PS  P+P      PPAP P +  P P     PP P  A
Sbjct: 1241 PPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPPTPPPPPPLA 1283

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 39/100 (39%), Positives = 49/100 (49%), Gaps = 2/100 (2%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           +P+  P+ PP   P+P   PP  + PP   PP   PP   P    P+P  SP  SPP PT
Sbjct: 689 SPSPPPSPPP---PSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPT 745

Query: 242 --PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             P + P  AP P+   SPP   P S  P P  +  PP+P
Sbjct: 746 PPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTP 785

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 42/101 (41%), Positives = 48/101 (47%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
            L   P+  P+ PP+  P+P   PP    PP A PP A PP+  P+P  P P   PA  PP
Sbjct: 1118 LPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTP-PPPAPPPP 1176

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             P P S P   P P    SPP P P    P P     PPSP
Sbjct: 1177 NPPPPSPPPPLPPPP---SPPPPLPPPPLP-PPPVPPPPSP 1213

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 41/104 (39%), Positives = 50/104 (48%), Gaps = 7/104 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAA---VPAPATPAPASSPATSPPA 249
            P + P  PP + P P   PP  + PP   PP   PP +   +P P  P P S P + PP+
Sbjct: 1590 PPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPS 1649

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGP----GPSGADTPPSP 129
            P P+  PS  P+PS    PP PTP    P     P  A  PPSP
Sbjct: 1650 PPPSPPPSPPPSPSPL--PPPPTPPPPSPPLPSPPLPAPPPPSP 1691

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 39/104 (37%), Positives = 54/104 (51%), Gaps = 3/104 (2%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTA--QPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
            L   P   P  PP   P P +   PP  + PP + PP  +PP + P P+ P P+ SP+  
Sbjct: 1712 LPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPP--SPPPSPPPPSPPPPSLSPSPP 1769

Query: 257  PPAPTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            PP+ +P+   PS +P+P    + P+P P SL P P    T PSP
Sbjct: 1770 PPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSP 1813

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 39/100 (39%), Positives = 47/100 (47%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P   P  PP   P PT  P     PP  TPP  +PP  +P+P  P+P + P   PP+P+P
Sbjct: 2126 PPTPPPSPPPLPPPPTPPPSPPPLPPPPTPPPQSPP--LPSPPPPSPPTPPPLPPPSPSP 2183

Query: 239  ASTPSTAPTPSTAGSPP--APTPDSLGPGPSGADTPPSPS 126
               P   P PS    PP  +P P S  P P     PP PS
Sbjct: 2184 LPPPPIPPPPSPPPHPPPQSPLPPSPPPPPPPPPLPPPPS 2223

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 40/99 (40%), Positives = 58/99 (58%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTA-TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           P+ +P+ PP + +P+P   PP  +T P+  PP   PP+A P+P  P P+ SP+  PP+ +
Sbjct: 283 PSLSPSPPPPSLSPSPPPSPPPPSTSPS--PPPRPPPSASPSP--PPPSLSPSPPPPSLS 338

Query: 242 PASTP-STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P+  P S +P+P      P+P P SL P P  A  PPSP
Sbjct: 339 PSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSP 377

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 39/102 (38%), Positives = 56/102 (54%)
 Frame = -3

Query: 407  PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTP 228
            P  PP + P+P    P   +PP + PP+  PP+  P   +P+P   P+TSP  P P+++P
Sbjct: 1726 PLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPP-PSTSPSPPPPSASP 1784

Query: 227  STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            S  P PS + SPP P+     P PS + +PP P A+ S   P
Sbjct: 1785 SPPP-PSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPP 1825

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 40/100 (40%), Positives = 47/100 (47%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419  PTAAPTKPPT--ATPAPTAQPPAAATPPTATPPTATPPAAVPA-PATPAPASSPATSPPA 249
            P   P  PP     P P + PP    PP   PP   PP+  P+ P +P P+  P+  PP 
Sbjct: 816  PNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPT 875

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P P + P  AP PS   SPP PTP    P P     PPSP
Sbjct: 876  PPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPN-PPPPSP 914

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 40/100 (40%), Positives = 47/100 (47%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419  PTAAPTKPPT--ATPAPTAQPPAAATPPTATPPTATPPAAVPA-PATPAPASSPATSPPA 249
            P   P  PP     P P + PP    PP   PP   PP+  P+ P +P P+  P+  PP 
Sbjct: 994  PNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPT 1053

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P P + P  AP PS   SPP PTP    P P     PPSP
Sbjct: 1054 PPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPN-PPPPSP 1092

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 40/100 (40%), Positives = 47/100 (47%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419  PTAAPTKPPT--ATPAPTAQPPAAATPPTATPPTATPPAAVPA-PATPAPASSPATSPPA 249
            P   P  PP     P P + PP    PP   PP   PP+  P+ P +P P+  P+  PP 
Sbjct: 1085 PNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPT 1144

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P P + P  AP PS   SPP PTP    P P     PPSP
Sbjct: 1145 PPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPN-PPPPSP 1183

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 39/98 (39%), Positives = 44/98 (44%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            PT  P  PP   P P + PP    PP+  PP   PP   P P  P P+  P   PP P P
Sbjct: 1166 PTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLP-PPPVPPPPSPPPLPPPPLPPP 1224

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
               P  +P PS   SPP   P S  P P    TPP P+
Sbjct: 1225 PLPPPPSPPPSPPPSPPPSPPPSPPPSPP-PPTPPPPA 1261

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 40/99 (40%), Positives = 46/99 (46%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA--AVPAPATPAPASSPATSPPAP 246
            P   P  PP   P P + PP    PP   PP   PP+   +P P  P P   P  SPP P
Sbjct: 1176 PNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPP-P 1234

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            +P  +P  +P PS   SPP PTP    P P     PPSP
Sbjct: 1235 SPPPSPPPSPPPSPPPSPPPPTPPP--PAPPPPTPPPSP 1271

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 40/102 (39%), Positives = 53/102 (51%), Gaps = 5/102 (4%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAA--TPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
            P+++P+ PP + P P + PP      PP  TPP + PP  +P P TP P+  P   PP P
Sbjct: 2098 PSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPP--LPPPPTPPPSPPPLPPPPTP 2155

Query: 245  TPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPSP 129
             P S P  +P P +  +P   P P+P  L P P     PPSP
Sbjct: 2156 PPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPP--IPPPPSP 2195

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 37/107 (34%), Positives = 59/107 (55%), Gaps = 1/107 (0%)
 Frame = -3

Query: 419 PTAAPTKPPTA-TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           P+ +P+ PP + +P+P     + + PP +  P+  PP+  P+P  P+ + SP  SPP P+
Sbjct: 247 PSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPS 306

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            + +P   P PS + SPP P+     P PS + +PP PS + S   P
Sbjct: 307 TSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPP 353

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 37/103 (35%), Positives = 47/103 (45%), Gaps = 6/103 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT------PAPASSPATS 258
            P   P  PP+  P P+  P    +PP + PP+  PP  +P P +      P P   P + 
Sbjct: 1569 PLPPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSP 1628

Query: 257  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            PP P P   P  +P PS   SPP   P S  P PS    PP+P
Sbjct: 1629 PPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTP 1671

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 44/115 (38%), Positives = 48/115 (41%), Gaps = 9/115 (7%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
            P + P  PP  TP P A PP A  P P  +PP  TPP   P P  P P S P   PP P+
Sbjct: 1133 PPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPS 1192

Query: 242  --------PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
                    P   P   P PS    PP P P    P P     PPSP  +   S P
Sbjct: 1193 PPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPP--PLPPPPSPPPSPPPSPPPSPP 1245

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 37/99 (37%), Positives = 43/99 (43%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P + P  PP  TP P A PP    PP+  PP   PP   P P  P P   P   PP P+P
Sbjct: 887  PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSP 946

Query: 239  ASTPSTAPTPSTAGSPPAPTPD-SLGPGPSGADTPPSPS 126
               P     P     PP+P P     P PS   +PP P+
Sbjct: 947  PPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPT 985

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 41/111 (36%), Positives = 47/111 (42%), Gaps = 11/111 (9%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
            A  P+  P+ PP+  P+P   PP    PP A PP   PP+  P+P  P P   PA  PP 
Sbjct: 759  APPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPP-PAPPPPN 817

Query: 248  PTPASTPSTAPTPSTAGSPPA-----------PTPDSLGPGPSGADTPPSP 129
            P P S P   P P     PP            P P S  P P     PPSP
Sbjct: 818  PPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPP-PSPPPSP 867

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 41/120 (34%), Positives = 52/120 (43%), Gaps = 12/120 (10%)
 Frame = -3

Query: 452  GLLATSCL-------AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-A 297
            GL+  SC          +P+  P  PP  +P+P   PP  + PP+  PP+  PP   P  
Sbjct: 1516 GLVGDSCARVGSVDCVPSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPV 1575

Query: 296  PATP----APASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P +P    +P  SP  SPP   P S P   P P     PP   P  + P PS    PP P
Sbjct: 1576 PPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPP 1635

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 38/102 (37%), Positives = 45/102 (44%), Gaps = 1/102 (0%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
            A  P   P+ PP+  P+P   PP +  PPT  PP   PP   P P+ P     P   PPA
Sbjct: 755  APPPAPPPSPPPSPPPSPPPSPPPSPPPPT--PPPPAPPPPTPPPSPPPSPPPPTPPPPA 812

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGP-SGADTPPSPS 126
            P P + P  +P P     PP   P  L P P      PP PS
Sbjct: 813  PPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPS 854

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 36/99 (36%), Positives = 46/99 (46%), Gaps = 6/99 (6%)
 Frame = -3

Query: 407  PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA------PATPAPASSPATSPPAP 246
            P+ PP+  P+P   PP +  PPT  PP   PPA  P+      P TP P + P  +PP P
Sbjct: 1122 PSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP 1181

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            +P       P+P     PP   P  + P PS    PP P
Sbjct: 1182 SPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPP 1220

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 39/101 (38%), Positives = 45/101 (44%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
            L   P+  P  PP   P P   PP +  P     P  +PP + P P  P PA  P   PP
Sbjct: 829  LPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPP 888

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            +P P+  P T P P  A  PP P P S  P P     PPSP
Sbjct: 889  SPPPSPPPPTPPPP--APPPPNPPPPS-PPPPLPLPPPPSP 926

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 38/97 (39%), Positives = 45/97 (46%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P   P  PP   P P + PP+    P  +PP + PP   P PA P PA  P + PP+P P
Sbjct: 838  PLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPA-PPPSPPPSPPP 896

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             + P  AP P     P  P P  L P PS    PP P
Sbjct: 897  PTPPPPAPPPPNPPPPSPPPPLPLPPPPS----PPPP 929

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 41/101 (40%), Positives = 45/101 (44%), Gaps = 3/101 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
            P + P  PP  TP P A PP A  P P  +PP  TPP   P P  P P S P   P  P 
Sbjct: 864  PPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP 923

Query: 242  PASTPSTAPTP-STAGSPPAPTPDSLGPGP-SGADTPPSPS 126
            P+  P   P P      PP P+P  L P P      PP PS
Sbjct: 924  PSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPS 964

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 39/101 (38%), Positives = 45/101 (44%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
            L   P+  P  PP   P P   PP +  P     P  +PP + P P  P PA  P   PP
Sbjct: 1007 LPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPP 1066

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            +P P+  P T P P  A  PP P P S  P P     PPSP
Sbjct: 1067 SPPPSPPPPTPPPP--APPPPNPPPPS-PPPPLPLPPPPSP 1104

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 38/97 (39%), Positives = 45/97 (46%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P   P  PP   P P + PP+    P  +PP + PP   P PA P PA  P + PP+P P
Sbjct: 1016 PLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPA-PPPSPPPSPPP 1074

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             + P  AP P     P  P P  L P PS    PP P
Sbjct: 1075 PTPPPPAPPPPNPPPPSPPPPLPLPPPPS----PPPP 1107

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 40/115 (34%), Positives = 56/115 (48%), Gaps = 12/115 (10%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATP-----------APA 276
           +P+  P  PP+A+P+P     + + PP +  P+  PP+  P+P  P           +P+
Sbjct: 308 SPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPS 367

Query: 275 SSPATSPPAPTPASTPSTAPTPSTAGSPPAP-TPDSLGPGPSGADTPPSPSAAFS 114
             PAT PP+P P S P   P P    SPP P  P  + P PS    PP P A F+
Sbjct: 368 PPPATPPPSPPPPSPPPPLPPPP---SPPPPLPPPPIPPPPSPPPPPPPPLAPFT 419

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 39/98 (39%), Positives = 46/98 (46%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
            P + P  PP + P PT  PPA   P P  +PP + PP   P PA P P + P  SPP P 
Sbjct: 860  PPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPA-PPPPNPPPPSPPPPL 918

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P   P + P P     PP   P  + P PS    PP P
Sbjct: 919  PLPPPPSPPPPL---PPPPLPPPPVPPPPSPPPLPPPP 953

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 2/108 (1%)
 Frame = -3

Query: 419 PTAAPTKPP-TATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-TPAPASSPATSPPAP 246
           P+ +P+ PP + +P+P     + + PP +  P+  PP+  P+P  +P P S+  + PP P
Sbjct: 256 PSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRP 315

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P+++PS  P PS + SPP P+     P PS + +PP PS  FS S P
Sbjct: 316 PPSASPSPPP-PSLSPSPPPPSLSPSPPPPSLSPSPPPPS--FSPSPP 360

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 39/94 (41%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = -3

Query: 407  PTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAST 231
            P  PP   P+P   PP +  P P  +PP  TPP   P P TP P+  P+  PP P P + 
Sbjct: 754  PAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAP 813

Query: 230  PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P   P P    SPP P P  L P PS    PP P
Sbjct: 814  PPPNPPPP---SPPPPLP--LPPPPS----PPPP 838

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 37/101 (36%), Positives = 44/101 (43%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
            L   P+  P  PP   P P   PP +  P     P  +PP + P P  P PA  P   PP
Sbjct: 1098 LPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPP 1157

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            +P P+  P T P P    +PP P P    P P     PPSP
Sbjct: 1158 SPPPSPPPPTPPPP----APPPPNPPPPSP-PPPLPPPPSP 1193

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 42/104 (40%), Positives = 46/104 (44%), Gaps = 3/104 (2%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
            L   P   P  PP  +P P+  P    +PP + PP   PP   PAP  PAP  SP  SPP
Sbjct: 1108 LPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPP---PAPPPPAPPPSPPPSPP 1164

Query: 251  APT---PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             PT   PA  P   P PS    PP P P S  P       PP P
Sbjct: 1165 PPTPPPPAPPPPNPPPPSP--PPPLPPPPSPPPPLPPPPLPPPP 1206

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 40/107 (37%), Positives = 49/107 (45%), Gaps = 1/107 (0%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  PP + P P+  PP    PP   PP+  PP + P    P+P  SP  SPP P P
Sbjct: 1550 PSPPPPSPPPSPPPPSPPPPL---PPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLP 1606

Query: 239  ASTPSTAPTP-STAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
               P + P P      PP P+P  L P P     PPSP  +   S P
Sbjct: 1607 LPPPPSPPPPLPPPPVPPPPSPPPLPPPP--LPPPPSPPPSPPPSPP 1651

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 41/114 (35%), Positives = 50/114 (43%), Gaps = 7/114 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATP------APASSPATS 258
            P   P  PP + P P   PP    PP  +PP   PP   P P+ P       P S P + 
Sbjct: 1602 PPPLPLPPPPSPPPPLPPPPV---PPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 1658

Query: 257  PPAPTPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
            PP+P+P   P T P PS    SPP P P    P P  A +P S   + S   P+
Sbjct: 1659 PPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPL 1712

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 41/111 (36%), Positives = 55/111 (49%), Gaps = 5/111 (4%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAP--ASSPATSPPA- 249
            P+  P+ PP+  P+P+  PP   TPP  +PP  +PP   P P +P P  A SP++ PP+ 
Sbjct: 1648 PSPPPSPPPSPPPSPSPLPPPP-TPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQ 1706

Query: 248  --PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
              P P   P   P P+    PP P P S    P  +  PPSP  +   S P
Sbjct: 1707 SPPPPLPPPPLPPPPNPP--PPLPPPPSPPSPPPPSPPPPSPPPSPPPSPP 1755

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 44/116 (37%), Positives = 52/116 (44%), Gaps = 6/116 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPA--PATPAPASSPATSPPA 249
            P + P  PP  TP P+  P P   TPP  +PP  +PP   P   P  P P+ SP   PP 
Sbjct: 2130 PPSPPPLPPPPTPPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPI 2189

Query: 248  PTPASTPSTAP--TPSTAGSPPAPTPDSLGPGPSGADT-PPSPSAAFSYSKPIIAA 90
            P P S P   P  +P     PP P P  L P PS   + PPS   A     PI  +
Sbjct: 2190 PPPPSPPPHPPPQSPLPPSPPPPPPPPPLPPPPSPPPSQPPSLENASQSLVPIFVS 2245

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 36/95 (37%), Positives = 43/95 (45%), Gaps = 1/95 (1%)
 Frame = -3

Query: 407  PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTP 228
            P+ PP+  P+P   PP +  PPT  PP   PP   P P+ P     P   PPAP P + P
Sbjct: 853  PSPPPSPPPSPPPSPPPSPPPPT--PPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPP 910

Query: 227  STAPTPSTAGSPPAPTPDSLGPGP-SGADTPPSPS 126
              +P P     PP   P  L P P      PP PS
Sbjct: 911  PPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPS 945

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 38/102 (37%), Positives = 49/102 (48%), Gaps = 1/102 (0%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT-PAPASSPATSP 255
            L   P   P  PP   P P   PP+    P  +PP + PP+  P+P+  P P + P  SP
Sbjct: 1617 LPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSP 1676

Query: 254  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P P+P   P  AP P +   P AP+P S+ P  S    PP P
Sbjct: 1677 PLPSP---PLPAPPPPSPPPPNAPSPSSMPPSQS----PPPP 1711

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 41/108 (37%), Positives = 52/108 (48%), Gaps = 10/108 (9%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP--PAAVPAPATPAPASSPATSPPAP 246
            P + P  PP   P P + PP+    P  +PP + P  P+ +P P TP P S P  SPP P
Sbjct: 1625 PPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLP 1684

Query: 245  T---PASTPSTAPTPST---AGSPPAPTPDSLGPGPSG--ADTPPSPS 126
                P+  P  AP+PS+   + SPP P P    P P       PP PS
Sbjct: 1685 APPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPS 1732

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 35/99 (35%), Positives = 54/99 (54%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+     PP+A+P+P     + + PP +  P+  PP+  P+P  P P+ SP+  PP+ +P
Sbjct: 212 PSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSP--PPPSLSPSPPPPSVSP 269

Query: 239 A-STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           +   PS +P+P      P+P P SL P P  +  PPS S
Sbjct: 270 SPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTS 308

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 40/105 (38%), Positives = 52/105 (49%), Gaps = 3/105 (2%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATP--PTATPPTATPPAAVPAPA-TPAPASSPAT 261
            L   P+  P  PP   P P + PP    P  P  +PP + PP+  P+P  +P P+ SP  
Sbjct: 1607 LPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLP 1666

Query: 260  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             PP P P S P  +P P  A  PP+P P +    PS +  PPS S
Sbjct: 1667 PPPTPPPPSPPLPSP-PLPAPPPPSPPPPN---APSPSSMPPSQS 1707

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 38/97 (39%), Positives = 45/97 (46%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P   P  PP   P P + PP+    P  +PP + PP   P PA P PA  P + PP+P P
Sbjct: 1107 PLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPA-PPPSPPPSPPP 1165

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             + P  AP P     PP   P  L P PS    PP P
Sbjct: 1166 PTPPPPAPPP--PNPPPPSPPPPLPPPPS----PPPP 1196

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 40/113 (35%), Positives = 63/113 (55%), Gaps = 4/113 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTA-TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           P+ +P+ PP + +P+P     + + PP +  P+  PP+  P+P  P P+ SP+  PP+ +
Sbjct: 238 PSLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSP--PPPSLSPSPPPPSLS 295

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPG---PSGADTPPSPSAAFSYSKPIIA 93
           P S P + P PST+ SPP   P S  P    PS + +PP PS + S   P ++
Sbjct: 296 P-SPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLS 347

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 39/102 (38%), Positives = 46/102 (45%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P   P  P    P+P   PP    PP   PP + PP+  P+P  P+P  SP  SPP PTP
Sbjct: 1199 PPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPP-PSPPPSPPPSPPPPTP 1257

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
               P   P P+   SPP PTP            PP P A F+
Sbjct: 1258 --PPPAPPPPTPPPSPPPPTP-----------PPPPPLAPFT 1286

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 35/94 (37%), Positives = 43/94 (45%)
 Frame = -3

Query: 407  PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTP 228
            P  PP + P+ +  PP  + P   +PP   PP  VP P TP P+  P   PP P P+  P
Sbjct: 2090 PPSPPPSLPSSSPSPPPPSPPLPPSPPPLPPPP-VPPPPTPPPSPPPLPPPPTPPPSPPP 2148

Query: 227  STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
               P      SPP P+P    P       PPSPS
Sbjct: 2149 LPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPS 2182

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 38/119 (31%), Positives = 62/119 (52%), Gaps = 10/119 (8%)
 Frame = -3

Query: 419 PTAAPTKPPTA-TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP---ATSPP 252
           P+A+P+ PP + +P+P     + + PP +  P+  PP+  P+P  P+ + SP   + SP 
Sbjct: 220 PSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPS 279

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPG------PSGADTPPSPSAAFSYSKPIIA 93
            P P+ +PS  P   +   PP+P P S  P       PS + +PP PS + S   P ++
Sbjct: 280 PPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLS 338

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 38/103 (36%), Positives = 59/103 (57%), Gaps = 5/103 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTAT-PAPTAQPPAAATP---PTATPPTATPPAAVPAPATPAPASSPATSP 255
           +P+  P+ PP +T P+P  +PP +A+P   P +  P+  PP+  P+P  P P+ SP+  P
Sbjct: 295 SPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSP--PPPSLSPSPPP 352

Query: 254 PAPTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P+ +P+   PS +P+P  A  PP+P P S  P      +PP P
Sbjct: 353 PSFSPSPPPPSLSPSPPPATPPPSPPPPSPPPPLPPPPSPPPP 395

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 38/98 (38%), Positives = 43/98 (43%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P   P  PP   P P   PP    PP+  PP   PP  +P P  P P S P + PP+P P
Sbjct: 919  PLPPPPSPPPPLPPPPLPPPPVPPPPS--PP-PLPPPPLPPPPLPPPPSPPPSPPPSPPP 975

Query: 239  ASTPS-TAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            +  PS   PTP     PP   P    P P     PPSP
Sbjct: 976  SPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSP 1013

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 41/111 (36%), Positives = 46/111 (41%), Gaps = 1/111 (0%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSP 255
            L   P   P  PP   P P   PP    P P  +PP + PP+  P+P  P P   PA  P
Sbjct: 935  LPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPP-PAPPP 993

Query: 254  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P P P S P   P P     PP   P  L P P     PPSP  +   S P
Sbjct: 994  PNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPP--LPPPPSPPPSPPPSPP 1042

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 42/109 (38%), Positives = 46/109 (42%), Gaps = 3/109 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPP-AAVPAPATPAPASSPATSPP--A 249
            PT  P  PP   PAP   PP +  PPT  PP   PP    P+P  P P   P + PP   
Sbjct: 874  PTPPPPAPPP--PAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLP 931

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P P   P   P PS    PP P P    P P     PPSP  +   S P
Sbjct: 932  PPPLPPPPVPPPPSPPPLPPPPLPPP--PLPPPPSPPPSPPPSPPPSPP 978

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 39/103 (37%), Positives = 45/103 (43%), Gaps = 2/103 (1%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATP--APASSPATS 258
            L   P+  P  PP   P P   PP +  PP   PP   PP   P P+ P   P S P + 
Sbjct: 920  LPPPPSPPPPLPPPPLPPPPVPPPPS--PPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSP 977

Query: 257  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            PP+P P + P  AP P     P  P P  L P PS    PP P
Sbjct: 978  PPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPS----PPPP 1016

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 36/95 (37%), Positives = 52/95 (54%), Gaps = 6/95 (6%)
 Frame = -3

Query: 392 TATPAPTAQPPAAATPPTATPPTATPPAAVPA--PATPAPASSPATSPPA----PTPAST 231
           T  P+P   PP+  +PP+  PP+A+P    P+  P+ P P+ SP+  PP+    P P S 
Sbjct: 200 TDIPSPP-YPPSLPSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSL 258

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             + P PS + SPP P+     P PS + +PP PS
Sbjct: 259 SPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPS 293

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 36/101 (35%), Positives = 43/101 (42%), Gaps = 3/101 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP--AP 246
            P   P  P    P+P   PP    PP   PP + PP+  P+P    P S P  +PP  AP
Sbjct: 932  PPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAP 991

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGP-SGADTPPSPS 126
             P + P  +P P     PP   P  L P P      PP PS
Sbjct: 992  PPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPS 1032

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 33/87 (37%), Positives = 41/87 (47%)
 Frame = -3

Query: 389  ATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTP 210
            + P P + PP+  +   + PP + P    P P  P P   P T PP+P P   P T P P
Sbjct: 2086 SVPPPPSPPPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPT-PPP 2144

Query: 209  STAGSPPAPTPDSLGPGPSGADTPPSP 129
            S    PP PTP    P P  +  PPSP
Sbjct: 2145 SPPPLPPPPTPPPQSP-PLPSPPPPSP 2170

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 33/93 (35%), Positives = 51/93 (54%), Gaps = 3/93 (3%)
 Frame = -3

Query: 362 PAAATPPTA-TPPTATPPAAVPAPATP--APASSPATSPPAPTPASTPSTAPTPSTAGSP 192
           P+   PP+  +PP+  PP+A P+P  P  +P+  P +  P+P P S   + P PS + SP
Sbjct: 203 PSPPYPPSLPSPPSLPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSP 262

Query: 191 PAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
           P P+     P PS + +PP PS + S   P ++
Sbjct: 263 PPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLS 295

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 35/105 (33%), Positives = 58/105 (55%), Gaps = 11/105 (10%)
 Frame = -3

Query: 419  PTAAPTKPPTAT-PAPTAQPPAAATPPTATPPTATPPAAVPAPATPA-------PASSPA 264
            P+ +P+ PP +T P+P   P + + PP +  P+  PP++ P+P  P+       P+ SP 
Sbjct: 1798 PSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPPPPSLSP- 1856

Query: 263  TSPPAPTPASTPSTAPTPSTAGSPPAP---TPDSLGPGPSGADTP 138
            + PP+P P+S P   P+P T  +PP P   + D +   PS ++ P
Sbjct: 1857 SPPPSPPPSSPP--PPSPPTPPAPPRPFLVSLDIIATQPSSSNPP 1899

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 27/80 (33%), Positives = 37/80 (46%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
            L   P+  P+ PP+  P+P   PP +  PPT  PP   PP   P+P  P P   P  +P 
Sbjct: 1226 LPPPPSPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPPTPPPPPPLAPF 1285

Query: 251  APTPASTPSTAPTPSTAGSP 192
                 ++ S AP    + SP
Sbjct: 1286 TCEDRASRSLAPHGCASVSP 1305

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 2/112 (1%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPP-TATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-TPAPASS 270
            +TS     P A+P+ PP +A+P+P     + + PP ++ P+  PP+  P+P  +P P+S 
Sbjct: 1808 STSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPPPPSLSPSPPPSPPPSSP 1867

Query: 269  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
            P  SPP P     P        A  P +  P    P      TP +    F+
Sbjct: 1868 PPPSPPTPPAPPRPFLVSLDIIATQPSSSNPPERYPYIGSGATPDNKIVPFA 1919

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 31/92 (33%), Positives = 41/92 (44%)
 Frame = -3

Query: 404  TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPS 225
            T PP    +        + PP  +PP + P ++ P+P  P+P   P + PP P P   P 
Sbjct: 2069 TNPPGGAYSSIGGLQLMSVPPPPSPPPSLPSSS-PSPPPPSP-PLPPSPPPLPPPPVPPP 2126

Query: 224  TAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              P PS    PP PTP    P P     PP+P
Sbjct: 2127 PTPPPSPPPLPPPPTPP---PSPPPLPPPPTP 2155

 Score = 52.0 bits (123), Expect(2) = 7e-06
 Identities = 28/83 (33%), Positives = 43/83 (51%)
 Frame = -3

Query: 341 TATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP 162
           T  P    PP+    P+ P P++SP+  PP+ +P+  P     PS + SPP P+     P
Sbjct: 200 TDIPSPPYPPSLPSPPSLPPPSASPSPPPPSLSPSPPP-----PSLSPSPPPPSISPSPP 254

Query: 161 GPSGADTPPSPSAAFSYSKPIIA 93
            PS + +PP PS + S   P ++
Sbjct: 255 PPSLSPSPPPPSVSPSPPPPSLS 277

 Score = 21.6 bits (44), Expect(2) = 7e-06
 Identities = 9/25 (36%), Positives = 16/25 (64%)
 Frame = -2

Query: 396 TNSNPSTNSSTTCSSNTTNSNSTYS 322
           TN+NPS+N +T   +++ +  S  S
Sbjct: 138 TNNNPSSNMNTRLVASSVSVASNVS 162

[88][TOP]
>UniRef100_C0PPC0 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C0PPC0_MAIZE
          Length = 199

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 64/154 (41%), Positives = 71/154 (46%), Gaps = 24/154 (15%)
 Frame = -3

Query: 461 LILGLLATSCLAQ------------APTA--APTKPPTATPAPTAQPPAAATPP---TAT 333
           L+L LL  SC AQ            AP A   P  PP   P P  Q P A  PP   TAT
Sbjct: 8   LVLVLLIASCAAQQSPPAQPPPTPNAPPANSPPQAPPAGNPPPAPQAPPAGNPPPAPTAT 67

Query: 332 PPTA--TPPAAV----PAPATPAPASSPATSPPAP-TPASTPSTAPTPSTAGSPPAPTPD 174
           PP A  TPP A     PAP TP PA  P T PPAP TP  +P  +P P+    PP+P   
Sbjct: 68  PPPAPTTPPPAPTTPPPAPTTPPPA--PTTPPPAPTTPPPSPPASPPPAPTTPPPSP--- 122

Query: 173 SLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
              P P+ A  PPSP  A   + P    T   AA
Sbjct: 123 PASPPPAPATPPPSPPMATPAASPKSPKTPSPAA 156

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 57/112 (50%), Positives = 64/112 (57%), Gaps = 8/112 (7%)
 Frame = -3

Query: 425 QAPTAA-PTKPPTAT--PAPTAQPPAAATPPTA--TPPTA--TPPAAVPAPATPAPASSP 267
           QAP A  P   PTAT  PAPT  PPA  TPP A  TPP A  TPP   PAP TP P S P
Sbjct: 53  QAPPAGNPPPAPTATPPPAPTTPPPAPTTPPPAPTTPPPAPTTPP---PAPTTP-PPSPP 108

Query: 266 ATSPPAP-TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
           A+ PPAP TP  +P  +P P+ A  PP+P   +    P    T PSP+AA S
Sbjct: 109 ASPPPAPTTPPPSPPASPPPAPATPPPSPPMATPAASPKSPKT-PSPAAATS 159

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 48/101 (47%), Positives = 56/101 (55%), Gaps = 2/101 (1%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTA--TPPTATPPAAVPAPATPAPASSPATSPPA 249
           APT  P  P T  PAPT  PPA  TPP A  TPP + P +  PAP TP P  SP  SPP 
Sbjct: 71  APTTPPPAPTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPP--SPPASPP- 127

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P PA+ P + P  + A SP +P      P P+ A T P+PS
Sbjct: 128 PAPATPPPSPPMATPAASPKSPKT----PSPAAA-TSPAPS 163

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 52/124 (41%), Positives = 65/124 (52%), Gaps = 6/124 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATP---PTATPPTA--TPPAAVPAPATPAPASSPATS 258
           APT  P  P T  PAPT  PPA  TP   P A+PP A  TPP + PA   PAPA +P  S
Sbjct: 78  APTTPPPAPTTPPPAPTTPPPAPTTPPPSPPASPPPAPTTPPPSPPASPPPAPA-TPPPS 136

Query: 257 PPAPTPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATAL 81
           PP  TPA++P +  TPS  A + PAP+    G  P+  D+  S  A    +   +A   L
Sbjct: 137 PPMATPAASPKSPKTPSPAAATSPAPSLSPAGT-PTNEDSGASARAVGFATVVALAGAGL 195

Query: 80  SAAL 69
           +  L
Sbjct: 196 AVLL 199

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-P 252
           A  P A  T PP+    P + PPA ATPP  +PP ATP A+  +P TP+PA+  ATSP P
Sbjct: 109 ASPPPAPTTPPPS---PPASPPPAPATPP-PSPPMATPAASPKSPKTPSPAA--ATSPAP 162

Query: 251 APTPASTPSTAPTPSTA 201
           + +PA TP+   + ++A
Sbjct: 163 SLSPAGTPTNEDSGASA 179

[89][TOP]
>UniRef100_A9PG83 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
           RepID=A9PG83_POPTR
          Length = 241

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 53/140 (37%), Positives = 65/140 (46%), Gaps = 21/140 (15%)
 Frame = -3

Query: 458 ILGLLATSCL--------AQAPTAAP------TKPPTATPA-PTAQPPAAATPPTATPPT 324
           +L  L  +CL        AQ P  +P      T PPT TP  PT  P +A TPPTAT P 
Sbjct: 4   VLWALILACLSFPLAITDAQTPAVSPSTPTTTTPPPTTTPTTPTQSPASAVTPPTATTPI 63

Query: 323 ATPPAAVPAPATPA------PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP 162
           ++P   V    TP       P SSPA +P  P     P  +P P+ A  PPAP P    P
Sbjct: 64  SSPSPKVAPATTPVVPPPQPPQSSPAATPIPPPATPPPQVSPAPAPATPPPAPAPAKEVP 123

Query: 161 GPSGADTPPSPSAAFSYSKP 102
            P+ A  PP+P  A +   P
Sbjct: 124 APAPATPPPAPVPAPAIPPP 143

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 47/92 (51%), Positives = 52/92 (56%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           AP   P  PP     P + P A   PP ATPP    PA  PAPATP PA +PA   PAP 
Sbjct: 71  APATTPVVPP--PQPPQSSPAATPIPPPATPPPQVSPA--PAPATPPPAPAPAKEVPAPA 126

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA 147
           PA TP  AP P+ A  PPAP+P SL P P+ A
Sbjct: 127 PA-TPPPAPVPAPAIPPPAPSP-SLVPSPAPA 156

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 44/102 (43%), Positives = 49/102 (48%), Gaps = 1/102 (0%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           Q+  AA   PP ATP P   P PA ATPP A  P    PA  PA   PAP  +PA  PPA
Sbjct: 85  QSSPAATPIPPPATPPPQVSPAPAPATPPPAPAPAKEVPAPAPATPPPAPVPAPAIPPPA 144

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
           P+P+  PS AP P                 P+ A  PPSP A
Sbjct: 145 PSPSLVPSPAPAPGKHKMKRKHKHKHHHHAPAPAPNPPSPPA 186

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 51/132 (38%), Positives = 61/132 (46%), Gaps = 31/132 (23%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTA--TPPAAVPAPATPAPASSPATSP 255
           A  P   P +PP ++PA T  PP A  PP  +P  A  TPP A PAPA   PA +PAT P
Sbjct: 73  ATTPVVPPPQPPQSSPAATPIPPPATPPPQVSPAPAPATPPPA-PAPAKEVPAPAPATPP 131

Query: 254 PAPTPAS-------TPSTAPTPSTA-----------------GSPPAPTPDSLGPGP--- 156
           PAP PA        +PS  P+P+ A                    PAP P S  P P   
Sbjct: 132 PAPVPAPAIPPPAPSPSLVPSPAPAPGKHKMKRKHKHKHHHHAPAPAPNPPS-PPAPPTV 190

Query: 155 --SGADTPPSPS 126
             +  DT P+PS
Sbjct: 191 TTASEDTAPAPS 202

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 40/111 (36%), Positives = 47/111 (42%), Gaps = 17/111 (15%)
 Frame = -3

Query: 422 APTAAP-TKPPTATPAPTAQPPAAATPPTA-TPPTATPPAAVPAPATPAPASSPA----- 264
           +P  AP T PP   PA     PA ATPP A  P  A PP A      P+PA +P      
Sbjct: 104 SPAPAPATPPPAPAPAKEVPAPAPATPPPAPVPAPAIPPPAPSPSLVPSPAPAPGKHKMK 163

Query: 263 ----------TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 141
                        PAP P S P+  PT +TA    AP      P P+G +T
Sbjct: 164 RKHKHKHHHHAPAPAPNPPSPPA-PPTVTTASEDTAP-----APSPNGGNT 208

[90][TOP]
>UniRef100_B8GAZ4 Putative uncharacterized protein n=1 Tax=Chloroflexus aggregans DSM
           9485 RepID=B8GAZ4_CHLAD
          Length = 381

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 47/114 (41%), Positives = 57/114 (50%), Gaps = 9/114 (7%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTAT---PPTAT---PPAAVPAPATPAP 279
           T+ L   PT   T   T TP+P   P A   PPTAT   PPTAT   PP A P P T  P
Sbjct: 247 TATLQPTPTRTNTPTATVTPSPMVTPTATPPPPTATPPPPPTATPPPPPTATPPPPTATP 306

Query: 278 ASSPATSPPAP---TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           +  P  +PP P   TP   P+  P+P    +PP P P +  P P+   +PP PS
Sbjct: 307 SPLPTATPPPPPTATPPPPPTATPSPPPTATPP-PPPTATPPPPTATPSPPPPS 359

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 47/98 (47%), Positives = 52/98 (53%), Gaps = 6/98 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATP---PTATPP---AAVPAPATPAPASSPATS 258
           PTA P  PPTATP P   P A   PPTATP   PTATPP    A P P   A  S P T+
Sbjct: 279 PTATPPPPPTATPPPP--PTATPPPPTATPSPLPTATPPPPPTATPPPPPTATPSPPPTA 336

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
            P P P +TP   P P+   SPP P+P +  PG    D
Sbjct: 337 TPPPPPTATP---PPPTATPSPPPPSPTATPPGDDDDD 371

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 49/101 (48%), Positives = 53/101 (52%), Gaps = 6/101 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTAT--PAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           PTA P  PPTAT  P PTA PP    PPTATPP   PP A P+P   A    P T+ P P
Sbjct: 272 PTATPP-PPTATPPPPPTATPP---PPPTATPP---PPTATPSPLPTATPPPPPTATPPP 324

Query: 245 TPASTPSTAPT----PSTAGSPPAPTPDSLGPGPSGADTPP 135
            P +TPS  PT    P    +PP PT     P PS   TPP
Sbjct: 325 PPTATPSPPPTATPPPPPTATPPPPTATPSPPPPSPTATPP 365

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 49/123 (39%), Positives = 55/123 (44%), Gaps = 13/123 (10%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQ--PPAAATPPTATPPTATPP---AAVPAPATPAPASSPATSPP 252
           T AP+   T  P PT    P A  TP     PTATPP   A  P P T  P   P  +PP
Sbjct: 241 TPAPSHTATLQPTPTRTNTPTATVTPSPMVTPTATPPPPTATPPPPPTATPPPPPTATPP 300

Query: 251 APTPASTP---STAPTPSTAGSPPAPT-----PDSLGPGPSGADTPPSPSAAFSYSKPII 96
            PT   +P   +T P P TA  PP PT     P +  P P    TPP P+A  S   P  
Sbjct: 301 PPTATPSPLPTATPPPPPTATPPPPPTATPSPPPTATPPPPPTATPPPPTATPSPPPPSP 360

Query: 95  AAT 87
            AT
Sbjct: 361 TAT 363

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 36/73 (49%), Positives = 41/73 (56%), Gaps = 2/73 (2%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAA--ATPPTATPPTATPPAAVPAPATPAPASSP 267
           T+  +  PTA P  PPTATP P   PP A  + PPTATPP   PP A P P T  P    
Sbjct: 303 TATPSPLPTATPPPPPTATPPP---PPTATPSPPPTATPP--PPPTATPPPPTATP---- 353

Query: 266 ATSPPAPTPASTP 228
             SPP P+P +TP
Sbjct: 354 --SPPPPSPTATP 364

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 39/102 (38%), Positives = 46/102 (45%), Gaps = 3/102 (2%)
 Frame = -3

Query: 419 PTAAPTKP-PTATPAPTAQPPAAATPPTATPPTAT--PPAAVPAPATPAPASSPATSPPA 249
           P  +PT    T TPAP+       TP     PTAT  P   V   ATP P +  AT PP 
Sbjct: 229 PQPSPTTALATNTPAPSHTATLQPTPTRTNTPTATVTPSPMVTPTATPPPPT--ATPPPP 286

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
           PT    P    TP    + P+P P +  P P  A  PP P+A
Sbjct: 287 PTATPPPPPTATPPPPTATPSPLPTATPPPPPTATPPPPPTA 328

[91][TOP]
>UniRef100_Q58NA5 Plus agglutinin (Fragment) n=1 Tax=Chlamydomonas incerta
            RepID=Q58NA5_CHLIN
          Length = 2371

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 40/109 (36%), Positives = 58/109 (53%), Gaps = 7/109 (6%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV---PAPATPAPASSPATSP 255
            + P+ AP  P   +PAP +  P +  PP+  PP+  PP+     P P +P P + P+ +P
Sbjct: 1404 EPPSPAPPSPAPPSPAPPSPQPPSPAPPSPRPPSPAPPSPAPPSPVPPSPQPPAPPSPAP 1463

Query: 254  PAPTPASTPSTAPTPSTAGS----PPAPTPDSLGPGPSGADTPPSPSAA 120
            P+P P S    +P P +  S    PP PTP S  P P+ +  PPSP+ A
Sbjct: 1464 PSPAPPSPAPPSPAPPSPASPSPVPPLPTPPSPAPAPTTSPLPPSPTPA 1512

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S P  SP  P+P
Sbjct: 808  PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPPSPEPPSP 865

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P S PS +P P +  +PP+P P S  P      +PP PS
Sbjct: 866  APPSPPSPSPEPPSP-APPSPPPPSPAPPSPAPPSPPPPS 904

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 43/111 (38%), Positives = 58/111 (52%), Gaps = 5/111 (4%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS--SPATSPPAP 246
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S  SP+  PP+P
Sbjct: 823  PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPSPSPEPPSP 880

Query: 245  TPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTP-PSPSAAFSYSKP 102
             P S P  +P P +    SPP P+P+   P P     P P P +  S S P
Sbjct: 881  APPSPPPPSPAPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPASPSPP 931

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 41/101 (40%), Positives = 56/101 (55%), Gaps = 2/101 (1%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PA 249
            +P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S P  SP  P+
Sbjct: 927  SPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPPSPEPPS 984

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P P S P  +P P +  +PP+PTP S  P      +PP PS
Sbjct: 985  PAPPSPPPPSPEPPSP-APPSPTPPSPEPPSPAPPSPPPPS 1024

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 42/101 (41%), Positives = 56/101 (55%), Gaps = 4/101 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS--PPAP 246
            P+  P  P   +PAP + PP +  PP+  PP+ TPP+  P P +PAP S P  S  PP+P
Sbjct: 973  PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPTPPS--PEPPSPAPPSPPPPSPEPPSP 1030

Query: 245  TPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
             P S P  +P P +    SPP P+P+   P P  +  PPSP
Sbjct: 1031 APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 1070

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 41/107 (38%), Positives = 53/107 (49%), Gaps = 7/107 (6%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
            Q P+  P  P   +PAP +  P +  PPT  PP+  PP+ VP   TP     P+ +PPAP
Sbjct: 1170 QPPSPDPPSPAPPSPAPPSPVPPSPIPPTPAPPSPEPPSPVPPSPTPPAPQPPSPAPPAP 1229

Query: 245  TPAS-------TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P S        PS APT   +  PP+P P S  P    +  PPSP+
Sbjct: 1230 QPPSPAPPSPNPPSPAPTTPASPEPPSPQPPSPSPPVPPSPAPPSPA 1276

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 44/116 (37%), Positives = 59/116 (50%), Gaps = 8/116 (6%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA---PATPAPASSPATSP 255
            + P+ AP  PP  +P P +  P + TPP+  PP+  PP+  P    P +PAP S P  SP
Sbjct: 981  EPPSPAPPSPPPPSPEPPSPAPPSPTPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSP 1040

Query: 254  --PAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTP-PSPSAAFSYSKP 102
              P+P P S P  +P P +    SPP P+P+   P P     P P PS+    S P
Sbjct: 1041 EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPSSPAPPSPP 1096

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 41/102 (40%), Positives = 55/102 (53%), Gaps = 2/102 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S P  SP  P+P
Sbjct: 1003 PSPTPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPPSPEPPSP 1060

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
             P S P  +P P +  +PP+P P S  P      +PP PS A
Sbjct: 1061 APPSPPPPSPEPPSP-APPSPPPPSPEPSSPAPPSPPPPSPA 1101

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 51/132 (38%), Positives = 63/132 (47%), Gaps = 12/132 (9%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT-----------PAPAS 273
            P+ AP  P   +PAP +  P +   P+  PP  TPP+  PAP T           PAP +
Sbjct: 1459 PSPAPPSPAPPSPAPPSPAPPSPASPSPVPPLPTPPSPAPAPTTSPLPPSPTPALPAPPA 1518

Query: 272  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAF-SYSKPII 96
            SPA  P  P P   P+ AP PS A  PP+P P  L P P      P+P+AA  S   P  
Sbjct: 1519 SPAPPPNPPRPPQPPA-APPPSPAAPPPSPAP--LAPPPPQPQPQPTPAAAAPSPPLPPD 1575

Query: 95   AATALSAALFAI 60
             A    AAL +I
Sbjct: 1576 CALLAQAALLSI 1587

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S P  SP  P+P
Sbjct: 778  PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPPSPEPPSP 835

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P S P  +P P +  +PP+P P S  P      +PPSPS
Sbjct: 836  APPSPPPPSPEPPSP-APPSPPPPSPEPPSPAPPSPPSPS 874

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 42/104 (40%), Positives = 57/104 (54%), Gaps = 4/104 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S P  SP  P+P
Sbjct: 793  PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPPSPEPPSP 850

Query: 245  TPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSPSAA 120
             P S P  +P P +    SPP+P+P+   P P    +PP PS A
Sbjct: 851  APPSPPPPSPEPPSPAPPSPPSPSPEPPSPAP---PSPPPPSPA 891

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 42/110 (38%), Positives = 57/110 (51%), Gaps = 1/110 (0%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P++PAP S P  SP  P+P
Sbjct: 1048 PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPSSPAPPSPPPPSPAPPSP 1105

Query: 239  ASTPSTAPTPSTAGS-PPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
                S  P+P    S PP+P P S  P      +P  PS + S + PI A
Sbjct: 1106 EPQSSAPPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPAPPIPA 1155

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 43/110 (39%), Positives = 53/110 (48%), Gaps = 13/110 (11%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP--------APATPAPASSPA 264
            PT AP  P   +P P +  P A  PP+  PP   PP+  P        AP TPA    P+
Sbjct: 1197 PTPAPPSPEPPSPVPPSPTPPAPQPPSPAPPAPQPPSPAPPSPNPPSPAPTTPASPEPPS 1256

Query: 263  TSPPAPTPA-----STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              PP+P+P      + PS AP P  +  PP+P P S  P PS    PPSP
Sbjct: 1257 PQPPSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPPS-PPAPPSP 1305

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 45/107 (42%), Positives = 60/107 (56%), Gaps = 8/107 (7%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA----AVPAPATPAPA----SS 270
            Q P+ AP  P   +PAP +  P +  PP+  PP    PA    A P+PA P+PA    +S
Sbjct: 1424 QPPSPAPPSPRPPSPAPPSPAPPSPVPPSPQPPAPPSPAPPSPAPPSPAPPSPAPPSPAS 1483

Query: 269  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P+  PP PTP   PS AP P+T+  PP+PTP +L   P+    PP+P
Sbjct: 1484 PSPVPPLPTP---PSPAPAPTTSPLPPSPTP-ALPAPPASPAPPPNP 1526

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 41/103 (39%), Positives = 56/103 (54%), Gaps = 4/103 (3%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--P 252
            + P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S P  SP  P
Sbjct: 716  EPPSPTPPSPQPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPPSPEPP 773

Query: 251  APTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
            +P P S P  +P P +    SPP P+P+   P P  +  PPSP
Sbjct: 774  SPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 815

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 41/106 (38%), Positives = 58/106 (54%), Gaps = 7/106 (6%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPASS----PAT 261
            + P+ AP  PP  +PAP +  P +  PP+  PP+  PP+  P +P  P+PAS     P+ 
Sbjct: 876  EPPSPAPPSPPPPSPAPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPASPSPPPPSP 935

Query: 260  SPPAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
             PP+P P S P  +P P +    SPP P+P+   P P  +  PPSP
Sbjct: 936  EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 980

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 40/100 (40%), Positives = 52/100 (52%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S P  SP  P+P
Sbjct: 1018 PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPPSPEPPSP 1075

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPS-GADTPPSP 129
             P S P  +P PS+   P  P P    P P   +  PPSP
Sbjct: 1076 APPSPPPPSPEPSSPAPPSPPPPSPAPPSPEPQSSAPPSP 1115

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 42/104 (40%), Positives = 56/104 (53%), Gaps = 7/104 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA---PATPAPASSPATSP-- 255
           P+ AP  PP  +PAP +  P +  PP+  PP+  PP+  P    P +PAP S P  SP  
Sbjct: 683 PSPAPPSPPPPSPAPPSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPSPAPPSPPPPSPEP 742

Query: 254 PAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
           P+P P S P  +P P +    SPP P+P+   P P  +  PPSP
Sbjct: 743 PSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 785

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 44/108 (40%), Positives = 58/108 (53%), Gaps = 9/108 (8%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATP-----APTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
            Q P+ AP  PP  +P     AP + PP +  PP+  PP+  PP+  P P +PAP S P  
Sbjct: 726  QPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPP 783

Query: 260  SP--PAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
            SP  P+P P S P  +P P +    SPP P+P+   P P  +  PPSP
Sbjct: 784  SPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 830

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 41/101 (40%), Positives = 55/101 (54%), Gaps = 4/101 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S P  SP  P+P
Sbjct: 748  PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPPSPEPPSP 805

Query: 245  TPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
             P S P  +P P +    SPP P+P+   P P  +  PPSP
Sbjct: 806  APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 845

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 41/101 (40%), Positives = 55/101 (54%), Gaps = 4/101 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S P  SP  P+P
Sbjct: 763  PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPPSPEPPSP 820

Query: 245  TPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
             P S P  +P P +    SPP P+P+   P P  +  PPSP
Sbjct: 821  APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 860

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 40/100 (40%), Positives = 55/100 (55%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S P  SP  P+P
Sbjct: 838  PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS--PPSPSPEPPSPAPPSPPPPSPAPPSP 895

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P S P  +P P +  +PP+P P S  P    + +PP PS
Sbjct: 896  APPSPPPPSPEPPSP-APPSPPPPSPEPPSPASPSPPPPS 934

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 43/108 (39%), Positives = 57/108 (52%), Gaps = 9/108 (8%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATP-----APTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
            + P+ AP  PP+ +P     AP + PP +  PP+  PP+  PP+  P P +PAP S P  
Sbjct: 861  EPPSPAPPSPPSPSPEPPSPAPPSPPPPSPAPPSPAPPSPPPPS--PEPPSPAPPSPPPP 918

Query: 260  SPPAPTPAS----TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            SP  P+PAS     PS  P      SPP P+P+   P P  +  PPSP
Sbjct: 919  SPEPPSPASPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 965

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 45/101 (44%), Positives = 58/101 (57%), Gaps = 1/101 (0%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV-PAPATPAPASSPATSPPA 249
            Q P+ AP  P   +PAPT   PA+  PP+  PP+ +PP    PAP +PAP   P+  PP+
Sbjct: 1230 QPPSPAPPSPNPPSPAPTT--PASPEPPSPQPPSPSPPVPPSPAPPSPAPLPPPSPDPPS 1287

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P P   PS AP PS   +PP+P P    P PS  + PPSP+
Sbjct: 1288 PVP---PSPAPPPSPP-APPSPEPIPPAPPPSPPE-PPSPA 1323

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 40/107 (37%), Positives = 51/107 (47%), Gaps = 6/107 (5%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           A  P+  P  P   TPAP +  P +  PP+  PP+  PP   PAP +P P S    SPP 
Sbjct: 633 ALPPSPKPPSPKPPTPAPPSPLPPSPLPPSPAPPSPAPPQPPPAPPSPTPPSPAPPSPPP 692

Query: 248 PTPASTPSTAPTPS------TAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P+PA      P+P        +  PP+PTP S  P      +PP PS
Sbjct: 693 PSPAPPSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPSPAPPSPPPPS 739

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 43/108 (39%), Positives = 58/108 (53%), Gaps = 9/108 (8%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQ-----PPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
            + P+ AP  PP  +P P +      PP +  PP+  PP+  PP+  P P +PAP S P  
Sbjct: 906  EPPSPAPPSPPPPSPEPPSPASPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPP 963

Query: 260  SP--PAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
            SP  P+P P S P  +P P +    SPP P+P+   P P  + TPPSP
Sbjct: 964  SPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPTPPSP 1010

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 45/117 (38%), Positives = 54/117 (46%), Gaps = 18/117 (15%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV------------------PAP 294
            P+  P  P   TPAP +  P +  PP+ TPP   PP+                    PAP
Sbjct: 1187 PSPVPPSPIPPTPAPPSPEPPSPVPPSPTPPAPQPPSPAPPAPQPPSPAPPSPNPPSPAP 1246

Query: 293  ATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
             TPA    P+  PP+P+P   PS AP PS A  PP P+PD   P P     PPSP A
Sbjct: 1247 TTPASPEPPSPQPPSPSPPVPPSPAP-PSPAPLPP-PSPDPPSPVPPSPAPPPSPPA 1301

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 37/99 (37%), Positives = 51/99 (51%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P  AP  P   +PAP + PP +  PP+  PP+  PP+  P    P   + P+  PP+P P
Sbjct: 673 PPPAPPSPTPPSPAPPSPPPPSPAPPSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPSPAP 732

Query: 239 ASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
            S P  +P P +    SPP P+P+   P P  +  PPSP
Sbjct: 733 PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 770

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 40/101 (39%), Positives = 55/101 (54%), Gaps = 4/101 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS--PATSPPAP 246
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S   P+  PP+P
Sbjct: 958  PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPTPPSPEPPSP 1015

Query: 245  TPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
             P S P  +P P +    SPP P+P+   P P  +  PPSP
Sbjct: 1016 APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 1055

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 41/101 (40%), Positives = 56/101 (55%), Gaps = 4/101 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
            P+  P  P   +PAP + P  +  PP+  PP+  PP+  PAP +PAP S P  SP  P+P
Sbjct: 853  PSPPPPSPEPPSPAPPSPPSPSPEPPSPAPPSPPPPS--PAPPSPAPPSPPPPSPEPPSP 910

Query: 245  TPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPSP 129
             P S P  +P P +  + SPP P+P+   P P  +  PPSP
Sbjct: 911  APPSPPPPSPEPPSPASPSPPPPSPEPPSPAPP-SPPPPSP 950

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 39/104 (37%), Positives = 54/104 (51%), Gaps = 4/104 (3%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA---AVPAPATPAPASSPATSP 255
            + P+ AP  PP  +P P +  P +  PP+  PP+  PP+     P P +PAP S P  SP
Sbjct: 936  EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSP 995

Query: 254  PAPTPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSGADTPPSPS 126
              P+PA    T P+P   + +PP+P P S  P      +PP PS
Sbjct: 996  EPPSPAPPSPTPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 1039

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 41/104 (39%), Positives = 55/104 (52%), Gaps = 7/104 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTA---TPPAAVPAPATPAPASSPATSP-- 255
            P+ AP  PP  +P P +  P +  PP+  PP+    +PP   P P +PAP S P  SP  
Sbjct: 893  PSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPASPSPPPPSPEPPSPAPPSPPPPSPEP 952

Query: 254  PAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
            P+P P S P  +P P +    SPP P+P+   P P  +  PPSP
Sbjct: 953  PSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 995

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 42/107 (39%), Positives = 53/107 (49%), Gaps = 10/107 (9%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV---PAPATPAPAS-------S 270
            P  AP  P   +PAP    P +  PP+  PP+  PP+ V   P P TPAP S        
Sbjct: 1152 PIPAPPSPQPPSPAPQTPQPPSPDPPSPAPPSPAPPSPVPPSPIPPTPAPPSPEPPSPVP 1211

Query: 269  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P+ +PPAP P S    AP P +  +PP+P P S  P    +  PPSP
Sbjct: 1212 PSPTPPAPQPPSPAPPAPQPPSP-APPSPNPPSPAPTTPASPEPPSP 1257

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 41/100 (41%), Positives = 54/100 (54%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS--PPAP 246
            P+  P  PP+  P P+  PP+ A P  A P  A+P    P P  P+PA +P TS  PP+P
Sbjct: 1451 PSPQPPAPPSPAP-PSPAPPSPAPPSPAPPSPASPSPVPPLPTPPSPAPAPTTSPLPPSP 1509

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            TPA  P+   +P+   +PP P      P PS A  PPSP+
Sbjct: 1510 TPA-LPAPPASPAPPPNPPRPPQPPAAPPPSPAAPPPSPA 1548

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 42/102 (41%), Positives = 56/102 (54%), Gaps = 2/102 (1%)
 Frame = -3

Query: 425  QAPTAAPTKPPT-ATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS-SPATSPP 252
            Q P+ +P  PP+ A P+P   PP +  PP+  PP+  PP + PAP +P P   +P  SPP
Sbjct: 1258 QPPSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPPSPPAPPSPEPIPPAPPPSPP 1317

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P   + PS  P    + SPP+P P S  P PS    PPSP+
Sbjct: 1318 EPPSPAPPSPQPPQPPSPSPPSPAPPSPEP-PS--PIPPSPA 1356

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 43/101 (42%), Positives = 56/101 (55%), Gaps = 4/101 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S P  SP  P+P
Sbjct: 943  PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPPSPEPPSP 1000

Query: 245  TPAS-TPSTAPTPSTA-GSPPAPTPDSLGPGPSGADTPPSP 129
             P S TP +   PS A  SPP P+P+   P P  +  PPSP
Sbjct: 1001 APPSPTPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 1040

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 44/103 (42%), Positives = 57/103 (55%), Gaps = 9/103 (8%)
 Frame = -3

Query: 410  APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP---APATPAPAS------SPATS 258
            AP  PP  +PAP +  P ++ PP+  P ++ PP+ VP   AP +PAP S      SP+ +
Sbjct: 1091 APPSPPPPSPAPPSPEPQSSAPPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPA 1150

Query: 257  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            PP P P S    +P P T   PP+P P S  P PS A  PPSP
Sbjct: 1151 PPIPAPPSPQPPSPAPQTP-QPPSPDPPSPAP-PSPA--PPSP 1189

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 40/98 (40%), Positives = 54/98 (55%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
            AP  +P  PP+  P P A PP+   PP+  PP+  PP   P+P+ P+PA  P+  PP+P 
Sbjct: 1294 APPPSPPAPPSPEPIPPAPPPSPPEPPSPAPPSPQPPQP-PSPSPPSPA-PPSPEPPSPI 1351

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P S    +P P +   PP+P P S  P PS A   P+P
Sbjct: 1352 PPSPAPPSPAPPSP-QPPSPEPPSPAP-PSPAPLSPAP 1387

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 40/104 (38%), Positives = 54/104 (51%), Gaps = 7/104 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA---PATPAPASSPATSP-- 255
            P+  P  P   +P P +  P + TPP+  PP+  PP+  P    P +PAP S P  SP  
Sbjct: 698  PSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEP 757

Query: 254  PAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
            P+P P S P  +P P +    SPP P+P+   P P  +  PPSP
Sbjct: 758  PSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 800

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 39/101 (38%), Positives = 59/101 (58%), Gaps = 2/101 (1%)
 Frame = -3

Query: 422  APTAAPTKPPT-ATPAPTAQPPAAATPPTATPPTATPPAAV-PAPATPAPASSPATSPPA 249
            AP  +P +PP+ A P+P    P + +PP+  PP+  PP+ + P+PA P+PA  P+  PP+
Sbjct: 1311 APPPSPPEPPSPAPPSPQPPQPPSPSPPSPAPPSPEPPSPIPPSPAPPSPA-PPSPQPPS 1369

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P P S    +P P  + +PP+P P S  P    +  PPSP+
Sbjct: 1370 PEPPSPAPPSPAP-LSPAPPSPAPPSPIPPAPPSPEPPSPA 1409

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 35/98 (35%), Positives = 50/98 (51%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  P  ++PAP + PP +  PP+  P ++ PP+  P  + P     P+ +PP+P P
Sbjct: 1078 PSPPPPSPEPSSPAPPSPPPPSPAPPSPEPQSSAPPSPEPQSSAPPSPVPPSPAPPSPAP 1137

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             S    +P+PS A  PP P P S  P      TP  PS
Sbjct: 1138 PSPEPPSPSPSPA--PPIPAPPSPQPPSPAPQTPQPPS 1173

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 41/104 (39%), Positives = 55/104 (52%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS--SPATSPPAP 246
           P+  P  P   +PAP   PPA   PP+ TPP+  PP+  P P +PAP S   P+  PP+P
Sbjct: 656 PSPLPPSPAPPSPAPPQPPPA---PPSPTPPSPAPPS--PPPPSPAPPSPRPPSPEPPSP 710

Query: 245 TPASTPSTAPTPST----AGSPPAPTPDSLGPGPSGADTPPSPS 126
            P S    +PTP +    + +PP+P P S  P      +PP PS
Sbjct: 711 KPPSPEPPSPTPPSPQPPSPAPPSPPPPSPEPPSPAPPSPPPPS 754

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 41/104 (39%), Positives = 56/104 (53%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS--PPAP 246
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S P  S  P +P
Sbjct: 1033 PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPPSPEPSSP 1090

Query: 245  TPASTPSTAPTPST----AGSPPAPTPDSLGPGPSGADTPPSPS 126
             P S P  +P P +    + +PP+P P S  P PS    PPSP+
Sbjct: 1091 APPSPPPPSPAPPSPEPQSSAPPSPEPQSSAP-PS--PVPPSPA 1131

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 43/109 (39%), Positives = 57/109 (52%), Gaps = 11/109 (10%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS--PATSPPA 249
           AP   PT PP+  P P+ +PP+  +PP+  PP+  PP+    P +P P S   P  +PP+
Sbjct: 594 APPDPPTAPPSPDP-PSPEPPSQPSPPSPDPPSPDPPSPPALPPSPKPPSPKPPTPAPPS 652

Query: 248 PTPAST-------PSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPPSP 129
           P P S        PS AP P    +PP+PTP S  P   P  +  PPSP
Sbjct: 653 PLPPSPLPPSPAPPSPAP-PQPPPAPPSPTPPSPAPPSPPPPSPAPPSP 700

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 38/105 (36%), Positives = 50/105 (47%), Gaps = 1/105 (0%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
            T    + P+  P  P P   P+P    PA   PP+  PP+  PP+  P P+ PAP S P 
Sbjct: 1248 TPASPEPPSPQPPSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPPSPPAPPS-PE 1306

Query: 263  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              PPAP P+     +P P +   P  P+P    P P   + PPSP
Sbjct: 1307 PIPPAPPPSPPEPPSPAPPSPQPPQPPSPSPPSPAPPSPE-PPSP 1350

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 9/107 (8%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA---------AVPAPATPAPASSP 267
            P+  P  P   +PAP +  P +  PP+  PP+  PPA         A P+PA P+PA  P
Sbjct: 1363 PSPQPPSPEPPSPAPPSPAPLSPAPPSPAPPSPIPPAPPSPEPPSPAPPSPAPPSPA-PP 1421

Query: 266  ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            +  PP+P P S    +P P +  +PP+P P S  P    +  PPSP+
Sbjct: 1422 SPQPPSPAPPSPRPPSPAPPSP-APPSPVPPSPQPPAPPSPAPPSPA 1467

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 36/104 (34%), Positives = 53/104 (50%), Gaps = 4/104 (3%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
            + P+ AP  PP  +P P +  P +  PP+  PP+  PP+  P    P   + P+ +PP+P
Sbjct: 951  EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPTPPSP 1010

Query: 245  TPAS-TPSTAPTPS---TAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P S  P + P PS    + +PP+P P S  P      +PP PS
Sbjct: 1011 EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 1054

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 42/104 (40%), Positives = 58/104 (55%), Gaps = 5/104 (4%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPASSPATSPPA 249
            + P+ AP  PP  +P P +  P +  PP+  PP+  PP+  P +P  P+PA  P+  PP+
Sbjct: 1026 EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA-PPSPPPPS 1084

Query: 248  PTPAS-TPSTAPTPSTAGSPPAPTPDSLGPGPS---GADTPPSP 129
            P P+S  P + P PS A  PP+P P S  P PS    +  PPSP
Sbjct: 1085 PEPSSPAPPSPPPPSPA--PPSPEPQSSAP-PSPEPQSSAPPSP 1125

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 38/99 (38%), Positives = 52/99 (52%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS--PATSPPAP 246
            P+ AP  P   +P P +  P +  PP+  PP+  PP+  PAP +PAP S   P+ +PP+P
Sbjct: 1338 PSPAPPSPEPPSPIPPSPAPPSPAPPSPQPPSPEPPS--PAPPSPAPLSPAPPSPAPPSP 1395

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             P + PS  P      SP  P+P    P P  +  PPSP
Sbjct: 1396 IPPAPPSPEPPSPAPPSPAPPSPAPPSPQPP-SPAPPSP 1433

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 43/105 (40%), Positives = 57/105 (54%), Gaps = 8/105 (7%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPA-SSPATSPPAP 246
           P+  P  PP   P+P    P +  PPT  PP+  PP+ +P +PA P+PA   P  +PP+P
Sbjct: 624 PSPDPPSPPALPPSPK---PPSPKPPTPAPPSPLPPSPLPPSPAPPSPAPPQPPPAPPSP 680

Query: 245 TPAS-TPSTAPTPSTA-GSPPAPTPDSLGPGPSGAD----TPPSP 129
           TP S  P + P PS A  SP  P+P+   P P   +    TPPSP
Sbjct: 681 TPPSPAPPSPPPPSPAPPSPRPPSPEPPSPKPPSPEPPSPTPPSP 725

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 39/100 (39%), Positives = 51/100 (51%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS--SPATSPPAP 246
            P+  P  P   +PAP +  P +  PP+  PP+  PP+  PAP +PAP S   P+  PPAP
Sbjct: 1343 PSPEPPSPIPPSPAPPSPAPPSPQPPSPEPPSPAPPS--PAPLSPAPPSPAPPSPIPPAP 1400

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
                 PS AP      SP  P+P    P P  +  PPSP+
Sbjct: 1401 PSPEPPSPAPPSPAPPSPAPPSPQPPSPAPP-SPRPPSPA 1439

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 44/109 (40%), Positives = 55/109 (50%), Gaps = 3/109 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           P  AP  P   +P P +QP P +  PP+  PP  +PPA  P+P  P+P   P  +PP+P 
Sbjct: 598 PPTAPPSPDPPSPEPPSQPSPPSPDPPSPDPP--SPPALPPSPKPPSP-KPPTPAPPSPL 654

Query: 242 PAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           P S   PS AP PS A   P P P S  P      +PP PS A    +P
Sbjct: 655 PPSPLPPSPAP-PSPAPPQPPPAPPSPTPPSPAPPSPPPPSPAPPSPRP 702

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 39/105 (37%), Positives = 55/105 (52%), Gaps = 2/105 (1%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS--PATS 258
            L+ AP + P  P    PAP +  P +  PP+  PP+  PP+  P P +PAP S   P+ +
Sbjct: 1383 LSPAPPS-PAPPSPIPPAPPSPEPPSPAPPSPAPPSPAPPS--PQPPSPAPPSPRPPSPA 1439

Query: 257  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
            PP+P P S    +P P    SP  P+P    P P  +  PPSP++
Sbjct: 1440 PPSPAPPSPVPPSPQPPAPPSPAPPSPAPPSPAPP-SPAPPSPAS 1483

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 38/98 (38%), Positives = 53/98 (54%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+ AP  P   +P P +  P +  PP+  P +  PP+  PAP +P P + P+  PP+P P
Sbjct: 1353 PSPAPPSPAPPSPQPPSPEPPSPAPPSPAPLSPAPPS--PAPPSPIPPAPPSPEPPSPAP 1410

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             S    +P P +   PP+P P S  P PS A  PPSP+
Sbjct: 1411 PSPAPPSPAPPSP-QPPSPAPPSPRP-PSPA--PPSPA 1444

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 39/103 (37%), Positives = 52/103 (50%), Gaps = 3/103 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP---PTATPPTATPPAAVPAPATPAPASSPATSPPA 249
            P+  P  P   +PAP   PPA  +P   P A PP+   P + PAP +P P   P+ SPP+
Sbjct: 1281 PSPDPPSPVPPSPAPPPSPPAPPSPEPIPPAPPPSPPEPPS-PAPPSPQPPQPPSPSPPS 1339

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            P P S    +P P +  +PP+P P S  P      +P  PS A
Sbjct: 1340 PAPPSPEPPSPIPPSP-APPSPAPPSPQPPSPEPPSPAPPSPA 1381

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 36/97 (37%), Positives = 49/97 (50%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+ AP  PP+  P P+  PP+ A PP  +PP    P  +P    P+P   P+ +PP+P P
Sbjct: 1273 PSPAPLPPPSPDP-PSPVPPSPAPPP--SPPAPPSPEPIPPAPPPSPPEPPSPAPPSPQP 1329

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
               PS +P      SP  P+P    P P  +  PPSP
Sbjct: 1330 PQPPSPSPPSPAPPSPEPPSPIPPSPAPP-SPAPPSP 1365

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 38/102 (37%), Positives = 49/102 (48%), Gaps = 3/102 (2%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           +P     +PP   P P   P   A P    PPTA P    P+P  P+  S P+  PP+P 
Sbjct: 568 SPQPPVPRPPPRAPRPPRPPSPPAPPAPPDPPTAPPSPDPPSPEPPSQPSPPSPDPPSPD 627

Query: 242 PASTPSTAPTPS-TAGSPPAPTPDS-LGPGP-SGADTPPSPS 126
           P S P+  P+P   +  PP P P S L P P   +  PPSP+
Sbjct: 628 PPSPPALPPSPKPPSPKPPTPAPPSPLPPSPLPPSPAPPSPA 669

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 37/100 (37%), Positives = 51/100 (51%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           +Q    +P  P    P+P A PP+   PP+  PPT  PP+ +P    P   + P+ +PP 
Sbjct: 614 SQPSPPSPDPPSPDPPSPPALPPSPK-PPSPKPPTPAPPSPLPPSPLPPSPAPPSPAPPQ 672

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P PA    T P+P+   SPP P+P    P P   + PPSP
Sbjct: 673 PPPAPPSPTPPSPAPP-SPPPPSPAPPSPRPPSPE-PPSP 710

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 39/101 (38%), Positives = 52/101 (51%), Gaps = 3/101 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS--PATSPPAP 246
            P+ AP  P   +P P +  P+ A PP   PP+  PP+  PAP TP P S   P+ +PP+P
Sbjct: 1128 PSPAPPSPAPPSPEPPSPSPSPA-PPIPAPPSPQPPS--PAPQTPQPPSPDPPSPAPPSP 1184

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPS-GADTPPSPS 126
             P S    +P P T   P    P  + P P+  A  PPSP+
Sbjct: 1185 APPSPVPPSPIPPTPAPPSPEPPSPVPPSPTPPAPQPPSPA 1225

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 39/113 (34%), Positives = 52/113 (46%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
            A  P  +P  P    P+P A PP+   PP+  P    PP + P P +PAP S     PP+
Sbjct: 1276 APLPPPSPDPPSPVPPSP-APPPSPPAPPSPEPIPPAPPPSPPEPPSPAPPSPQPPQPPS 1334

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAA 90
            P+P S    +P P +   PP+P P S  P      +P  PS A     P+  A
Sbjct: 1335 PSPPSPAPPSPEPPSP-IPPSPAPPSPAPPSPQPPSPEPPSPAPPSPAPLSPA 1386

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 35/99 (35%), Positives = 55/99 (55%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
            P+  P +PP+  P+P +  P +  PP+  PP+  PP+ A P+P  P+P   P+ +PP+P 
Sbjct: 1325 PSPQPPQPPS--PSPPSPAPPSPEPPSPIPPSPAPPSPAPPSPQPPSP-EPPSPAPPSPA 1381

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P S    +P P +   P  P+P+   P P  +  PPSP+
Sbjct: 1382 PLSPAPPSPAPPSPIPPAPPSPEPPSPAPP-SPAPPSPA 1419

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 38/97 (39%), Positives = 50/97 (51%), Gaps = 2/97 (2%)
 Frame = -3

Query: 410 APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP--APATPAPASSPATSPPAPTPA 237
           AP  PPTA P+P   PP+   P   +PP+  PP+  P   PA P     P+  PP P P 
Sbjct: 594 APPDPPTAPPSP--DPPSPEPPSQPSPPSPDPPSPDPPSPPALPPSPKPPSPKPPTPAPP 651

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           S    +P P +  +PP+P P    P P  + TPPSP+
Sbjct: 652 SPLPPSPLPPSP-APPSPAPPQPPPAPP-SPTPPSPA 686

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 41/102 (40%), Positives = 55/102 (53%), Gaps = 2/102 (1%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS--SPATSPP 252
            + P+ +P+  P     P+ QPP+ A P T  PP+  PP+  PAP +PAP S   P+  PP
Sbjct: 1141 EPPSPSPSPAPPIPAPPSPQPPSPA-PQTPQPPSPDPPS--PAPPSPAPPSPVPPSPIPP 1197

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P P S    +P P +  +PPAP P S  P    A  PPSP+
Sbjct: 1198 TPAPPSPEPPSPVPPSP-TPPAPQPPSPAP---PAPQPPSPA 1235

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 7/105 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV-PAPATPAPAS--SPATSPPA 249
            P+ AP  P   +P P +  P +  P +  PP+  PP+ + PAP +P P S   P+ +PP+
Sbjct: 1358 PSPAPPSPQPPSPEPPSPAPPSPAPLSPAPPSPAPPSPIPPAPPSPEPPSPAPPSPAPPS 1417

Query: 248  PTPASTPSTAPTPST----AGSPPAPTPDSLGPGPSGADTPPSPS 126
            P P S    +P P +    + +PP+P P S  P       PPSP+
Sbjct: 1418 PAPPSPQPPSPAPPSPRPPSPAPPSPAPPSPVPPSPQPPAPPSPA 1462

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 36/97 (37%), Positives = 53/97 (54%)
 Frame = -3

Query: 416  TAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPA 237
            +A P+  P ++  P+  PP+ A PP+  PP+  PP+  P+PA P PA  P+  PP+P P 
Sbjct: 1110 SAPPSPEPQSSAPPSPVPPSPA-PPSPAPPSPEPPSPSPSPAPPIPA-PPSPQPPSPAPQ 1167

Query: 236  STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            +    +P P +  +PP+P P S  P      TP  PS
Sbjct: 1168 TPQPPSPDPPSP-APPSPAPPSPVPPSPIPPTPAPPS 1203

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 42/124 (33%), Positives = 48/124 (38%), Gaps = 27/124 (21%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPP----------AAV------PAPAT 288
           P + P  PP+  P P A PP    PP   P    PP          A V      P P  
Sbjct: 501 PPSPPPTPPSPPPTPPAPPPVPPLPPAPPPSPPLPPEPPFIALCIRAGVLCAMPSPVPPL 560

Query: 287 PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPA-----------PTPDSLGPGPSGADT 141
           P+P   P+  PP P P   P  AP P    SPPA           P+PD   P P    +
Sbjct: 561 PSPPRPPSPQPPVPRP---PPRAPRPPRPPSPPAPPAPPDPPTAPPSPDPPSPEPPSQPS 617

Query: 140 PPSP 129
           PPSP
Sbjct: 618 PPSP 621

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 41/108 (37%), Positives = 53/108 (49%), Gaps = 11/108 (10%)
 Frame = -3

Query: 416  TAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS------SPATS- 258
            ++AP  P   + AP +  P +  PP+  PP+  PP+  P+PA P PA       SPA   
Sbjct: 1109 SSAPPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPAPPIPAPPSPQPPSPAPQT 1168

Query: 257  --PPAPTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              PP+P P S   PS AP      SP  PTP    P P  +  PPSP+
Sbjct: 1169 PQPPSPDPPSPAPPSPAPPSPVPPSPIPPTPAPPSPEPP-SPVPPSPT 1215

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 42/102 (41%), Positives = 50/102 (49%), Gaps = 1/102 (0%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATPPTAT-PPTATPPAAVPAPATPAPASSPATSP 255
           L   P+  P  P    P P+ QPP    PP A  PP    P A PAP  P P + P+  P
Sbjct: 550 LCAMPSPVPPLPSPPRP-PSPQPPVPRPPPRAPRPPRPPSPPAPPAPPDP-PTAPPSPDP 607

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P+P P S PS  P+P    SP  P+P +L P P     PPSP
Sbjct: 608 PSPEPPSQPS-PPSPDPP-SPDPPSPPALPPSPK----PPSP 643

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 43/120 (35%), Positives = 58/120 (48%), Gaps = 4/120 (3%)
 Frame = -3

Query: 422  APTAAPTK---PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP-ATSP 255
            +P  APT    PP+ TPA  A P + A PP    P   P A  P+PA P P+ +P A  P
Sbjct: 1495 SPAPAPTTSPLPPSPTPALPAPPASPAPPPNPPRPPQPPAAPPPSPAAPPPSPAPLAPPP 1554

Query: 254  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSA 75
            P P P  TP+ A     A SPP P   +L    +    P + ++ F  +  + A+ A SA
Sbjct: 1555 PQPQPQPTPAAA-----APSPPLPPDCALLAQAALLSIPEAVNSMFVVAAGVPASAAASA 1609

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 35/98 (35%), Positives = 45/98 (45%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAP-ASSPATSPPAPT 243
            P+  P      +P P +  P +  PP+  PP+ +P  A P PA P+P   SPA   P P 
Sbjct: 1113 PSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPAPPIPAPPSPQPPSPAPQTPQPP 1172

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
                PS AP      SP  P+P    P P   + PPSP
Sbjct: 1173 SPDPPSPAPPSPAPPSPVPPSPIPPTPAPPSPE-PPSP 1209

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 44/122 (36%), Positives = 52/122 (42%), Gaps = 21/122 (17%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPT--------------ATPAPTAQPPAAATPPTATPPTATPPAAVPAP 294
           L  AP  +P  PP               A P+P    P+   PP+  PP   PP   P P
Sbjct: 524 LPPAPPPSPPLPPEPPFIALCIRAGVLCAMPSPVPPLPSPPRPPSPQPPVPRPPPRAPRP 583

Query: 293 -------ATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
                  A PAP   P T+PP+P P S     P P +  SPP+P P S  P PS    PP
Sbjct: 584 PRPPSPPAPPAP-PDPPTAPPSPDPPS-----PEPPSQPSPPSPDPPSPDP-PSPPALPP 636

Query: 134 SP 129
           SP
Sbjct: 637 SP 638

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 45/134 (33%), Positives = 58/134 (43%), Gaps = 26/134 (19%)
 Frame = -3

Query: 446 LATSCLAQ--APTAAPTKPPT--ATPAPTAQPPAAATPPTA--TPPT--ATPPAAVPA-P 294
           L   CLA   +P+ AP +PP    +P P  +PP+   PP+   TPP+   TPPA  P  P
Sbjct: 464 LGGQCLAPPPSPSPAPPRPPPFPPSPPPNPRPPSPPVPPSPPPTPPSPPPTPPAPPPVPP 523

Query: 293 ATPAPASSPATSP-----------------PAPTPASTPSTAPTPSTAGSPPAPTPDSLG 165
             PAP  SP   P                 P+P P   P  +P    +  PP P P    
Sbjct: 524 LPPAPPPSPPLPPEPPFIALCIRAGVLCAMPSPVP---PLPSPPRPPSPQPPVPRPPPRA 580

Query: 164 PGPSGADTPPSPSA 123
           P P    +PP+P A
Sbjct: 581 PRPPRPPSPPAPPA 594

[92][TOP]
>UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK5_CHLRE
          Length = 853

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 40/98 (40%), Positives = 50/98 (51%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV-PAPATPAPASSPATSPPAPT 243
           P+  P  PP  +P P + PP +  PP+  PP+  PP    P P +P P S P   PP+P 
Sbjct: 205 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 264

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P S P  +P P    SPP P P S  P P  +  PPSP
Sbjct: 265 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 302

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 38/97 (39%), Positives = 50/97 (51%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P   PP+P P
Sbjct: 190 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPPPPSPPP 247

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            S P  +P P    SPP P+P    P P    +PP P
Sbjct: 248 PSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 284

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 39/98 (39%), Positives = 48/98 (48%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP+  P P   PP  + PP + PP + PP + P P  P+P   P  SPP P P
Sbjct: 450 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P  +P P    SPP P+P    P P     PP PS
Sbjct: 510 PSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPPPPS 544

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 39/98 (39%), Positives = 48/98 (48%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P   PP  + PP + PP + PP   P+P  P P S P   PP+P P
Sbjct: 243 PSPPPPSPPPPSPPP---PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 299

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P  +P P    SPP P+P    P P     PP PS
Sbjct: 300 PSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPS 337

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 39/100 (39%), Positives = 49/100 (49%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP+  P P   PP  + PP + PP + PP + P P  P+P   P  SPP P P
Sbjct: 336 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395

Query: 239 ASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P  +P P +    SPP P+P    P P     PP PS
Sbjct: 396 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 435

 Score = 84.0 bits (206), Expect = 7e-15
 Identities = 39/103 (37%), Positives = 50/103 (48%)
 Frame = -3

Query: 434 CLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP 255
           C   +    P+ PP + P P+  PP+   PP  +PP  +PP   P P +P P S P  SP
Sbjct: 181 CCPISTPGIPSPPPPSPPPPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 237

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P P P S P  +P P +   PP P+P    P P     PP PS
Sbjct: 238 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPS 280

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 41/106 (38%), Positives = 51/106 (48%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP+  P P   PP+   PP  +PP  +PP   P P +P P S P  SPP P+P
Sbjct: 372 PSPPPPPPPSPPPPP---PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 428

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
              P  +P P    SPP P P S  P P  +  PP P +    S P
Sbjct: 429 PPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 474

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 39/103 (37%), Positives = 50/103 (48%), Gaps = 6/103 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTA------TPPAAVPAPATPAPASSPATS 258
           P   P+ PP + P P+  PP   +PP   PP+       +PP   P P +P P   P+  
Sbjct: 257 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 316

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           PP+P P S P  +P P    SPP P P S  P P  +  PPSP
Sbjct: 317 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 359

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 38/96 (39%), Positives = 49/96 (51%), Gaps = 3/96 (3%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA---PATPAPASSPATSPPAPTPA 237
           P+ PP + P P+  PP   +PP  +PP  +PP   P    P +P P S P   PP+P P 
Sbjct: 225 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 284

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             PS  P P  +  PP+P P S  P P  +  PPSP
Sbjct: 285 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 320

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 39/97 (40%), Positives = 48/97 (49%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P+ PP + P P+  PP+   PP  +PP   PP+  P P    P  SP   PP+P P
Sbjct: 309 PPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP--PPPSPPP 366

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            S P  +P P    SPP P P S  P P  +  PPSP
Sbjct: 367 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 403

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 39/97 (40%), Positives = 51/97 (52%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P  +P  PP  +P P + PP +  PP+  PP+  PP   P+P  P P S P   PP+P P
Sbjct: 456 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP-PSPPPPPPPSPPPPPPPSPPP 514

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            S P  +P P +   PP+P P S  P P  +  PPSP
Sbjct: 515 PSPPPPSPPPPSP-PPPSPPPPSPPPPPPPSPPPPSP 550

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 38/98 (38%), Positives = 47/98 (47%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P + P  PP + P P+  PP+   PP  +PP  +PP   P+P  P+P   P  SPP P P
Sbjct: 286 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP--PSPPPPSPPPPPPPSPPPPPP 343

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P   P      SPP P+P    P P     PP PS
Sbjct: 344 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 381

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 41/109 (37%), Positives = 54/109 (49%), Gaps = 3/109 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPASSPATSPPAPT 243
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P +P  P P S P  SPP P+
Sbjct: 195 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPS 254

Query: 242 PASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           P   P  +P P +    SPP P P S  P P  +  PP P +    S P
Sbjct: 255 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 303

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 42/109 (38%), Positives = 53/109 (48%), Gaps = 3/109 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-TPAPASSPATSPPAPT 243
           P + P  PP + P P+  PP+   PP  +PP   PP+  P P  +P P S P  SPP P 
Sbjct: 252 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPP 311

Query: 242 PASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           P S P  +P P +    SPP P P S  P P  +  PP P +    S P
Sbjct: 312 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 360

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 38/98 (38%), Positives = 46/98 (46%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP   PP + P P  P+P   P  SPP P P
Sbjct: 401 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---PPPSPPPPPPPSPPPPPPPSPPPPPP 457

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P   P      SPP P+P    P P     PP PS
Sbjct: 458 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 495

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 40/109 (36%), Positives = 51/109 (46%), Gaps = 2/109 (1%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           +P      PP+  P P   PP  + PP + PP + PP   P+P  P P S P   PP+P 
Sbjct: 296 SPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 355

Query: 242 PASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           P S P  +P P +    SPP P P S  P P  +  PP P +    S P
Sbjct: 356 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 404

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 38/98 (38%), Positives = 48/98 (48%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP+  P P   PP+   PP  +PP  +PP   P P +P P S P   PP+P P
Sbjct: 328 PSPPPPPPPSPPPPP---PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 384

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              PS  P P  +  PP+P P S  P      +PP PS
Sbjct: 385 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 422

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 38/98 (38%), Positives = 48/98 (48%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP+  P P   PP+   PP  +PP  +PP   P P +P P S P   PP+P P
Sbjct: 442 PSPPPPPPPSPPPPP---PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 498

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              PS  P P  +  PP+P P S  P      +PP PS
Sbjct: 499 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 536

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 38/98 (38%), Positives = 50/98 (51%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
           P + P  PP + P P+  PP+   PP  +PP  +PP  + P P  P+P   P  SPP P 
Sbjct: 234 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 293

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P S P  +P P +   PP P+P    P P  +  PPSP
Sbjct: 294 PPSPPPPSPPPPSPPPPPPPSPPPPSP-PPPSPPPPSP 330

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 37/97 (38%), Positives = 47/97 (48%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P+ PP + P P+  PP   +PP  +PP  +PP   P+P  P P S P   PP+P P
Sbjct: 291 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP--PSPPPPPPPSPPPPPPPSPPP 348

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              PS  P      SPP P+P    P P    +PP P
Sbjct: 349 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 385

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 40/108 (37%), Positives = 50/108 (46%), Gaps = 2/108 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP     P   PP + PP   P+P  P P S P   PP+P P
Sbjct: 411 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 470

Query: 239 ASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            S P  +P P +    SPP P P S  P P  +  PP P +    S P
Sbjct: 471 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 518

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 37/93 (39%), Positives = 47/93 (50%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTP 228
           P+ PP + P P+  PP+   PP  +PP  +PP   P+P  P P S P  SPP P+P   P
Sbjct: 220 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP--PSPPPPPPPSPPPPSPPPPSPPPPP 277

Query: 227 STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             +P P    SPP P P S  P      +PP P
Sbjct: 278 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 310

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 38/95 (40%), Positives = 47/95 (49%), Gaps = 1/95 (1%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPT-ATPPAAVPAPATPAPASSPATSPPAPTPAST 231
           P+ PP + P P+  PP   +PP   PP+   PP   P P +P P S P  SPP P+P   
Sbjct: 318 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 377

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P  +P P    SPP P P S  P      +PP PS
Sbjct: 378 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPS 412

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 37/97 (38%), Positives = 46/97 (47%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP    P   PP + P P  P+P   P  SPP P P
Sbjct: 406 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 465

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            S P  +P P    SPP P+P    P P    +PP P
Sbjct: 466 PSPPPPSPPPP---SPPPPSPPPPSPPPPPPPSPPPP 499

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 37/100 (37%), Positives = 49/100 (49%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPA---AATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           P   P+ PP + P P+  PP+    + PP + PP + PP   P+P  P P S P   PP+
Sbjct: 392 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 451

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P P   PS  P P  +  PP+P P S  P      +PP P
Sbjct: 452 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 491

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 38/98 (38%), Positives = 47/98 (47%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P+ PP   P+P   PP +  PP+  PP+  PP     P +P P S P  SPP P+P
Sbjct: 275 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPP----PPSPPPPSPPPPSPPPPSP 330

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              P  +P P    SPP P P S  P      +PP PS
Sbjct: 331 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPS 368

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 37/99 (37%), Positives = 47/99 (47%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTA--TPPAAVPAPATPAPASSPATSPPAP 246
           P+  P  PP+  P P   PP  + PP + PP    +PP   P P +P P S P   PP+P
Sbjct: 279 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 338

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P   PS  P P  +  PP+P P S  P      +PP P
Sbjct: 339 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 377

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 39/96 (40%), Positives = 48/96 (50%), Gaps = 3/96 (3%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV-PAPATPAPASSPATSPPAPT--PA 237
           P+ PP + P P+  PP   +PP   PP+  PP    P P +P P S P  SPP P+  P 
Sbjct: 362 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 421

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           S P  +P P    SPP P P S  P P  +  PP P
Sbjct: 422 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 457

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 39/99 (39%), Positives = 49/99 (49%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
           P  +P  PP  +P P + PP +  PP+  PP+  PP+   P+P  P P S P   PP+P 
Sbjct: 386 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 445

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P   PS  P P    SPP P P S  P      +PP PS
Sbjct: 446 PPPPPSPPPPPPP--SPPPPPPPSPPPPSPPPPSPPPPS 482

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 38/98 (38%), Positives = 46/98 (46%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P+ PP   P+P   PP +  PP    P   PP + P P +P P S P  SPP P+P
Sbjct: 430 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPS-PPPPSPPPPSPPPPSPPPPSP 488

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              P  +P P    SPP P P S  P      +PP PS
Sbjct: 489 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPS 526

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 36/95 (37%), Positives = 45/95 (47%), Gaps = 1/95 (1%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPTPAST 231
           P+ PP + P P+  PP+   PP  +PP   PP+   P P +P P S P  SPP P+P   
Sbjct: 357 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 416

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
               P+P     PP P P    P P     PP PS
Sbjct: 417 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 451

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 37/98 (37%), Positives = 43/98 (43%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP+  P P   PP    P    PP  +PP   P P +P P S P  SPP P P
Sbjct: 434 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 493

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P   P       PP+P P S  P      +PP PS
Sbjct: 494 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 531

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 39/105 (37%), Positives = 50/105 (47%), Gaps = 2/105 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT- 243
           P+  P  PP  +P P + PP +  PP   PP + PP   P+P  P P S P  SPP P+ 
Sbjct: 466 PSPPPPSPPPPSPPPPSPPPPSPPPP---PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 522

Query: 242 -PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSY 111
            P S P  +P P +   PP P+P    P P    +PP P     Y
Sbjct: 523 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPP---PSPPPPCQVCVY 564

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 37/98 (37%), Positives = 45/98 (45%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P + P  PP + P P    P   +PP  +PP   PP+  P P +P P S P  SPP P P
Sbjct: 278 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPS--PPPPSPPPPSPPPPSPPPPPP 335

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P   P       PP+P P S  P      +PP PS
Sbjct: 336 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 373

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 35/96 (36%), Positives = 43/96 (44%), Gaps = 1/96 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           P   P+ PP + P P+  PP+   P P   PP + PP   P+P  P P S P  SPP P+
Sbjct: 462 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 521

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           P       P+P     PP P P    P P     PP
Sbjct: 522 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 557

[93][TOP]
>UniRef100_B3XYC5 Chitin-binding lectin n=1 Tax=Solanum lycopersicum var. cerasiforme
           RepID=B3XYC5_SOLLC
          Length = 365

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 43/104 (41%), Positives = 59/104 (56%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           +C +Q P   P+ PP + P P+  PP    PP+  PP+ +PP   P+P  PAP S P  S
Sbjct: 87  NCQSQCPHT-PSPPPPSPPPPSPSPP----PPSPPPPSPSPPPPTPSPPPPAP-SPPPPS 140

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           PP P+P+  P + P PS +  PP P+P    P PS +  PP+PS
Sbjct: 141 PPPPSPSPPPPSPPPPSPSPPPPTPSP----PPPSPSPPPPTPS 180

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 40/100 (40%), Positives = 52/100 (52%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPA---AATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           P  +P+ PP + P P+  PP    +  PP  +PP  +PP   P+P  P+P   P+ SPP 
Sbjct: 104 PPPSPSPPPPSPPPPSPSPPPPTPSPPPPAPSPPPPSPPPPSPSPPPPSPPP-PSPSPPP 162

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           PTP+  P   P+P    SPP PTP    P PS    PP P
Sbjct: 163 PTPSPPP---PSP----SPPPPTPSPPPPAPS----PPPP 191

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 34/87 (39%), Positives = 47/87 (54%), Gaps = 5/87 (5%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPT----AQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT-S 258
           +P+  P  PP  +P+P     + PP A +PP  +PP  +P    P+P  P+P+  P T S
Sbjct: 107 SPSPPPPSPPPPSPSPPPPTPSPPPPAPSPPPPSPPPPSPSPPPPSPPPPSPSPPPPTPS 166

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTP 177
           PP P+P+  P T   P  A SPP P P
Sbjct: 167 PPPPSPSPPPPTPSPPPPAPSPPPPYP 193

 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 26/64 (40%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA-SSPATSPP 252
           A +P      PP+ +P P + PP + +PP   PPT +PP   P+P  P P+   PA SPP
Sbjct: 133 APSPPPPSPPPPSPSPPPPSPPPPSPSPP---PPTPSPPPPSPSPPPPTPSPPPPAPSPP 189

Query: 251 APTP 240
            P P
Sbjct: 190 PPYP 193

[94][TOP]
>UniRef100_A9NMQ1 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NMQ1_PICSI
          Length = 159

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 54/155 (34%), Positives = 79/155 (50%), Gaps = 17/155 (10%)
 Frame = -3

Query: 482 SAAVQIFLILGLLATSCLAQAPTAAPT----KPPTATPAPTAQPPAAATP---PTATPPT 324
           + AV +F+I+ L+ +SC AQ+P+AAP+     P T T +P   P  A++P   P A+PPT
Sbjct: 6   AVAVTLFVIVSLMGSSCWAQSPSAAPSTTAGAPTTTTASPVTSPKKASSPTVSPLASPPT 65

Query: 323 ATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAG-------SPPAPT---PD 174
            + P+  P   TP  +SSP +SPP+P   S  ++ P PS +        SPP P+   P 
Sbjct: 66  TSAPS--PVAVTPTMSSSPISSPPSPPSVSPVASGPAPSISAVASSPTTSPPMPSSSLPS 123

Query: 173 SLGPGPSGADTPPSPSAAFSYSKPIIAATALSAAL 69
            L P P+      S +      K  +   AL A L
Sbjct: 124 KLPPTPTPVAGDKSSAEVLKLEKMALFGAALVAFL 158

[95][TOP]
>UniRef100_Q7U3X4 Putative uncharacterized protein n=1 Tax=Synechococcus sp. WH 8102
            RepID=Q7U3X4_SYNPX
          Length = 2014

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 55/119 (46%), Positives = 71/119 (59%), Gaps = 20/119 (16%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP---PTATP---PTATP---PAAVPAPA-----TPA 282
            P+A PT  PT TP PT  P  +ATP   P+ATP   P+ATP   P+A P P      TP 
Sbjct: 1582 PSATPTPTPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTPTPTPTPTPT 1641

Query: 281  PASSPATSP---PAPTPASTPSTAPTPSTAGSPPA-PTPD-SLGPGPSGADTP-PSPSA 123
            P+++P  SP   P P+P++TP+ +P+ +   SP A PTP  S  P PS + TP PSPSA
Sbjct: 1642 PSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSA 1700

 Score = 84.0 bits (206), Expect = 7e-15
 Identities = 53/123 (43%), Positives = 67/123 (54%), Gaps = 17/123 (13%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATPPAAVPAPATPAPASSP 267
            T+  +  PT  P+  PT TP+ T  P    TP PT TP P+ATP  +  A  TP+P+++P
Sbjct: 1563 TTSDSTTPTPTPSVTPTPTPSATPTPTPTPTPTPTPTPTPSATPTPSPSATPTPSPSATP 1622

Query: 266  ATSP-------PAPTPASTPSTAPTPSTAGSP-------PAPTPDSLGPGPSGADTP-PS 132
              SP       P PTP  TPS  PTPS + +P       P P+P S  P PS + TP PS
Sbjct: 1623 TPSPSATPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSP-SATPTPSPSATPTPS 1681

Query: 131  PSA 123
            PSA
Sbjct: 1682 PSA 1684

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 49/103 (47%), Positives = 64/103 (62%), Gaps = 3/103 (2%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATPPAAVPAPATPAPASSPATSPPA 249
            +P+A PT  P+ATP P+       TP PT TP P+ATP  +  A  TP+P+++P  SP A
Sbjct: 1609 SPSATPTPSPSATPTPSPSATPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSA 1668

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSPSA 123
             TP  +PS  PTPS + + P P+P S  P PS + TP PSPSA
Sbjct: 1669 -TPTPSPSATPTPSPSAT-PTPSP-SATPTPSPSATPTPSPSA 1708

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 48/105 (45%), Positives = 66/105 (62%), Gaps = 4/105 (3%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATP---PTATPPAAVPAPATPAPASSPATSPP 252
            +P+A PT  P+ATP PT  P    T P+ATP   P+ATP  +  A  TP+P+++P  SP 
Sbjct: 1617 SPSATPTPSPSATPTPTPTPTPTPT-PSATPTPSPSATPTPSPSATPTPSPSATPTPSPS 1675

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSPSAA 120
            A TP  +PS  PTPS + + P P+P S  P PS + TP P+P+A+
Sbjct: 1676 A-TPTPSPSATPTPSPSAT-PTPSP-SATPTPSPSATPDPTPTAS 1717

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 50/114 (43%), Positives = 65/114 (57%), Gaps = 7/114 (6%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATP-PTATPPAAVPAPATPAPASSP 267
            A S    + +  PT  P+ TP PT   P+A   PT TP PT TP     A  TP+P+++P
Sbjct: 1558 ARSSGTTSDSTTPTPTPSVTPTPT---PSATPTPTPTPTPTPTPTPTPSATPTPSPSATP 1614

Query: 266  ATSP---PAPTPASTPSTAPTPSTAGSPPA-PTPD-SLGPGPSGADTP-PSPSA 123
              SP   P P+P++TP+  PTP+   +P A PTP  S  P PS + TP PSPSA
Sbjct: 1615 TPSPSATPTPSPSATPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSA 1668

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 48/109 (44%), Positives = 63/109 (57%), Gaps = 14/109 (12%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP---PTATP---PTATP---PAAVPAPA-----TPA 282
            PT +P+  PT TP PT  P  +ATP   P+ATP   P+ATP   P+A P P+     TP+
Sbjct: 1622 PTPSPSATPTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTPS 1681

Query: 281  PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
            P+++P  SP A TP  +PS  PTPS     P+ TPD   P P+ +D  P
Sbjct: 1682 PSATPTPSPSA-TPTPSPSATPTPS-----PSATPD---PTPTASDELP 1721

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 46/115 (40%), Positives = 63/115 (54%), Gaps = 17/115 (14%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP---PTATP---PTATP---PAAVPAPA-----TPA 282
            PT  PT  PT TP+ T  P  +ATP   P+ATP   P+ATP   P+A P P+     TP+
Sbjct: 1630 PTPTPTPTPTPTPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTPSPSATPTPS 1689

Query: 281  PASSPATSP---PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P+++P  SP   P P+P++TP   PTP+ +   P    D LG     + TP + S
Sbjct: 1690 PSATPTPSPSATPTPSPSATPD--PTPTASDELPVDVSD-LGSDDISSLTPDAVS 1741

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 48/111 (43%), Positives = 59/111 (53%), Gaps = 11/111 (9%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATP---PTATP-PAAVPAPATPAPASSPATSP 255
            A  ++ T   + TP PT      +  PT TP   PT TP P   P P TP P+++P  SP
Sbjct: 1557 AARSSGTTSDSTTPTPTP-----SVTPTPTPSATPTPTPTPTPTPTP-TPTPSATPTPSP 1610

Query: 254  PAPTPASTPSTAPTPSTAGSP-PAPTP-----DSLGPGPSGADTP-PSPSA 123
             A TP  +PS  PTPS + +P P PTP      S  P PS + TP PSPSA
Sbjct: 1611 SA-TPTPSPSATPTPSPSATPTPTPTPTPTPTPSATPTPSPSATPTPSPSA 1660

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 40/98 (40%), Positives = 55/98 (56%), Gaps = 5/98 (5%)
 Frame = -3

Query: 401  KPPTATPAPTAQPPAAATPPTATPP-TATP-PAAVPAPATPAPASSPATSPPAPTPASTP 228
            + P    A ++   + +T PT TP  T TP P+A P P TP P  +P    P PTP++TP
Sbjct: 1551 RTPGFVAARSSGTTSDSTTPTPTPSVTPTPTPSATPTP-TPTPTPTPT---PTPTPSATP 1606

Query: 227  STAPTPSTAGSPPA-PTPD-SLGPGPSGADTP-PSPSA 123
            + +P+ +   SP A PTP  S  P P+   TP P+PSA
Sbjct: 1607 TPSPSATPTPSPSATPTPSPSATPTPTPTPTPTPTPSA 1644

[96][TOP]
>UniRef100_Q12DK8 Putative uncharacterized protein n=1 Tax=Polaromonas sp. JS666
           RepID=Q12DK8_POLSJ
          Length = 433

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 57/130 (43%), Positives = 67/130 (51%), Gaps = 4/130 (3%)
 Frame = -3

Query: 497 PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQP-PAAATPPTATPPTA 321
           PK A +A V+        A    A AP  AP   P   PAP   P PA A  P   P  A
Sbjct: 130 PKAAPAAEVKPPPAPAPAAAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPA 189

Query: 320 TPPAAVPAPATPAPASSPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGA 147
             PA  PAPA PAPA +PA +P PAP PA  P+ AP P+ A +P PAP P    P P+ A
Sbjct: 190 PAPAPAPAPA-PAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAP---APAPAPA 245

Query: 146 DTP-PSPSAA 120
             P P+P+ A
Sbjct: 246 PAPAPAPAPA 255

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 55/128 (42%), Positives = 67/128 (52%), Gaps = 9/128 (7%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPATPAPASSPATSP- 255
           A AP  AP   P   PAP   P PA A  P   P  A  PA  PAPA PAPA +PA +P 
Sbjct: 169 APAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPA-PAPAPAPAPAPA 227

Query: 254 PAPTPASTPSTAPTPSTAGSP-PAPTP-DSLGPGPSGADTP-----PSPSAAFSYSKPII 96
           PAP PA  P+ AP P+ A +P PAP P  +  P P+ A  P     P+P+ A + S P +
Sbjct: 228 PAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPPPAPAPTPAPAPTPSVPPV 287

Query: 95  AATALSAA 72
               +S A
Sbjct: 288 TMMPMSKA 295

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 56/110 (50%), Positives = 64/110 (58%), Gaps = 7/110 (6%)
 Frame = -3

Query: 428 AQAPTAAPT---KPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
           A AP AAP    KPP A PAP A P PA A  P   P  A  PA  PAPA PAPA +PA 
Sbjct: 127 AAAPKAAPAAEVKPPPA-PAPAAAPAPAPAPAPAPAPAPAPAPAPAPAPA-PAPAPAPAP 184

Query: 260 SP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
           +P PAP PA  P+ AP P+ A +P PAP P    P P+ A  P P+P+ A
Sbjct: 185 APAPAPAPAPAPAPAPAPAPAPAPAPAPAP---APAPAPAPAPAPAPAPA 231

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 46/93 (49%), Positives = 53/93 (56%), Gaps = 3/93 (3%)
 Frame = -3

Query: 389 ATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSPPAPTPASTPSTAPT 213
           A  AP A P A   PP A  P A P PA  PAPA PAPA +PA   PAP PA  P+ AP 
Sbjct: 126 AAAAPKAAPAAEVKPPPAPAPAAAPAPAPAPAPA-PAPAPAPA---PAPAPAPAPAPAPA 181

Query: 212 PSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
           P+ A +P PAP P    P P+ A  P P+P+ A
Sbjct: 182 PAPAPAPAPAPAP---APAPAPAPAPAPAPAPA 211

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 40/92 (43%), Positives = 44/92 (47%), Gaps = 2/92 (2%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPATPAPASSPATSP- 255
           A AP  AP   P   PAP   P PA A  P   P  A  PA  PAPA PAP  +PA +P 
Sbjct: 219 APAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPA-PAPPPAPAPTPA 277

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG 159
           PAPTP S P     P +   P + T     PG
Sbjct: 278 PAPTP-SVPPVTMMPMSKADPSSITAQQAVPG 308

[97][TOP]
>UniRef100_A0QRP9 Putative uncharacterized protein n=1 Tax=Mycobacterium smegmatis
           str. MC2 155 RepID=A0QRP9_MYCS2
          Length = 403

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 57/134 (42%), Positives = 67/134 (50%), Gaps = 4/134 (2%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCL---AQAPTAAPTKPPTATPAPTAQPPAAATP-PTATPPT 324
           +ASSAAV I L  G +A +     A     A +KP T   AP  +PPAA  P P A PP 
Sbjct: 249 VASSAAVGIQLHPGAIAPAAEVTDAGKSEPAASKPATPAAAPRPKPPAAPAPAPEARPPA 308

Query: 323 ATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
             P A  PAPA PAP +   + P A  PA  P  AP P  A  PPAP P +  P P  A 
Sbjct: 309 PEPAAPAPAPAAPAPVAEVNSVPAAEPPAYVP-PAPAPEPAYVPPAPEP-AYVPPPPPAF 366

Query: 143 TPPSPSAAFSYSKP 102
            PP P    +Y +P
Sbjct: 367 VPPPPPPPLNYPQP 380

[98][TOP]
>UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK6_CHLRE
          Length = 738

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 39/97 (40%), Positives = 50/97 (51%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 203 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 260

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              P  +P P    SPP P P    P P  +  PPSP
Sbjct: 261 PPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSP 297

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 42/108 (38%), Positives = 53/108 (49%), Gaps = 2/108 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT- 243
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+ 
Sbjct: 193 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 250

Query: 242 -PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P S P  +P P    SPP P P S  P P     PP P +    S P
Sbjct: 251 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPP 298

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 40/97 (41%), Positives = 48/97 (49%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P  +P  PP+  P P  +PP  + PP + PP + PP   P+P  P P S P   PP P P
Sbjct: 334 PPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPP---PSPPPPPPPSPPPPPPPRPPP 390

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            S P  +P P    SPP P P S  P P     PPSP
Sbjct: 391 PSPPPPSPPPP---SPPPPPPPSPPPPPPPRPPPPSP 424

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 38/98 (38%), Positives = 46/98 (46%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP   P+P  P P S P   PP P P
Sbjct: 228 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP-PSPPPPPPPSPPPPPPPRPPP 286

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              PS  P      SPP P+P    P P     PP PS
Sbjct: 287 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPS 324

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 38/102 (37%), Positives = 46/102 (45%), Gaps = 4/102 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT----PPAAVPAPATPAPASSPATSPP 252
           P + P  PP   P P+  PP+   PP  +PP       PP   P P +P P S P  SPP
Sbjct: 309 PPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPP 368

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P+P   P  +P P     PP P+P    P P     PP PS
Sbjct: 369 PPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPS 410

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 36/95 (37%), Positives = 46/95 (48%), Gaps = 1/95 (1%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT-PAPASSPATSPPAPTPAST 231
           P+ PP + P P+  PP+   PP  +PP   PP+  P P   P P   P+  PP+P P S 
Sbjct: 243 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSP 302

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P  +P P +   PP P P    P P     PP PS
Sbjct: 303 PPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPS 337

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 36/98 (36%), Positives = 48/98 (48%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
           P+  P  PP  +P P + PP +  PP+  PP+  PP+   P+P  P P S P   PP+P 
Sbjct: 218 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 277

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P   P   P P  +  PP+P P S  P      +PP P
Sbjct: 278 PPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 315

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 36/97 (37%), Positives = 45/97 (46%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P  P+P   P  SPP P P
Sbjct: 223 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP-PPPPPPSPPPPPPPSPPPPPP 281

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              P   P      SPP P+P    P P     PP P
Sbjct: 282 PRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 318

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 38/97 (39%), Positives = 48/97 (49%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP   PP + P P  P+P   P   PP P P
Sbjct: 233 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---PPPSPPPPPPPSPPPPPPPRPPPPPP 289

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            S P  +P P +   PP+P P S  P P     PPSP
Sbjct: 290 PSPPPPSPPPPSP-PPPSPPPPSPPPPPPPRPPPPSP 325

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 39/95 (41%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTP 228
           P+ PP + P P+  PP    PP  +PP  +PP   P P+ P P S P   PP P P S P
Sbjct: 300 PSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPP-PPPSPPPPPSPPPPPPPRPPPPSPP 358

Query: 227 STAPTPST--AGSPPAPTPDSLGPGPSGADTPPSP 129
             +P P +    SPP P P S  P P     PPSP
Sbjct: 359 PPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSP 393

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 37/99 (37%), Positives = 48/99 (48%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPASSPATSPPAPT 243
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P +P  P+P   P  SPP P 
Sbjct: 213 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 272

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P S P   P       PP+P P S  P      +PP PS
Sbjct: 273 PPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPS 311

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 39/103 (37%), Positives = 48/103 (46%), Gaps = 4/103 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV----PAPATPAPASSPATSPP 252
           P  +P  PP   P P + PP +  PP+  PP+  PP       P P  P P S P  SPP
Sbjct: 340 PPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPP 399

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
            P+P   P  +P P     PP P+P    P P  +  PPSP A
Sbjct: 400 PPSPPPPPPPSPPPPPPPRPPPPSPPPPSP-PPPSPPPPSPPA 441

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 38/100 (38%), Positives = 45/100 (45%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP+  P P   PP    P    PP  +PP   P P +P P S P  SPP P P
Sbjct: 258 PSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 317

Query: 239 ASTPSTAPTPSTAGSPPAPT---PDSLGPGPSGADTPPSP 129
              P  +P P +   PP P+   P S  P P     PPSP
Sbjct: 318 PRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSP 357

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 39/107 (36%), Positives = 47/107 (43%), Gaps = 9/107 (8%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP   P P   PP  + PP + PP + PP + P P  P P   P+  PP+P P
Sbjct: 274 PSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPP-PSPPPPSPPP 332

Query: 239 ASTPSTAPTPS---------TAGSPPAPTPDSLGPGPSGADTPPSPS 126
              PS  P PS            SPP P+P    P P     PP PS
Sbjct: 333 PPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPS 379

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 36/98 (36%), Positives = 44/98 (44%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P+ PP   P+P   PP    PP   PP + PP + P P+ P P+  P + PP P P
Sbjct: 262 PPPPPSPPPPPPPSPPPPPPPRPPPP---PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 318

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              P + P PS    PP   P    P P     PP PS
Sbjct: 319 RPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPS 356

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 36/99 (36%), Positives = 45/99 (45%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           +P   P+ PP   P P    P   +PP  +PP  +PP   P P +P P   P   PP+P 
Sbjct: 337 SPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPP--PPPPSPPPPPPPRPPPPSPP 394

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P S P  +P P    SPP P P    P      +PP PS
Sbjct: 395 PPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPS 433

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 37/95 (38%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV----PAPATPAPASSPATSPPAPTP 240
           P+ PP + P P+  PP   +PP   PP+  PP       P P +P P S P  SPP P+P
Sbjct: 248 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSP 307

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
              PS  P P     PP+P P S  P P  +  PP
Sbjct: 308 -PPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPP 341

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 37/99 (37%), Positives = 46/99 (46%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P+ PP   P P   PP +  PP+  PP+  PP+  P P +P P   P   PP+P P
Sbjct: 270 PPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPPPPRPPPPSPPP 327

Query: 239 AS-TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S  P   P+P    SPP P P    P      +PP PS
Sbjct: 328 PSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPS 366

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 37/97 (38%), Positives = 42/97 (43%), Gaps = 2/97 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP   P     PP  + PP   P    PP   P P +P P S P  SPP P+P
Sbjct: 253 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 312

Query: 239 ASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPP 135
              P   P P +    SPP P P S  P PS    PP
Sbjct: 313 PPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPP 349

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 37/93 (39%), Positives = 43/93 (46%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTP 228
           P+ PP   P+P   PP  + PP   PP   PP   P P +P P S P  SPP P P S P
Sbjct: 328 PSPPPPPPPSP---PPPPSPPP---PPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 381

Query: 227 STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              P      SPP P+P    P P    +PP P
Sbjct: 382 PPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPP 414

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 36/100 (36%), Positives = 43/100 (43%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
           P  +P  P    P P   PP +  PP+  PP    P   P+P  P P   P  SP  P+P
Sbjct: 303 PPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSP 362

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P S P  +P P    SPP P P    P      +PP PS
Sbjct: 363 PPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPS 402

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 33/94 (35%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA-SSPATSPPAPTPAST 231
           P         P   PP  + PP + PP + PP + P P+ P P+   P+  PP+P P S 
Sbjct: 181 PLSQANVPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 240

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P  +P P    SPP P+P    P P    +PP P
Sbjct: 241 PPPSPPPP---SPPPPSPPPPSPPPPPPPSPPPP 271

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 35/91 (38%), Positives = 43/91 (47%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTA 219
           P +    P+  PP+   PP  +PP  +PP   P P +P P S P  SPP P+P   PS  
Sbjct: 181 PLSQANVPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPP 236

Query: 218 PTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P      SPP P+P    P P     PP PS
Sbjct: 237 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 267

[99][TOP]
>UniRef100_UPI0001982858 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982858
          Length = 238

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 43/96 (44%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = -3

Query: 422 APTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           +P ++PT  PP  +PAP   PP     P   PP   PP  VPAPATP PA +PA  PPAP
Sbjct: 65  SPASSPTVPPPQVSPAPVQAPPL----PAPAPPPPVPPPPVPAPATPPPAPAPAPPPPAP 120

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 138
            P   P T P P+    PPAP P  +   P+ A  P
Sbjct: 121 APVPVPPT-PAPAPVPVPPAPVPAPISEPPAPAPAP 155

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 54/143 (37%), Positives = 63/143 (44%), Gaps = 19/143 (13%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPP------AAATPPTATP 330
           MAS     +   L +L     AQAP A+P+  PT TP    QPP      A AT P A+P
Sbjct: 1   MASLMWACVSSCLFILVAIANAQAPAASPSVLPTPTPVAATQPPSTPVIPAPATTPVASP 60

Query: 329 ---------PTATPP----AAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPP 189
                    PT  PP    A V AP  PAPA  P   PP     +TP  AP P+     P
Sbjct: 61  SPKVSPASSPTVPPPQVSPAPVQAPPLPAPAPPPPVPPPPVPAPATPPPAPAPAPPPPAP 120

Query: 188 APTPDSLGPGPSGADTPPSPSAA 120
           AP P    P P+    PP+P  A
Sbjct: 121 APVPVPPTPAPAPVPVPPAPVPA 143

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 54/155 (34%), Positives = 67/155 (43%), Gaps = 30/155 (19%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPP--AAATPPTATPPTATPPAA--VPAPATPAPASSPA 264
           ++ AP  AP  P  A P P   PP  A ATPP A  P   PPA   VP P TPAPA  P 
Sbjct: 77  VSPAPVQAPPLPAPAPPPPVPPPPVPAPATPPPAPAPAPPPPAPAPVPVPPTPAPA--PV 134

Query: 263 TSPPAPTPA---STPSTAPTP------------------STAGSPPAPTPDSLGPGPSGA 147
             PPAP PA     P+ AP P                  + A +P  P+P +    P   
Sbjct: 135 PVPPAPVPAPISEPPAPAPAPTKHKHRRRRHKHKKHHHHAPAPAPVTPSPPAPPTVPEAE 194

Query: 146 DTPPSPSAAFS-----YSKPIIAATALSAALFAIA 57
           +T P+PS   +     Y +  +AA     AL  +A
Sbjct: 195 ETAPAPSPNLNGGIALYQQGGLAAMWARTALVLVA 229

[100][TOP]
>UniRef100_Q91GH4 Putative uncharacterized protein n=1 Tax=Epiphyas postvittana NPV
           RepID=Q91GH4_NPVEP
          Length = 234

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 49/109 (44%), Positives = 65/109 (59%), Gaps = 11/109 (10%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           PT +PT  PT +P P+  P  + TPP +  P+ TPP   P+P TP+P  SP T PP+PTP
Sbjct: 38  PTPSPTPLPTPSPTPSPSPTPSPTPPPSPTPSPTPP---PSP-TPSPTPSP-TPPPSPTP 92

Query: 239 ASTPSTAPTPSTAGSP-PAPTPD-----SLGPGPSGADTP-----PSPS 126
           + TPS  P+P+ + SP P+PTP      +L P PS   +P     PSPS
Sbjct: 93  SPTPSPTPSPTPSPSPLPSPTPSPTPSPTLWPTPSPTPSPTLWPTPSPS 141

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 48/105 (45%), Positives = 64/105 (60%), Gaps = 7/105 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP---PAAVPAPA-TPAPASSPATSP- 255
           PT +PT  P+ TP+PT  PP + TP    PP+ TP   P+  P P+ TP+P  SP  SP 
Sbjct: 46  PTPSPTPSPSPTPSPT--PPPSPTPSPTPPPSPTPSPTPSPTPPPSPTPSPTPSPTPSPT 103

Query: 254 PAPTPASTPSTAPTPS-TAGSPPAPTPD-SLGPGPSGADTPPSPS 126
           P+P+P  +P+ +PTPS T    P+PTP  +L P PS    PPSP+
Sbjct: 104 PSPSPLPSPTPSPTPSPTLWPTPSPTPSPTLWPTPS-PSPPPSPN 147

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 35/87 (40%), Positives = 52/87 (59%), Gaps = 1/87 (1%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSPPAP 246
           +PT  P+  P+ TP+PT  P    +P  +  P+ TP P+ +P+P TP+P  SP T  P P
Sbjct: 69  SPTPPPSPTPSPTPSPTPPPSPTPSPTPSPTPSPTPSPSPLPSP-TPSPTPSP-TLWPTP 126

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLG 165
           +P  +P+  PTPS +   P P+P+ LG
Sbjct: 127 SPTPSPTLWPTPSPS---PPPSPNPLG 150

[101][TOP]
>UniRef100_B2HSC2 Conserved hypothetical secreted protein n=1 Tax=Mycobacterium
           marinum M RepID=B2HSC2_MYCMM
          Length = 399

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 59/139 (42%), Positives = 64/139 (46%), Gaps = 22/139 (15%)
 Frame = -3

Query: 422 APTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATP------PAAVPAPATPAPASSPA 264
           AP AAP   PP + PAP A  PA+A P TA  P A P      PA  PA A PAPA +PA
Sbjct: 160 APVAAPAGAPPASAPAPAAAAPASA-PGTAPAPAAAPGPAPAAPAPAPAAAAPAPAPAPA 218

Query: 263 TSP------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSK- 105
             P      PAP PA  P+ AP P  A   PAP P        G D PP+    F Y   
Sbjct: 219 APPAAPVAAPAPVPAPAPAAAPAPEAAAPAPAPAPAPAAAPGFGPDAPPTQD--FMYPSI 276

Query: 104 --------PIIAATALSAA 72
                     I ATALS A
Sbjct: 277 GTNCLADGSNIIATALSVA 295

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 52/130 (40%), Positives = 64/130 (49%), Gaps = 8/130 (6%)
 Frame = -3

Query: 422 APTAAPTK--PPTATP-----APTAQPPAAATPPTATPPT-ATPPAAVPAPATPAPASSP 267
           AP AAP +  PP + P     AP A+P   A  P    P  A  PA V APA   PAS+P
Sbjct: 115 APAAAPVEVAPPASAPVPHVPAPGAEPGTLAHLPAGIDPAHAAGPAPVAAPAGAPPASAP 174

Query: 266 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAAT 87
           A  P A  PAS P TAP P+ A   P P P +  P P+ A   P+P+ A   + P+ A  
Sbjct: 175 A--PAAAAPASAPGTAPAPAAA---PGPAPAAPAPAPAAAAPAPAPAPAAPPAAPVAAPA 229

Query: 86  ALSAALFAIA 57
            + A   A A
Sbjct: 230 PVPAPAPAAA 239

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 48/109 (44%), Positives = 58/109 (53%), Gaps = 9/109 (8%)
 Frame = -3

Query: 419 PTAAPTKPPTATPA--PTAQPPA-AATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           P  A    P A PA  P A  PA AA  P + P TA  PAA P PA  APA +PA + PA
Sbjct: 153 PAHAAGPAPVAAPAGAPPASAPAPAAAAPASAPGTAPAPAAAPGPAPAAPAPAPAAAAPA 212

Query: 248 PTPA-----STPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPSPSAA 120
           P PA     + P  AP P  A +P  AP P++  P P+ A   P+P+AA
Sbjct: 213 PAPAPAAPPAAPVAAPAPVPAPAPAAAPAPEAAAPAPAPA---PAPAAA 258

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 43/92 (46%), Positives = 47/92 (51%), Gaps = 3/92 (3%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA---TPAPASSPATS 258
           A AP AAP   P A PAP    PAAA P  A  P A P A V APA    PAPA++PA  
Sbjct: 188 APAPAAAPGPAPAA-PAP---APAAAAPAPAPAPAAPPAAPVAAPAPVPAPAPAAAPAPE 243

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP 162
             AP PA  P+ A  P      P PT D + P
Sbjct: 244 AAAPAPAPAPAPAAAPGFGPDAP-PTQDFMYP 274

[102][TOP]
>UniRef100_A5USV4 Putative uncharacterized protein n=1 Tax=Roseiflexus sp. RS-1
           RepID=A5USV4_ROSS1
          Length = 548

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 54/118 (45%), Positives = 62/118 (52%), Gaps = 9/118 (7%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATP---PTATP---PTATPPAAVPAPATPAPASSPAT 261
           APTA PT PP  T  PT  P   ATP   PTATP   PTATP  A  A  TPAP ++P T
Sbjct: 420 APTATPTDPPAPTATPTDPPAPTATPTPAPTATPTPAPTATPTPAPTATPTPAPTATP-T 478

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPA--PTPDSLGPGPSGADT-PPSPSAAFSYSKPII 96
            PPAPT   T +  PTPS   +  A  PT    G  PSG  T  P+P+ +     P +
Sbjct: 479 DPPAPTATPTETLPPTPSITPTDEAGQPTVTPAGSEPSGMPTLTPTPAGSEPSGMPTL 536

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 54/125 (43%), Positives = 69/125 (55%), Gaps = 18/125 (14%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAAT----PPTATP--PTATP-PAAVPAPA-------TP 285
           +PTA P  PPTAT  P  +PP+A++    PPTA P  PTATP P   P  A        P
Sbjct: 372 SPTATP--PPTATRVPPTEPPSASSTPQPPPTARPPRPTATPRPTITPTSAPTATPTDPP 429

Query: 284 APASSPATSPPAP--TPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADT-PPSPSAAF 117
           AP ++P T PPAP  TP   P+  PTP+   +P PAPT     P P+   T PP+P+A  
Sbjct: 430 APTATP-TDPPAPTATPTPAPTATPTPAPTATPTPAPTATPT-PAPTATPTDPPAPTATP 487

Query: 116 SYSKP 102
           + + P
Sbjct: 488 TETLP 492

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 54/126 (42%), Positives = 68/126 (53%), Gaps = 12/126 (9%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAA--ATPPTATPPTATP--PAAVPAPATPAPA 276
           A+S     PTA P +P TATP PT  P +A  ATP     PTATP  P A  A  TPAP 
Sbjct: 392 ASSTPQPPPTARPPRP-TATPRPTITPTSAPTATPTDPPAPTATPTDPPAPTATPTPAPT 450

Query: 275 SSPATSP---PAPTPASTPSTAPTPSTAGSPPAPT---PDSLGPGPS--GADTPPSPSAA 120
           ++P  +P   P P P +TP+ APT +T   PPAPT    ++L P PS    D    P+  
Sbjct: 451 ATPTPAPTATPTPAPTATPTPAPT-ATPTDPPAPTATPTETLPPTPSITPTDEAGQPTVT 509

Query: 119 FSYSKP 102
            + S+P
Sbjct: 510 PAGSEP 515

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 49/115 (42%), Positives = 58/115 (50%), Gaps = 14/115 (12%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPA--PTAQPPAAATPPTATP-PTATPP-AAVPAPATPAPASS---- 270
           ++PTA P  PPT TP   PT   P     PT TP PTATPP  A   P T  P++S    
Sbjct: 338 RSPTATPPPPPTMTPTAPPTEASPTNTPLPTNTPSPTATPPPTATRVPPTEPPSASSTPQ 397

Query: 269 --PATSPPAPT----PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
             P   PP PT    P  TP++APT +T   PPAPT     P    A   P+P+A
Sbjct: 398 PPPTARPPRPTATPRPTITPTSAPT-ATPTDPPAPTATPTDPPAPTATPTPAPTA 451

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 51/114 (44%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATP--APTAQPPAAATPPTATP---PTATPPAAVPAPATPAP 279
           AT     APTA PT  PTATP  APTA P  A   PTATP   PTATP         PAP
Sbjct: 433 ATPTDPPAPTATPTPAPTATPTPAPTATPTPA---PTATPTPAPTATP------TDPPAP 483

Query: 278 ASSPATSPPAPTPASTPST---APTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            ++P  + P PTP+ TP+     PT + AGS P+  P +L P P+G++    P+
Sbjct: 484 TATPTETLP-PTPSITPTDEAGQPTVTPAGSEPSGMP-TLTPTPAGSEPSGMPT 535

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 45/114 (39%), Positives = 53/114 (46%), Gaps = 14/114 (12%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP-ATPAPASSPATSPPAPT 243
           P       P ATP PT++PP  +  P    PTA   +  PAP ATPAP S  AT PP PT
Sbjct: 293 PERVDAATPIATPPPTSRPPRPSPTPGQIEPTA---SNAPAPTATPAPRSPTATPPPPPT 349

Query: 242 -----------PASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPPSPSAA 120
                      P +TP    TPS   +PP PT   + P   PS + TP  P  A
Sbjct: 350 MTPTAPPTEASPTNTPLPTNTPSPTATPP-PTATRVPPTEPPSASSTPQPPPTA 402

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 45/129 (34%), Positives = 56/129 (43%), Gaps = 10/129 (7%)
 Frame = -3

Query: 428 AQAPTAAP---TKPPTATPAPTAQPPAA--ATPPTATP----PTATPPAAVPAPATPAPA 276
           A  P A P   ++PP  +P P    P A  A  PTATP    PTATPP       T  P 
Sbjct: 298 AATPIATPPPTSRPPRPSPTPGQIEPTASNAPAPTATPAPRSPTATPPPPPTMTPTAPPT 357

Query: 275 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPD-SLGPGPSGADTPPSPSAAFSYSKPI 99
            +  T+ P PT   +P+  P P+    PP   P  S  P P     PP P+A     +P 
Sbjct: 358 EASPTNTPLPTNTPSPTATPPPTATRVPPTEPPSASSTPQPPPTARPPRPTAT---PRPT 414

Query: 98  IAATALSAA 72
           I  T+   A
Sbjct: 415 ITPTSAPTA 423

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 42/102 (41%), Positives = 50/102 (49%), Gaps = 11/102 (10%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP---PTATP-----PTATPPAAVPAPATPAP---AS 273
           PT APT  PT  P  T  P   ATP   PTATP     PTATP   +P   +  P   A 
Sbjct: 445 PTPAPTATPTPAPTATPTPAPTATPTPAPTATPTDPPAPTATPTETLPPTPSITPTDEAG 504

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA 147
            P  +P    P+  P+  PTP  AGS P+  P +L P  +GA
Sbjct: 505 QPTVTPAGSEPSGMPTLTPTP--AGSEPSGMP-TLTPDDAGA 543

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 43/111 (38%), Positives = 53/111 (47%), Gaps = 12/111 (10%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAP---TAQPPAAAT-----PPTATPPTATP-PAAVPAP-ATPAPASS 270
           PTA+    PTATPAP   TA PP   T     PPT   PT TP P   P+P ATP P ++
Sbjct: 323 PTASNAPAPTATPAPRSPTATPPPPPTMTPTAPPTEASPTNTPLPTNTPSPTATPPPTAT 382

Query: 269 PATSPPAPTPASTPSTAPT--PSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
                  P+ +STP   PT  P    + P PT        +    PP+P+A
Sbjct: 383 RVPPTEPPSASSTPQPPPTARPPRPTATPRPTITPTSAPTATPTDPPAPTA 433

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 41/126 (32%), Positives = 57/126 (45%), Gaps = 18/126 (14%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPA--AATPPTATPPTATPPAAVPAP------ATPAPASS 270
           +APT      P A P    +P    AATP    PPT+ PP   P P      A+ APA +
Sbjct: 273 EAPTTVEITAPEAAPQTGREPERVDAATPIATPPPTSRPPRPSPTPGQIEPTASNAPAPT 332

Query: 269 PATSPPAPT------PASTPSTAPTPSTAGSPPAPT---PDSLGPGPSGADTPPS-PSAA 120
              +P +PT      P  TP+  PT ++  + P PT     +  P P+    PP+ P +A
Sbjct: 333 ATPAPRSPTATPPPPPTMTPTAPPTEASPTNTPLPTNTPSPTATPPPTATRVPPTEPPSA 392

Query: 119 FSYSKP 102
            S  +P
Sbjct: 393 SSTPQP 398

[103][TOP]
>UniRef100_B0C060 Putative uncharacterized protein n=1 Tax=Acaryochloris marina
           MBIC11017 RepID=B0C060_ACAM1
          Length = 541

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 53/121 (43%), Positives = 65/121 (53%), Gaps = 19/121 (15%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-----PAAVPAP---ATPAPASS 270
           +A   AP   P A PAPTA P   A  P + P T +P     P + PAP   A PAPA++
Sbjct: 366 RARQQAPAPAPAAAPAPTAAPVRPADTPVSVPRTPSPASAPAPISTPAPAPVAAPAPAAA 425

Query: 269 PATSP-PAPTPASTPSTAPTPSTAGSP-----PAPTPDSL-----GPGPSGADTPPSPSA 123
           PA++P PAPTPAS P+ AP P  A +P     PAP P S       P P  A  PP+P+ 
Sbjct: 426 PASAPVPAPTPASAPAAAPAPVPAPAPAPVAAPAPAPVSAPVPAPAPPPVPAYVPPAPAP 485

Query: 122 A 120
           A
Sbjct: 486 A 486

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 53/133 (39%), Positives = 66/133 (49%), Gaps = 15/133 (11%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSP- 255
           A AP + P   P A PAP A P +A  P PT     A  PA VPAPA PAP ++PA +P 
Sbjct: 405 APAPISTPAPAPVAAPAPAAAPASAPVPAPTPASAPAAAPAPVPAPA-PAPVAAPAPAPV 463

Query: 254 ------PAPTPAST---PSTAPTPSTAGSPPAPTPDSLGPGPSGAD----TPPSPSAAFS 114
                 PAP P      P+ AP P  A  PPAP P  + P P  A      PP+P+ A+ 
Sbjct: 464 SAPVPAPAPPPVPAYVPPAPAPAPVPAYVPPAPAPAYVPPAPVSAPVPAYVPPAPAPAYV 523

Query: 113 YSKPIIAATALSA 75
                ++A A +A
Sbjct: 524 PPPAPVSAPAPAA 536

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 52/133 (39%), Positives = 63/133 (47%), Gaps = 21/133 (15%)
 Frame = -3

Query: 428 AQAPTAAPTKP------------PTATPAPTAQP---PAAATPPTATPPTATPPAAVPAP 294
           A APTAAP +P            P + PAP + P   P AA  P A P +A  PA  PA 
Sbjct: 379 APAPTAAPVRPADTPVSVPRTPSPASAPAPISTPAPAPVAAPAPAAAPASAPVPAPTPAS 438

Query: 293 A---TPAPASSPATSP---PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
           A    PAP  +PA +P   PAP P S P  AP P      PA  P +  P P  A  PP+
Sbjct: 439 APAAAPAPVPAPAPAPVAAPAPAPVSAPVPAPAPPPV---PAYVPPAPAPAPVPAYVPPA 495

Query: 131 PSAAFSYSKPIIA 93
           P+ A+    P+ A
Sbjct: 496 PAPAYVPPAPVSA 508

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 44/105 (41%), Positives = 48/105 (45%), Gaps = 5/105 (4%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQP---PAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           A AP AAP   P   PAP A P   P +A  P   P    PP     P  PAPA  PA  
Sbjct: 437 ASAPAAAPAPVPAPAPAPVAAPAPAPVSAPVPAPAP----PPVPAYVPPAPAPAPVPAYV 492

Query: 257 PPAPTPAST-PSTAPTPSTAGSPPAPTPDSL-GPGPSGADTPPSP 129
           PPAP PA   P+    P  A  PPAP P  +  P P  A  P +P
Sbjct: 493 PPAPAPAYVPPAPVSAPVPAYVPPAPAPAYVPPPAPVSAPAPAAP 537

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 41/91 (45%), Positives = 45/91 (49%), Gaps = 7/91 (7%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPA--AATPPTATP---PTATPPAAVPAPATPAPASS-- 270
           A AP AAP   P + P P   PP   A  PP   P   P   PPA  PA   PAP S+  
Sbjct: 451 APAPVAAPAPAPVSAPVPAPAPPPVPAYVPPAPAPAPVPAYVPPAPAPAYVPPAPVSAPV 510

Query: 269 PATSPPAPTPASTPSTAPTPSTAGSPPAPTP 177
           PA  PPAP PA  P   P P +A +P AP P
Sbjct: 511 PAYVPPAPAPAYVP--PPAPVSAPAPAAPPP 539

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 48/121 (39%), Positives = 56/121 (46%), Gaps = 10/121 (8%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPTATP--PTATPPAAVPAPATPAPASSPATSPP 252
           +A   A  K   A     A  PAAA  PTA P  P  TP   V  P TP+PAS+PA   P
Sbjct: 355 RAQERAAAKARRARQQAPAPAPAAAPAPTAAPVRPADTP---VSVPRTPSPASAPA---P 408

Query: 251 APTPASTPSTAPTPSTAGSP---PAPTPDSL-----GPGPSGADTPPSPSAAFSYSKPII 96
             TPA  P  AP P+ A +    PAPTP S       P P+ A  P +  A    S P+ 
Sbjct: 409 ISTPAPAPVAAPAPAAAPASAPVPAPTPASAPAAAPAPVPAPAPAPVAAPAPAPVSAPVP 468

Query: 95  A 93
           A
Sbjct: 469 A 469

[104][TOP]
>UniRef100_Q3R162 Outer membrane autotransporter barrel n=1 Tax=Xylella fastidiosa
           subsp. sandyi Ann-1 RepID=Q3R162_XYLFA
          Length = 1055

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 54/130 (41%), Positives = 65/130 (50%), Gaps = 9/130 (6%)
 Frame = -3

Query: 452 GLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPA-TP 285
           GL+        PT  PT  PT TP PT  P    TP PT TP PT TP P   P P  TP
Sbjct: 28  GLVRIDTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP 87

Query: 284 APASSPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP---PSPSAA 120
            P  +P  +P P PTP  TP+  PTP+   +P P PTP    P P+   TP   P+P+  
Sbjct: 88  TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT-PTPTPTPTPTPTPTPTPT 146

Query: 119 FSYSKPIIAA 90
               +P +AA
Sbjct: 147 LPPLQPSLAA 156

[105][TOP]
>UniRef100_A8J1D8 Vegetative cell wall protein gp1 n=1 Tax=Chlamydomonas reinhardtii
           RepID=A8J1D8_CHLRE
          Length = 296

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 50/137 (36%), Positives = 71/137 (51%), Gaps = 1/137 (0%)
 Frame = -3

Query: 449 LLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
           L+       +  A P  PP +   PT   P + +PP+  PP+  P    PAP +PAP+  
Sbjct: 17  LMVVLAFVASANAHPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPP 76

Query: 269 PATSPPAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
           P+ +PP P+P+ +PS +P+PS + SP P+P+P  + P PS     P PS       P   
Sbjct: 77  PSPAPPTPSPSPSPSPSPSPSPSPSPSPSPSPSPI-PSPS-----PKPS-------PSPV 123

Query: 92  ATALSAALFAIAF*DLS 42
           A  L  A  AIAF DL+
Sbjct: 124 AVKLVWADDAIAFDDLN 140

[106][TOP]
>UniRef100_C6HS16 Actin associated protein Wsp1 n=1 Tax=Ajellomyces capsulatus H143
           RepID=C6HS16_AJECH
          Length = 610

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 49/116 (42%), Positives = 54/116 (46%), Gaps = 14/116 (12%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPP----TATPPTATPPAAVPAPA------TPAPASSPATS 258
           P  PPT+TPAP   PPA A  P    + TPP   PP   PAPA       P P   P T 
Sbjct: 397 PAPPPTSTPAPPPPPPAPAPGPAPSSSPTPPPPPPPLPAPAPAPASTGPVPPPPPPPTTG 456

Query: 257 PPAPTPASTPSTA----PTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P P P S PS +    P P + G+PP P P S G  P     PP  SAA S   P
Sbjct: 457 LPRPPPRSAPSNSVPPPPPPPSGGAPPPPPPPSAGAPPPPPPPPPPGSAANSAGPP 512

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 40/99 (40%), Positives = 49/99 (49%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPT--ATPPAAVPAPATPAPASSPATSPPAP 246
           P A P K P ATP P   PP     PT+TP +    PP  VP P    PA  P ++P  P
Sbjct: 351 PPALPPKIPHATPPP--PPPRPQASPTSTPQSQHLLPPQTVPVPLPVRPAPPPTSTPAPP 408

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P   P+  P PS++ +PP P P    P P+ A T P P
Sbjct: 409 PPPPAPAPGPAPSSSPTPPPPPPPLPAPAPAPASTGPVP 447

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 39/104 (37%), Positives = 47/104 (45%), Gaps = 3/104 (2%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS---PP 252
           AP+++PT PP   P P   P  A+T P   PP   PP     P  P P S+P+ S   PP
Sbjct: 419 APSSSPTPPPPPPPLPAPAPAPASTGPVPPPP---PPPTTGLP-RPPPRSAPSNSVPPPP 474

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            P     P   P PS    PP P P   G   + A  PP P A+
Sbjct: 475 PPPSGGAPPPPPPPSAGAPPPPPPPPPPGSAANSAGPPPPPPAS 518

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 48/120 (40%), Positives = 54/120 (45%), Gaps = 22/120 (18%)
 Frame = -3

Query: 422 APTAAPTK----PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP 255
           +PT+ P      PP   P P   P   A PPT+TP    PP A PAP  PAP+SSP T P
Sbjct: 373 SPTSTPQSQHLLPPQTVPVPL--PVRPAPPPTSTPAPPPPPPA-PAPG-PAPSSSP-TPP 427

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLG------------------PGPSGADTPPSP 129
           P P P   P+ AP  ST   PP P P + G                  P PSG   PP P
Sbjct: 428 PPPPPLPAPAPAPA-STGPVPPPPPPPTTGLPRPPPRSAPSNSVPPPPPPPSGGAPPPPP 486

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 46/158 (29%), Positives = 62/158 (39%), Gaps = 38/158 (24%)
 Frame = -3

Query: 428 AQAPTAAPTKP-PTATPAPTA---QPPAAATPPTATPPTATPPA-AVPAPATPAPASSPA 264
           A AP  A T P P   P PT    +PP  + P  + PP   PP+   P P  P  A +P 
Sbjct: 435 APAPAPASTGPVPPPPPPPTTGLPRPPPRSAPSNSVPPPPPPPSGGAPPPPPPPSAGAPP 494

Query: 263 TSPPAPTPASTPSTA---PTPSTAGSPPAPTPDSLG------------------------ 165
             PP P P S  ++A   P P  + + P+  P S G                        
Sbjct: 495 PPPPPPPPGSAANSAGPPPPPPASSARPSSLPKSPGNDDLLASIRAGTGLRKVKDSEKRD 554

Query: 164 ------PGPSGADTPPSPSAAFSYSKPIIAATALSAAL 69
                 PG S ++TP SP++    + P     +L AAL
Sbjct: 555 RSAAMVPGAS-SETPSSPASGAGSADPNSMLGSLQAAL 591

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 39/107 (36%), Positives = 44/107 (41%), Gaps = 1/107 (0%)
 Frame = -3

Query: 419 PTAAPTKPPTAT-PAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           P  AP   P +T P P   PP     P   PP + P  +VP P  P P S  A  PP P 
Sbjct: 432 PLPAPAPAPASTGPVPPPPPPPTTGLP-RPPPRSAPSNSVPPP--PPPPSGGAPPPPPPP 488

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            A  P   P P     PP    +S GP P     PP  S+A   S P
Sbjct: 489 SAGAPPPPPPP----PPPGSAANSAGPPP-----PPPASSARPSSLP 526

[107][TOP]
>UniRef100_A6R0R5 Predicted protein n=1 Tax=Ajellomyces capsulatus NAm1
           RepID=A6R0R5_AJECN
          Length = 765

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 52/125 (41%), Positives = 58/125 (46%), Gaps = 7/125 (5%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-- 255
           A  PT+AP  PP   PAP A  P  ++ PT  PP   PPA  PA   PAP   P   P  
Sbjct: 459 APPPTSAPAPPPPPPPAP-APGPVPSSSPTPPPPPPPPPAPAPASTGPAPPPPPPPPPTA 517

Query: 254 --PAPTPASTPSTA---PTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAA 90
             P P P   PS +   P P +AG+PP P P S G  P     PP  SAA S   P    
Sbjct: 518 GLPRPPPRPAPSNSVPPPPPPSAGAPPPPPPPSAGAPPPPPPPPPPGSAANSAGPPPPPP 577

Query: 89  TALSA 75
            A SA
Sbjct: 578 PASSA 582

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 48/116 (41%), Positives = 54/116 (46%), Gaps = 10/116 (8%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATP------PTATPPAAVPAPATPAPASSPATS 258
           P A P K P ATP P   PP     PT+TP      P  T P  +P    P P S+PA  
Sbjct: 412 PPALPPKIPHATPPPP--PPRPQASPTSTPQSQHLLPPQTAPGPLPVRPAPPPTSAPAPP 469

Query: 257 PPAP-TPA--STPSTAPT-PSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           PP P  PA    PS++PT P     PPAP P S GP P     PP P+A      P
Sbjct: 470 PPPPPAPAPGPVPSSSPTPPPPPPPPPAPAPASTGPAPP-PPPPPPPTAGLPRPPP 524

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 52/127 (40%), Positives = 58/127 (45%), Gaps = 27/127 (21%)
 Frame = -3

Query: 419 PTAAPTKPPTATP----------APTAQPPAAATPPTATPPTATPPAAVPAPAT-PAPAS 273
           P   P   PT+TP          AP   P   A PPT+ P  A PP   PAPA  P P+S
Sbjct: 427 PPPRPQASPTSTPQSQHLLPPQTAPGPLPVRPAPPPTSAP--APPPPPPPAPAPGPVPSS 484

Query: 272 SPA-----TSPPAPTPAST----PSTAPTPSTAG---SPPAPTPDSLGPGP----SGADT 141
           SP        PPAP PAST    P   P P TAG    PP P P +  P P    +GA  
Sbjct: 485 SPTPPPPPPPPPAPAPASTGPAPPPPPPPPPTAGLPRPPPRPAPSNSVPPPPPPSAGAPP 544

Query: 140 PPSPSAA 120
           PP P +A
Sbjct: 545 PPPPPSA 551

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 35/99 (35%), Positives = 42/99 (42%), Gaps = 4/99 (4%)
 Frame = -3

Query: 428 AQAPTAA-PTKPPTATPAPTA---QPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
           A AP +  P  PP   P PTA   +PP    P  + PP   P A  P P  P  A +P  
Sbjct: 497 APAPASTGPAPPPPPPPPPTAGLPRPPPRPAPSNSVPPPPPPSAGAPPPPPPPSAGAPPP 556

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
            PP P P S  ++A  P       +  P SL   P  AD
Sbjct: 557 PPPPPPPGSAANSAGPPPPPPPASSARPSSLPKSPGNAD 595

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 37/107 (34%), Positives = 45/107 (42%), Gaps = 18/107 (16%)
 Frame = -3

Query: 395 PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP------------- 255
           P+  P   A+   +   P A PP    P A P P  P P +SP ++P             
Sbjct: 395 PSRNPVLPARREVSPGLPPALPPKI--PHATPPPPPPRPQASPTSTPQSQHLLPPQTAPG 452

Query: 254 -----PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
                PAP P S P+  P P     PPAP P   GP PS + TPP P
Sbjct: 453 PLPVRPAPPPTSAPAPPPPP-----PPAPAP---GPVPSSSPTPPPP 491

[108][TOP]
>UniRef100_Q6VTQ5 Putative uncharacterized protein n=1 Tax=Choristoneura fumiferana
           DEF MNPV RepID=Q6VTQ5_NPVCD
          Length = 218

 Score = 84.0 bits (206), Expect = 7e-15
 Identities = 57/120 (47%), Positives = 69/120 (57%), Gaps = 6/120 (5%)
 Frame = -3

Query: 467 IFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATP---PTATPPAAVPA 297
           IFL L LLAT  L + P     +PPT +P P+  PP+   PPT +P   PT +P  +   
Sbjct: 14  IFLTLYLLAT--LKRVP-----EPPTPSPTPSPTPPSPTPPPTPSPTPSPTPSPTPSPTP 66

Query: 296 PATPAPASSPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
           P TP P  SP  SP P PTP  TPS  PTPS   SP P+PTP S  P P+ + TP PSP+
Sbjct: 67  PPTPLPTPSPTPSPTPPPTPLPTPS--PTPSPTPSPTPSPTP-SPTPPPTPSPTPTPSPT 123

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 41/88 (46%), Positives = 51/88 (57%), Gaps = 3/88 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPA-TPAPASSPATSP-PA 249
           PT +PT  PT +P P+  PP    P P+ TP    PP  +P P+ TP+P  SP  SP P+
Sbjct: 48  PTPSPTPSPTPSPTPSPTPPPTPLPTPSPTPSPTPPPTPLPTPSPTPSPTPSPTPSPTPS 107

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLG 165
           PTP  TPS  PTPS     P P+P+ LG
Sbjct: 108 PTPPPTPSPTPTPSPT---PPPSPEPLG 132

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 29/73 (39%), Positives = 37/73 (50%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           +PT +PT PPT  P P+  P    +P  +  P+ TPP   P P +P P  SP T PP+P 
Sbjct: 75  SPTPSPTPPPTPLPTPSPTPSPTPSPTPSPTPSPTPP---PTP-SPTPTPSP-TPPPSPE 129

Query: 242 PASTPSTAPTPST 204
           P   P   P   T
Sbjct: 130 PLGEPMYFPAEIT 142

[109][TOP]
>UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S9_EHV86
          Length = 621

 Score = 84.0 bits (206), Expect = 7e-15
 Identities = 38/98 (38%), Positives = 50/98 (51%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP  +PP + PP + P P +P P S P  SPP P+P
Sbjct: 347 PSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPS-PPPPSPPPPSPPPPSPPPPSP 405

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
                  P+P    SPP P+P    P P    +PP PS
Sbjct: 406 PPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPS 443

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 37/99 (37%), Positives = 51/99 (51%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA-SSPATSPPAPT 243
           P+  P  PP  +P P + PP +  PP+  PP  +PP + P P+ P P+   P+  PP+P 
Sbjct: 286 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 345

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P S P  +P P +   P  P P    P PS   +PP PS
Sbjct: 346 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPS 384

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 38/98 (38%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA-SSPATSPPAPT 243
           P+  P  PP  +P P + PP +  PP  +PP + PP + P P+ P P+   P+  PP+P 
Sbjct: 291 PSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 350

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P S P  +P P    SPP P+P    P P  +  PPSP
Sbjct: 351 PPSPPPPSPPPP---SPPPPSPPPPPPSPPPSPPPPSP 385

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 37/99 (37%), Positives = 51/99 (51%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP-APT 243
           P+  P  PP   P+P   PP  + PP + PP + PP + P P+ P P+  P + PP +P 
Sbjct: 306 PSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 365

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P S P   P+P  +  PP+P P S  P      +PP PS
Sbjct: 366 PPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 404

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 38/98 (38%), Positives = 51/98 (52%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPASSPATSPPAPT 243
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P +P  P P+  P+  PP+P 
Sbjct: 327 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPP 386

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P S P  +P P    SPP P+P    P P     PPSP
Sbjct: 387 PPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPPSP 421

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 38/98 (38%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA-SSPATSPPAPT 243
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P+   P+  PP+P 
Sbjct: 332 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPP 391

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P S P  +P P    SPP P+P    P P  +  PPSP
Sbjct: 392 PPSPPPPSPPPP---SPPPPSPPPPSPPPPPSPPPPSP 426

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 38/99 (38%), Positives = 52/99 (52%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT--SPPAP 246
           P+  P  PP   P+P   PP  + PP + PP + PP + P P+ P P+  P +   PP+P
Sbjct: 362 PSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSP 421

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P S P  +P P +  SPP P+P    P P  +  PPSP
Sbjct: 422 PPPSPPPPSPPPPSPPSPPPPSPPPPSP-PPPSPPPPSP 459

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 39/102 (38%), Positives = 51/102 (50%), Gaps = 4/102 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA----TPAPASSPATSPP 252
           P+  P  PP  +P P + PP   +PP + PP + PP + P P+    +P P S P  SPP
Sbjct: 352 PSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 411

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P+P   PS  P      SPP P+P S  P      +PP PS
Sbjct: 412 PPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPS 453

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 39/98 (39%), Positives = 52/98 (53%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 378 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP-PPPPSPPPPSPPPPSPPPPSP 436

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P  +P P +   PP+P P S  P      +PP PS
Sbjct: 437 PSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPS 473

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 39/98 (39%), Positives = 52/98 (53%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP + P P +P P S P  SPP+P P
Sbjct: 383 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPS-PPPPSPPPPSPPPPSPPSPPP 441

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P  +P P +   PP+P P S  P      +PP PS
Sbjct: 442 PSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPS 478

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 39/97 (40%), Positives = 50/97 (51%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P + P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P P
Sbjct: 317 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPPP 374

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           +  PS  P      SPP P+P    P P  +  PPSP
Sbjct: 375 SPPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 410

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 38/99 (38%), Positives = 51/99 (51%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP   P+P  P+P   P+  PP+P P
Sbjct: 227 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPP-PSPPPPSPPP 285

Query: 239 ASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPSP 129
            S P  +P P +    SPP P+P    P P     PPSP
Sbjct: 286 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSP 324

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 39/99 (39%), Positives = 52/99 (52%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
           P+  P  PP  +P P + PP +  PP+  PP  +PP + P P +P P S P  SP  P+P
Sbjct: 342 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPS-PPPPSPPPPSPPPPSPPPPSP 400

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P S P  +P P +   PP+P P S  P      +PPSP
Sbjct: 401 PPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSP 439

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 39/98 (39%), Positives = 51/98 (52%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           +P   P+ PP + P P+  PP+  +PP  +PP  +PP   P P +P P S P  SPP P+
Sbjct: 414 SPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 473

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P   PS  P      SPP P+P    P P  +  PPSP
Sbjct: 474 P-PPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 509

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 39/97 (40%), Positives = 49/97 (50%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P P
Sbjct: 261 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPPP 318

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           +  PS  P      SPP P+P    P P  +  PPSP
Sbjct: 319 SPPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 354

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 38/100 (38%), Positives = 51/100 (51%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA-SSPATSPPAPT 243
           P+  P  PP  +P P + PP +  PP+  PP+  PP   P P+ P P+   P+  PP+P 
Sbjct: 281 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPP 340

Query: 242 PASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPSP 129
           P S P  +P P +    SPP P+P    P P     PPSP
Sbjct: 341 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSP 380

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 37/104 (35%), Positives = 51/104 (49%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP---- 252
           P+  P  PP  +P P + PP   +PP + PP + PP + P P+ P P+  P + PP    
Sbjct: 296 PSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 355

Query: 251 --APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             +P P S P  +P P     PP+P P S  P      +PP PS
Sbjct: 356 PPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPS 399

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 38/98 (38%), Positives = 52/98 (53%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP + PP + P P +P P S P+  PP+P P
Sbjct: 388 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPS-PPPPSPPPPSPPSPPPPSPPP 446

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P  +P P +   PP+P P S  P      +PP PS
Sbjct: 447 PSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPS 483

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 38/98 (38%), Positives = 51/98 (52%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           PT  P  PP + P P+  PP+   PP+  PP+  PP+  P P+ P P   P+  PP+P P
Sbjct: 113 PTTPPPSPPPSQPPPSPPPPSPP-PPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPP 171

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P  +P P +   PP+P P S  P      +PP PS
Sbjct: 172 PSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPS 208

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 37/98 (37%), Positives = 48/98 (48%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 187 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 244

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
                  P+P     PP P P S  P      +PP PS
Sbjct: 245 PPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPS 282

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 37/98 (37%), Positives = 49/98 (50%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 192 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 249

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
                  P+P     PP+P P S  P      +PP PS
Sbjct: 250 PPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPS 287

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 37/98 (37%), Positives = 49/98 (50%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 197 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 254

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
                  P P  +  PP+P P S  P      +PP PS
Sbjct: 255 PPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 292

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 37/98 (37%), Positives = 49/98 (50%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 202 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 259

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              P     P  +  PP+P P S  P      +PP PS
Sbjct: 260 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 297

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 37/98 (37%), Positives = 49/98 (50%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P P
Sbjct: 207 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPPP 264

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             +P     P  +  PP+P P S  P      +PP PS
Sbjct: 265 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 302

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 38/97 (39%), Positives = 50/97 (51%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P + P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 256 PPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 313

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              P + P      SPP P+P    P P  +  PPSP
Sbjct: 314 PPPPPSPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 349

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 37/97 (38%), Positives = 48/97 (49%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P + P  PP+  P+P    P   +PP  +PP  +PP   P P +P P S P  SPP P+P
Sbjct: 310 PPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 369

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              P + P      SPP P+P    P P  +  PPSP
Sbjct: 370 PPPPPSPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 405

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 40/106 (37%), Positives = 51/106 (48%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 172 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 229

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
              PS  P      SPP P+P    P P     PP P +    S P
Sbjct: 230 PP-PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPP 274

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 39/97 (40%), Positives = 48/97 (49%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP   P P+  PP+   PP  +PP  +PP   P P +P P S P  SPP P+P
Sbjct: 252 PSPPPPSPPPPPPPPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 308

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
                  P PS   SPP P+P    P P  +  PPSP
Sbjct: 309 PPPSPPPPPPSPPPSPPPPSPPPPSP-PPPSPPPPSP 344

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 39/97 (40%), Positives = 48/97 (49%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP   PP  +PP   P P +P P S P  SPP P+P
Sbjct: 237 PSPPPPSPPPPSPPPPSPPPPSPPPP---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 293

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              PS  P      SPP P+P    P P  +  PPSP
Sbjct: 294 -PPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSP 329

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 37/98 (37%), Positives = 52/98 (53%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP + PP + PP + P P+ P+P   P+  PP+P P
Sbjct: 393 PSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSP-PPPSPPPPSPPP 451

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P  +P P +   PP+P P S  P      +PP PS
Sbjct: 452 PSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPS 488

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 37/98 (37%), Positives = 52/98 (53%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP  + PP + PP + PP + P+P  P+P   P+  PP+P P
Sbjct: 398 PSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSP-PPPSPPPPSPPP 456

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P  +P P +   PP+P P S  P      +PP PS
Sbjct: 457 PSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPS 493

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 41/106 (38%), Positives = 52/106 (49%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P  +P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 432 PPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 489

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
              PS  P      SPP P+P    P P     PPSP  +   S P
Sbjct: 490 PP-PSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPSPPPSHPPSHP 532

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 37/98 (37%), Positives = 51/98 (52%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P+ P P+  P   PP+P P
Sbjct: 212 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSPPPPPPPPSPPP 270

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P  +P P +   PP+P P S  P      +PP PS
Sbjct: 271 PSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPS 307

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 37/98 (37%), Positives = 51/98 (52%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P+ P P   P+  PP+P P
Sbjct: 217 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPPPPPSPPPPSPPP 275

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S P  +P P +   PP+P P S  P      +PP PS
Sbjct: 276 PSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPS 312

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 39/100 (39%), Positives = 49/100 (49%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT- 243
           P+  P  PP  +P P   PP+   PP  +PP  +PP   P P +P P S P  SPP P+ 
Sbjct: 247 PSPPPPSPPPPSPPPPPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 303

Query: 242 -PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P S P  +P P     PP+P P S  P      +PP PS
Sbjct: 304 PPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPS 343

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 37/99 (37%), Positives = 52/99 (52%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
           P+  P  PP  +P P + PP +  PP+  PP+  PP+   P+P  P+P   P + PP+P 
Sbjct: 266 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPP 325

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P S P  +P P +   PP+P P S  P      +PP PS
Sbjct: 326 PPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPS 363

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 37/99 (37%), Positives = 52/99 (52%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
           P+  P  PP  +P P + PP +  PP+  PP+  PP+   P+P  P P+  P+  PP+P 
Sbjct: 271 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPP 330

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P S P  +P P +   PP+P P S  P      +PP PS
Sbjct: 331 PPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPS 368

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 40/99 (40%), Positives = 52/99 (52%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
           P+  P+ PP + P P+  PP+   PP + PP + PP + P P+ P P S P  SP  P+P
Sbjct: 374 PSPPPSPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSP 431

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P S PS  P      SPP P+P    P P  +  PPSP
Sbjct: 432 PPPSPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 469

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 36/99 (36%), Positives = 49/99 (49%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA-SSPATSPPAPT 243
           P  +P  P    P P   PP  + PP + PP + PP + P P+ P P+   P+  PP+P 
Sbjct: 250 PPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 309

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P S P   P+P  +  PP+P P S  P      +PP PS
Sbjct: 310 PPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 348

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 39/97 (40%), Positives = 50/97 (51%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 162 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 219

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              PS  P      SPP P+P    P P  +  PPSP
Sbjct: 220 -PPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 254

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 39/97 (40%), Positives = 50/97 (51%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P + P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 152 PPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 209

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              PS  P      SPP P+P    P P  +  PPSP
Sbjct: 210 -PPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 244

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 38/107 (35%), Positives = 52/107 (48%), Gaps = 3/107 (2%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTA---TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP 267
           SC     T  P+ PP+    +P P + PP +  PP+  PP+  PP + P P  P     P
Sbjct: 108 SCYIPPTTPPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPP 167

Query: 266 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           +  PP+P P S P  +P P +   PP+P P S  P      +PP PS
Sbjct: 168 SPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPS 213

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 39/97 (40%), Positives = 49/97 (50%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP + PP   P P +P P S P  SPP P+P
Sbjct: 122 PSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPP--PPPPSPPPPSPPPPSPPPPSP 179

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              PS  P      SPP P+P    P P  +  PPSP
Sbjct: 180 -PPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 214

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 39/97 (40%), Positives = 49/97 (50%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP + PP   PP+  P P +P P S P  SPP P+P
Sbjct: 127 PSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPS--PPPPSPPPPSPPPPSPPPPSP 184

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              PS  P      SPP P+P    P P  +  PPSP
Sbjct: 185 -PPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 219

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 39/97 (40%), Positives = 49/97 (50%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP  + PP   PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 132 PSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 189

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              PS  P      SPP P+P    P P  +  PPSP
Sbjct: 190 -PPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 224

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 39/97 (40%), Positives = 49/97 (50%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 157 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 214

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              PS  P      SPP P+P    P P  +  PPSP
Sbjct: 215 -PPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 249

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 38/98 (38%), Positives = 48/98 (48%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           +P      PP  +P P+  PP   +PP  +PP  +PP   P P +P P S P  SPP P+
Sbjct: 307 SPPPPSPPPPPPSPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 363

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P       P PS   SPP P+P    P P  +  PPSP
Sbjct: 364 PPPPSPPPPPPSPPPSPPPPSPPPPSP-PPPSPPPPSP 400

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 39/97 (40%), Positives = 48/97 (49%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P   PP    PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 137 PSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 194

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              PS  P      SPP P+P    P P  +  PPSP
Sbjct: 195 -PPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 229

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/97 (39%), Positives = 47/97 (48%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P  +P  PP+  P P    P   +PP  +PP  +PP   P P +P P S P  SPP P+P
Sbjct: 145 PPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 204

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              PS  P      SPP P+P    P P  +  PPSP
Sbjct: 205 -PPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 239

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 39/99 (39%), Positives = 49/99 (49%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTA--TPPAAVPAPATPAPASSPATSPPAP 246
           P+  P  PP  +P P   PP  + PP + PP +  +PP   P P +P P S P  SPP P
Sbjct: 403 PSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPP 462

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           +P   PS  P      SPP P+P    P P  +  PPSP
Sbjct: 463 SP-PPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 499

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 36/99 (36%), Positives = 50/99 (50%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA-SSPATSPPAPT 243
           P + P   P   P+P   PP  + PP + PP + PP + P P+ P P+   P+  PP+P 
Sbjct: 141 PPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 200

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P S P  +P P +   PP+P P S  P      +PP PS
Sbjct: 201 PPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPS 238

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 38/94 (40%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTA-TPPTATPPAAVPAPATPAPASSPATSPPAPTPAST 231
           P+ PP  +P P + PP +  PP+  +PP  +PP   P P +P P S P  SPP P+P   
Sbjct: 413 PSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP-PP 471

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           PS  P      SPP P+P    P P  +  PPSP
Sbjct: 472 PSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSP 504

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 36/99 (36%), Positives = 49/99 (49%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA-SSPATSPPAPT 243
           P + P  P    P P   PP  + PP + PP + PP + P P+ P P+   P+  PP+P 
Sbjct: 146 PPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 205

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P S P  +P P +   PP+P P S  P      +PP PS
Sbjct: 206 PPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPS 243

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 35/97 (36%), Positives = 46/97 (47%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 447 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 504

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
                  P+P     PP+P P S  P       P  P
Sbjct: 505 PPPSPPPPSPPPPSPPPSP-PPSHPPSHPPMHPPMHP 540

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 33/89 (37%), Positives = 44/89 (49%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 462 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 519

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPS 153
             +P  +  PS     P   P  L P  S
Sbjct: 520 PPSPPPSHPPSHPPMHPPMHPPFLPPTTS 548

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 30/85 (35%), Positives = 42/85 (49%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P+ P P+  P + PP+P P
Sbjct: 467 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPSPPP 525

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLG 165
           +  PS  P       P  P   S G
Sbjct: 526 SHPPSHPPMHPPMHPPFLPPTTSTG 550

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 31/87 (35%), Positives = 42/87 (48%), Gaps = 2/87 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA--PATPAPASSPATSPPAP 246
           P+  P  PP  +P P + PP +  PP+  PP+  PP+  P   P +P P S P + PP  
Sbjct: 477 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP-SHPPSHPPMH 535

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLG 165
            P   P   PT ST  +    T  S+G
Sbjct: 536 PPMHPPFLPPTTSTGLNKTQITFISIG 562

[110][TOP]
>UniRef100_UPI0000E49610 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus
           purpuratus RepID=UPI0000E49610
          Length = 699

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 60/134 (44%), Positives = 69/134 (51%), Gaps = 17/134 (12%)
 Frame = -3

Query: 452 GLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPT--ATPPTATP---PAAVPAPAT 288
           G    S  A  P   P   P +TPA T     A TP T  AT P  TP   PA+ PA +T
Sbjct: 139 GSTPASTPASTPATTPASTPASTPASTPASTPATTPATTPATTPATTPATTPASTPA-ST 197

Query: 287 PA--PASSPATSP-------PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGAD 144
           PA  PAS+PAT+P       PA TPASTP+T P  + A +P   PA TP S  PG + A 
Sbjct: 198 PASTPASTPATTPATTPASTPASTPASTPATTPASTPATTPATTPASTPAST-PGTTPAS 256

Query: 143 TPPSPSAAFSYSKP 102
           TPPS  A    S P
Sbjct: 257 TPPSTPATTPASTP 270

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 56/128 (43%), Positives = 66/128 (51%), Gaps = 19/128 (14%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATP---PTATPPT--ATPPAAVPAP---ATPA--P 279
           A  P   P   P  TPA T     A+TP   P +TP T  AT PA+ PA    +TPA  P
Sbjct: 171 ATTPATTPATTPATTPATTPASTPASTPASTPASTPATTPATTPASTPASTPASTPATTP 230

Query: 278 ASSPATSP---PAPTPASTPSTAPT---PSTAGSPPAPTP---DSLGPGPSGADTPPSPS 126
           AS+PAT+P   PA TPASTP T P    PST  + PA TP    +  P  + A TPPS  
Sbjct: 231 ASTPATTPATTPASTPASTPGTTPASTPPSTPATTPASTPATTPATTPASTPATTPPSTP 290

Query: 125 AAFSYSKP 102
           A    + P
Sbjct: 291 ATTPATTP 298

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 53/119 (44%), Positives = 65/119 (54%), Gaps = 10/119 (8%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATP---PTATPPT--ATPPAAVPAPATPA--PASS 270
           A  P   P   P  TPA T     A+TP   P +TP +  AT PA  PA +TPA  PAS+
Sbjct: 167 ASTPATTPATTPATTPATTPATTPASTPASTPASTPASTPATTPATTPA-STPASTPAST 225

Query: 269 PATSP---PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           PAT+P   PA TPA+TP++ P  ST G+ PA TP S  P  + A TP +  A    S P
Sbjct: 226 PATTPASTPATTPATTPASTPA-STPGTTPASTPPST-PATTPASTPATTPATTPASTP 282

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 52/107 (48%), Positives = 61/107 (57%), Gaps = 10/107 (9%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPT--ATPPTATP---PAAVPA---PATPA--P 279
           A  P   P   P +TPA T     A+TP T  AT P +TP   P   PA   P+TPA  P
Sbjct: 207 ATTPATTPASTPASTPASTPATTPASTPATTPATTPASTPASTPGTTPASTPPSTPATTP 266

Query: 278 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 138
           AS+PAT+P A TPASTP+T P PST  + PA TP S  P  + A TP
Sbjct: 267 ASTPATTP-ATTPASTPATTP-PSTPATTPATTPAST-PATTPATTP 310

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 56/130 (43%), Positives = 69/130 (53%), Gaps = 21/130 (16%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATP---PTATPPT--ATPPAAVPAPATPA--PASS 270
           A  P   P   P  TPA T     A+TP   P +TPP+  AT PA+ PA  TPA  PAS+
Sbjct: 223 ASTPATTPASTPATTPATTPASTPASTPGTTPASTPPSTPATTPASTPA-TTPATTPAST 281

Query: 269 PATSP-------PAPTPASTPSTAP--TPSTA-----GSPPAPTPDSLGPGPSGADTPPS 132
           PAT+P       PA TPASTP+T P  TP+T+      + PA TP +  P  + A TP S
Sbjct: 282 PATTPPSTPATTPATTPASTPATTPATTPATSWCTTPATTPATTP-ATTPASTPATTPAS 340

Query: 131 PSAAFSYSKP 102
             A  S + P
Sbjct: 341 TPATTSATTP 350

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 53/111 (47%), Positives = 65/111 (58%), Gaps = 5/111 (4%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA--PASSPATSP--- 255
           P+ +P   P  TPA T     A+TP  +TP  AT PA+ PA +TPA  PAS+PAT+P   
Sbjct: 122 PSTSPATTPATTPASTPGSTPASTP-ASTP--ATTPASTPA-STPASTPASTPATTPATT 177

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           PA TPA+TP+T P  ST  S PA TP S  P  + A TP S  A+   S P
Sbjct: 178 PATTPATTPATTPA-STPASTPASTPAST-PATTPATTPASTPASTPASTP 226

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 53/123 (43%), Positives = 64/123 (52%), Gaps = 14/123 (11%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATP---PTATPPT--ATPPAAVPAPATPA--PASS 270
           A  P + P   P +TPA T     A+TP   P +TP T  A+ PA  PA  TPA  PAS+
Sbjct: 191 ASTPASTPASTPASTPATTPATTPASTPASTPASTPATTPASTPATTPA-TTPASTPAST 249

Query: 269 PATSP-------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSY 111
           P T+P       PA TPASTP+T P  +T  S PA TP S  P  + A TP S  A    
Sbjct: 250 PGTTPASTPPSTPATTPASTPATTPA-TTPASTPATTPPST-PATTPATTPASTPATTPA 307

Query: 110 SKP 102
           + P
Sbjct: 308 TTP 310

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 52/121 (42%), Positives = 64/121 (52%), Gaps = 12/121 (9%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP---PAAVPAPATPA--PASSPA 264
           A  P + P   P +TPA T     A+TP  A+ P +TP   PA  PA  TPA  PA++PA
Sbjct: 131 ATTPASTPGSTPASTPASTPATTPASTP--ASTPASTPASTPATTPA-TTPATTPATTPA 187

Query: 263 TSP-------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSK 105
           T+P       PA TPASTP+T P  +T  S PA TP S  P  + A TP +  A    S 
Sbjct: 188 TTPASTPASTPASTPASTPATTPA-TTPASTPASTPAST-PATTPASTPATTPATTPAST 245

Query: 104 P 102
           P
Sbjct: 246 P 246

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 55/138 (39%), Positives = 71/138 (51%), Gaps = 18/138 (13%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPT--ATPPAAVPAPA---TPA--PASS 270
           A  P   P   P +TPA T  P   AT P  TP +  AT PA  PA +   TPA  PA++
Sbjct: 267 ASTPATTPATTPASTPA-TTPPSTPATTPATTPASTPATTPATTPATSWCTTPATTPATT 325

Query: 269 PATSP---PAPTPASTPST--APTPSTA------GSPPAPTPDSLGPGPSGADTPPSPSA 123
           PAT+P   PA TPASTP+T  A TP+T+       + PA TP S  P  + A TP +  A
Sbjct: 326 PATTPASTPATTPASTPATTSATTPATSWCTSWCSTTPASTPAST-PATTPATTPATTPA 384

Query: 122 AFSYSKPIIAATALSAAL 69
           +   S P     +  A++
Sbjct: 385 STPASTPASTPASTPASI 402

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 50/116 (43%), Positives = 63/116 (54%), Gaps = 7/116 (6%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTA--TPPTATPPAAVPAPATPA--PASSPAT 261
           A  P   P   P  TPA T    +A TP T+  T   +T PA+ PA +TPA  PA++PAT
Sbjct: 323 ATTPATTPASTPATTPASTPATTSATTPATSWCTSWCSTTPASTPA-STPATTPATTPAT 381

Query: 260 SP---PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           +P   PA TPASTP++ P  S   + PA TP S  P  + A TP S  A+   S P
Sbjct: 382 TPASTPASTPASTPASTPA-SIPATTPASTPVST-PATTQATTPASTPASTPASTP 435

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 54/133 (40%), Positives = 64/133 (48%), Gaps = 23/133 (17%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTA---TPPT--ATPPAAVPAPATPA--PASS 270
           A  P + P   P  TPA T     A TP T+   TP T  AT PA  PA +TPA  PAS+
Sbjct: 283 ATTPPSTPATTPATTPASTPATTPATTPATSWCTTPATTPATTPATTPA-STPATTPAST 341

Query: 269 PATSP----------------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 138
           PAT+                 PA TPASTP+T P  +T  + PA TP S  P  + A TP
Sbjct: 342 PATTSATTPATSWCTSWCSTTPASTPASTPATTPA-TTPATTPASTPAST-PASTPASTP 399

Query: 137 PSPSAAFSYSKPI 99
            S  A    S P+
Sbjct: 400 ASIPATTPASTPV 412

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 52/131 (39%), Positives = 65/131 (49%), Gaps = 22/131 (16%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPT--ATPPTATP---PAAVPAPA---TPA--- 282
           A  P + P   P  TPA +     A TP T  AT P +TP   PA+ PA     TPA   
Sbjct: 295 ATTPASTPATTPATTPATSWCTTPATTPATTPATTPASTPATTPASTPATTSATTPATSW 354

Query: 281 --------PASSPATSP---PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
                   PAS+PA++P   PA TPA+TP++ P  ST  S PA TP S+ P  + A TP 
Sbjct: 355 CTSWCSTTPASTPASTPATTPATTPATTPASTPA-STPASTPASTPASI-PATTPASTPV 412

Query: 134 SPSAAFSYSKP 102
           S  A    + P
Sbjct: 413 STPATTQATTP 423

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 49/123 (39%), Positives = 64/123 (52%), Gaps = 14/123 (11%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATP---PTATPPT--ATPPAAVPAPATPA------ 282
           A  P + P   P  TPA T     A+TP   P +TP +  AT PA+ P  +TPA      
Sbjct: 364 ASTPASTPATTPATTPATTPASTPASTPASTPASTPASIPATTPASTPV-STPATTQATT 422

Query: 281 PASSPATSP---PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSY 111
           PAS+PA++P   PA TPASTP+T P  +T  S PA TP +   G +   TP +     S 
Sbjct: 423 PASTPASTPASTPATTPASTPATTPA-TTLASTPAATPGTTS-GTTQGTTPGTTPGTTSG 480

Query: 110 SKP 102
           + P
Sbjct: 481 TTP 483

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 49/119 (41%), Positives = 60/119 (50%), Gaps = 13/119 (10%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTA--TPPTATP---PAAVPAPATPA--PASSPAT 261
           P   P   P  TP  TA   +  TP T   T P  TP   PA  PA  TPA  P S+PA+
Sbjct: 86  PGTTPGTTPGTTPGTTAGTTSGTTPGTTPGTNPGTTPSTSPATTPA-TTPASTPGSTPAS 144

Query: 260 SP---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           +P   PA TPASTP++ P  + A +P   PA TP +  P  + A TP S  A+   S P
Sbjct: 145 TPASTPATTPASTPASTPASTPASTPATTPATTP-ATTPATTPATTPASTPASTPASTP 202

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 49/125 (39%), Positives = 65/125 (52%), Gaps = 8/125 (6%)
 Frame = -3

Query: 452 GLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA--P 279
           G  A +     P   P   P  TP+ T+     AT P +TP   + PA+ PA +TPA  P
Sbjct: 99  GTTAGTTSGTTPGTTPGTNPGTTPS-TSPATTPATTPASTP--GSTPASTPA-STPATTP 154

Query: 278 ASSPATSP---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPSPSAAF 117
           AS+PA++P   PA TPA+TP+T P  + A +P   PA TP S  P  + A TP +  A  
Sbjct: 155 ASTPASTPASTPASTPATTPATTPATTPATTPATTPASTPAST-PASTPASTPATTPATT 213

Query: 116 SYSKP 102
             S P
Sbjct: 214 PASTP 218

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 47/113 (41%), Positives = 60/113 (53%), Gaps = 16/113 (14%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATP---PTATPPT--ATPPAAVPAP---ATPA--P 279
           A  P + P   P +TPA T     A TP   P +TP T  AT PA+ PA    +TPA  P
Sbjct: 380 ATTPASTPASTPASTPASTPASIPATTPASTPVSTPATTQATTPASTPASTPASTPATTP 439

Query: 278 ASSPATSPP---APTPASTPSTAPTPSTAGSPPAPTPDSLG---PGPSGADTP 138
           AS+PAT+P    A TPA+TP T  + +T G+ P  TP +     PG +   TP
Sbjct: 440 ASTPATTPATTLASTPAATPGTT-SGTTQGTTPGTTPGTTSGTTPGTTPGTTP 491

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 50/127 (39%), Positives = 61/127 (48%), Gaps = 18/127 (14%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQ--------PPAAATPPTATPPT--ATPPAAVPAPATPA- 282
           A  P   P   P  T A T              A+ P +TP T  AT PA  PA +TPA 
Sbjct: 331 ASTPATTPASTPATTSATTPATSWCTSWCSTTPASTPASTPATTPATTPATTPA-STPAS 389

Query: 281 -PASSPATSP---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPSPSA 123
            PAS+PA++P   PA TPASTP + P  + A +P   PA TP S  P  + A TP +  A
Sbjct: 390 TPASTPASTPASIPATTPASTPVSTPATTQATTPASTPASTPAST-PATTPASTPATTPA 448

Query: 122 AFSYSKP 102
               S P
Sbjct: 449 TTLASTP 455

 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 47/125 (37%), Positives = 59/125 (47%), Gaps = 16/125 (12%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATP---PTATPPTATPPAAVPAPATPAP--ASSPA 264
           A  P   P   P +TPA T     A+TP   P +TP  AT PA+ PA  TPA   AS+PA
Sbjct: 400 ASIPATTPASTPVSTPATTQATTPASTPASTPASTP--ATTPASTPA-TTPATTLASTPA 456

Query: 263 TSP-----------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAF 117
            +P           P  TP +T  T P  +T G+ P  TP +  PG S A TP +  A  
Sbjct: 457 ATPGTTSGTTQGTTPGTTPGTTSGTTP-GTTPGTTPGTTPGTT-PGTSPATTPATTPATT 514

Query: 116 SYSKP 102
             + P
Sbjct: 515 PGTTP 519

 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 39/104 (37%), Positives = 50/104 (48%), Gaps = 2/104 (1%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPT-ATPPAAVPAPAT-PAPASSPATSP 255
           A  P   P   P  TPA T     AATP T +  T  T P   P   +   P ++P T+P
Sbjct: 432 ASTPATTPASTPATTPATTLASTPAATPGTTSGTTQGTTPGTTPGTTSGTTPGTTPGTTP 491

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
              TP +TP T+P  +T  + PA TP +  PG S A TP +  A
Sbjct: 492 -GTTPGTTPGTSPA-TTPATTPATTPGTT-PGTSPATTPATTPA 532

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 44/122 (36%), Positives = 52/122 (42%), Gaps = 5/122 (4%)
 Frame = -3

Query: 452 GLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA--P 279
           G  A +     P   P   P  TP  T       TP T    TA   +      TP   P
Sbjct: 59  GTTAGTTPGTTPGITPETTPGTTPGTTPGTTPGTTPGTTPGTTAGTTSGTTPGTTPGTNP 118

Query: 278 ASSPATSP---PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYS 108
            ++P+TSP   PA TPASTP + P  ST  S PA TP S  P  + A TP S  A    +
Sbjct: 119 GTTPSTSPATTPATTPASTPGSTPA-STPASTPATTPAST-PASTPASTPASTPATTPAT 176

Query: 107 KP 102
            P
Sbjct: 177 TP 178

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 52/142 (36%), Positives = 60/142 (42%), Gaps = 36/142 (25%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPT-------ATPPT--------------ATPPAAV 303
           P   P   P  TP  T       TP T        TP T              AT PA  
Sbjct: 74  PETTPGTTPGTTPGTTPGTTPGTTPGTTAGTTSGTTPGTTPGTNPGTTPSTSPATTPATT 133

Query: 302 PAP---ATPA--PASSPATSP-------PAPTPASTPSTAPTPSTAGSP---PAPTPDSL 168
           PA    +TPA  PAS+PAT+P       PA TPASTP+T P  + A +P   PA TP S 
Sbjct: 134 PASTPGSTPASTPASTPATTPASTPASTPASTPASTPATTPATTPATTPATTPATTPAST 193

Query: 167 GPGPSGADTPPSPSAAFSYSKP 102
            P  + A TP S  A    + P
Sbjct: 194 -PASTPASTPASTPATTPATTP 214

[111][TOP]
>UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2Z7_EHV86
          Length = 516

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 42/124 (33%), Positives = 61/124 (49%), Gaps = 8/124 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + P    +PP  +PP  +PP   P P +P P S P + PP+P+P
Sbjct: 70  PSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSP 129

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP--------SPSAAFSYSKPIIAATA 84
            S P  +P P +    P P P      PS + +PP        +PSA+ S   P I+ + 
Sbjct: 130 PSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSP 189

Query: 83  LSAA 72
            S+A
Sbjct: 190 PSSA 193

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 39/100 (39%), Positives = 53/100 (53%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP   P+P    P  + PP   PP+ +PP+  P P +P P S P  SPP+P P
Sbjct: 35  PSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPS--PPPPSPPPPSPPPPSPPSPPP 92

Query: 239 ASTPSTAPTPS---TAGSPPAPTPDSLGPGPSGADTPPSP 129
           +  P + P PS    +  PP+P P S  P P  + +PPSP
Sbjct: 93  SPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSP 132

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 43/116 (37%), Positives = 58/116 (50%), Gaps = 1/116 (0%)
 Frame = -3

Query: 473 VQIFLI-LGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA 297
           + IF+I + +L     A  P+  P  PP  +P P + PP     P  +PP  +PP + P 
Sbjct: 1   MNIFMIFVVILCGGAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPP 60

Query: 296 PATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P  P   S P+  PP+P P S P  +P PS   SPP P+P    P P  +  PPSP
Sbjct: 61  PLPPPSPSPPSPPPPSPPPPSPPPPSP-PSPPPSPPPPSPPPPSP-PPPSPPPPSP 114

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 39/97 (40%), Positives = 53/97 (54%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P + P   P  +P+P + PP +  PP+  PP+   P   P P +P P S P  SPP P+P
Sbjct: 55  PPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSP 114

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              PS  P+P  + SPP+P P S  P PS + +PP P
Sbjct: 115 -PPPSPPPSPPPSPSPPSPPPPS-PPPPSISPSPPPP 149

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 45/127 (35%), Positives = 63/127 (49%), Gaps = 20/127 (15%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-------PAAVPAPATPAPASSPA 264
           +P + P  PP  +P P + PP +  PP+  PP+  P       P + P P+ P P+ SP+
Sbjct: 86  SPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPS 145

Query: 263 TSPPAP----TPASTPSTAP-------TPSTAGSPPAPTPDSLGPGP--SGADTPPSPSA 123
             PP P     P+++PS  P        PS + SPP   P S+ P P  S + TPP PSA
Sbjct: 146 PPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPP---PPSISPSPPSSASPTPPPPSA 202

Query: 122 AFSYSKP 102
           + S   P
Sbjct: 203 SPSPPPP 209

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 39/108 (36%), Positives = 56/108 (51%), Gaps = 2/108 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P+  P + P P+  PP+   P   +PP + PP + P P +P P S P  SPP P+P
Sbjct: 61  PLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPS-PPPPSPPPPSPPPPSPPPPSP 119

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP--PSPSAAFSYSKP 102
             +P  +P+P +   PP+P P S+ P P     P   +PSA+ S   P
Sbjct: 120 PPSPPPSPSPPSP-PPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPP 166

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 40/98 (40%), Positives = 57/98 (58%), Gaps = 1/98 (1%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSPPA 249
           QAP+A+P+ PP   P P  Q P+A+  P+  PP+ +P P +  +P  P P++SP+  PP+
Sbjct: 155 QAPSASPSPPP--PPPPWWQAPSAS--PSPPPPSISPSPPSSASPTPPPPSASPSPPPPS 210

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           P P S P   P P     PP P+P S  P PS + +PP
Sbjct: 211 PPPPSPPPPPPPP----PPPPPSPPSPNPPPSASPSPP 244

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 42/132 (31%), Positives = 60/132 (45%), Gaps = 26/132 (19%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATP------APASSPATS 258
           P  +P  P    P+P   PP + +PP+  PP+  PP+  P+P  P      AP++SP+  
Sbjct: 105 PPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPP 164

Query: 257 PPAP----TPASTPS----------------TAPTPSTAGSPPAPTPDSLGPGPSGADTP 138
           PP P     P+++PS                T P PS + SPP P+P    P P     P
Sbjct: 165 PPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPP 224

Query: 137 PSPSAAFSYSKP 102
           P P +  S + P
Sbjct: 225 PPPPSPPSPNPP 236

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 40/98 (40%), Positives = 55/98 (56%), Gaps = 6/98 (6%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           QAP+A+P+ PP   P+ +  PP++A+ PT  PP+A+P  + P P+ P P+  P   PP P
Sbjct: 172 QAPSASPSPPP---PSISPSPPSSAS-PTPPPPSASP--SPPPPSPPPPSPPPPPPPPPP 225

Query: 245 TPASTPSTAPTPSTAGSPP------APTPDSLGPGPSG 150
            P S PS  P PS + SPP      +P P    P P G
Sbjct: 226 PPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPPPPG 263

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 35/90 (38%), Positives = 48/90 (53%), Gaps = 2/90 (2%)
 Frame = -3

Query: 389 ATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSPPAPTPASTPSTAPT 213
           A   P + PP +  PP+  PP+  P P  +P P+ P P+  P+  PP P P+ +P + P 
Sbjct: 15  AYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPP 74

Query: 212 PS-TAGSPPAPTPDSLGPGPSGADTPPSPS 126
           PS    SPP P+P S  P P    +PP PS
Sbjct: 75  PSPPPPSPPPPSPPSPPPSPP-PPSPPPPS 103

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 9/110 (8%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPP-------AAATPPTATPPTATPPAAVPAPATPAPASSP- 267
           +P      PP+ +P+P   PP       A+ +PP   PP    P+A P+P  P+ + SP 
Sbjct: 131 SPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPP 190

Query: 266 -ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            + SP  P P+++PS  P      SPP P P    P PS     P PSA+
Sbjct: 191 SSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSAS 240

[112][TOP]
>UniRef100_Q3JTY3 Putative uncharacterized protein n=1 Tax=Burkholderia pseudomallei
           1710b RepID=Q3JTY3_BURP1
          Length = 602

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 55/132 (41%), Positives = 76/132 (57%), Gaps = 4/132 (3%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
           T+  A APT A    P +TPAP A  P  A+ PT TP +A  PA++PA   PAPAS+PA+
Sbjct: 405 TAASAPAPTPASAPAPASTPAP-ASAPTPASAPTPTPASAPTPASIPA---PAPASAPAS 460

Query: 260 SPPAPTPASTPSTAPTPSTAGSP-PAPTPD---SLGPGPSGADTPPSPSAAFSYSKPIIA 93
           +   P PASTP+ A  P+ A +P PAPT +   S+ P  +   +   P+ A  ++  + A
Sbjct: 461 T---PAPASTPAPASAPAPASAPAPAPTTNPASSIAPAAAPFASAIPPARAEKFAPAVTA 517

Query: 92  ATALSAALFAIA 57
            TA SA+  A A
Sbjct: 518 TTAGSASTPASA 529

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 61/157 (38%), Positives = 78/157 (49%), Gaps = 10/157 (6%)
 Frame = -3

Query: 497 PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPT--ATPAPT-----AQPPAAATPPT 339
           P  ASSAA        + A +     P A+    P   A PAP      A  P AA+ P 
Sbjct: 352 PVPASSAAPGTSASSAVAAPAAAGSGPAASAPAAPVRHAAPAPASATAAASAPTAASAPA 411

Query: 338 ATPPTATPPAAVPAPAT-PAPASSPATSPP-APTPASTPSTAPTPSTAGSP-PAPTPDSL 168
            TP +A  PA+ PAPA+ P PAS+P  +P  APTPAS P+ AP  + A +P PA T    
Sbjct: 412 PTPASAPAPASTPAPASAPTPASAPTPTPASAPTPASIPAPAPASAPASTPAPAST---- 467

Query: 167 GPGPSGADTPPSPSAAFSYSKPIIAATALSAALFAIA 57
            P P+ A  P S  A    + P  ++ A +AA FA A
Sbjct: 468 -PAPASAPAPASAPAPAPTTNP-ASSIAPAAAPFASA 502

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 47/120 (39%), Positives = 61/120 (50%), Gaps = 6/120 (5%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPPAAATPPTATP------PTATPPAAVPAPATPAPASSPATSPP 252
           AAPT P    PA +A P  +A+   A P      P A+ PAA    A PAPAS+ A +  
Sbjct: 344 AAPTPPAAPVPASSAAPGTSASSAVAAPAAAGSGPAASAPAAPVRHAAPAPASATAAAS- 402

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
           APT AS P  APTP++A +P +    +  P P+ A TP   SA    S P  A  +  A+
Sbjct: 403 APTAASAP--APTPASAPAPASTPAPASAPTPASAPTPTPASAPTPASIPAPAPASAPAS 460

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 49/131 (37%), Positives = 68/131 (51%), Gaps = 12/131 (9%)
 Frame = -3

Query: 428 AQAPTAAPTKPPT-ATPAPTAQP-PAAATPP--TATPPTATPPAAVPAPATPAPASSPAT 261
           A+    AP K  T A P P A P PA++  P  +A+   A P AA   PA  APA+    
Sbjct: 330 AETAEGAPMKLKTPAAPTPPAAPVPASSAAPGTSASSAVAAPAAAGSGPAASAPAAPVRH 389

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSL-----GPGPSGADTP---PSPSAAFSYSK 105
           + PAP  A+  ++APT ++A   PAPTP S       P P+ A TP   P+P+ A + + 
Sbjct: 390 AAPAPASATAAASAPTAASA---PAPTPASAPAPASTPAPASAPTPASAPTPTPASAPTP 446

Query: 104 PIIAATALSAA 72
             I A A ++A
Sbjct: 447 ASIPAPAPASA 457

[113][TOP]
>UniRef100_C6TXZ0 Putative lipoprotein n=1 Tax=Burkholderia pseudomallei 1710a
           RepID=C6TXZ0_BURPS
          Length = 474

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 55/132 (41%), Positives = 76/132 (57%), Gaps = 4/132 (3%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
           T+  A APT A    P +TPAP A  P  A+ PT TP +A  PA++PA   PAPAS+PA+
Sbjct: 277 TAASAPAPTPASAPAPASTPAP-ASAPTPASAPTPTPASAPTPASIPA---PAPASAPAS 332

Query: 260 SPPAPTPASTPSTAPTPSTAGSP-PAPTPD---SLGPGPSGADTPPSPSAAFSYSKPIIA 93
           +   P PASTP+ A  P+ A +P PAPT +   S+ P  +   +   P+ A  ++  + A
Sbjct: 333 T---PAPASTPAPASAPAPASAPAPAPTTNPASSIAPAAAPFASAIPPARAEKFAPAVTA 389

Query: 92  ATALSAALFAIA 57
            TA SA+  A A
Sbjct: 390 TTAGSASTPASA 401

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 61/157 (38%), Positives = 78/157 (49%), Gaps = 10/157 (6%)
 Frame = -3

Query: 497 PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPT--ATPAPT-----AQPPAAATPPT 339
           P  ASSAA        + A +     P A+    P   A PAP      A  P AA+ P 
Sbjct: 224 PVPASSAAPGTSASSAVAAPAAAGSGPAASAPAAPVRHAAPAPASATAAASAPTAASAPA 283

Query: 338 ATPPTATPPAAVPAPAT-PAPASSPATSPP-APTPASTPSTAPTPSTAGSP-PAPTPDSL 168
            TP +A  PA+ PAPA+ P PAS+P  +P  APTPAS P+ AP  + A +P PA T    
Sbjct: 284 PTPASAPAPASTPAPASAPTPASAPTPTPASAPTPASIPAPAPASAPASTPAPAST---- 339

Query: 167 GPGPSGADTPPSPSAAFSYSKPIIAATALSAALFAIA 57
            P P+ A  P S  A    + P  ++ A +AA FA A
Sbjct: 340 -PAPASAPAPASAPAPAPTTNP-ASSIAPAAAPFASA 374

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 47/120 (39%), Positives = 61/120 (50%), Gaps = 6/120 (5%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPPAAATPPTATP------PTATPPAAVPAPATPAPASSPATSPP 252
           AAPT P    PA +A P  +A+   A P      P A+ PAA    A PAPAS+ A +  
Sbjct: 216 AAPTPPAAPVPASSAAPGTSASSAVAAPAAAGSGPAASAPAAPVRHAAPAPASATAAAS- 274

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
           APT AS P  APTP++A +P +    +  P P+ A TP   SA    S P  A  +  A+
Sbjct: 275 APTAASAP--APTPASAPAPASTPAPASAPTPASAPTPTPASAPTPASIPAPAPASAPAS 332

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 49/131 (37%), Positives = 68/131 (51%), Gaps = 12/131 (9%)
 Frame = -3

Query: 428 AQAPTAAPTKPPT-ATPAPTAQP-PAAATPP--TATPPTATPPAAVPAPATPAPASSPAT 261
           A+    AP K  T A P P A P PA++  P  +A+   A P AA   PA  APA+    
Sbjct: 202 AETAEGAPMKLKTPAAPTPPAAPVPASSAAPGTSASSAVAAPAAAGSGPAASAPAAPVRH 261

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSL-----GPGPSGADTP---PSPSAAFSYSK 105
           + PAP  A+  ++APT ++A   PAPTP S       P P+ A TP   P+P+ A + + 
Sbjct: 262 AAPAPASATAAASAPTAASA---PAPTPASAPAPASTPAPASAPTPASAPTPTPASAPTP 318

Query: 104 PIIAATALSAA 72
             I A A ++A
Sbjct: 319 ASIPAPAPASA 329

[114][TOP]
>UniRef100_C0YBK6 Putative lipoprotein n=1 Tax=Burkholderia pseudomallei Pakistan 9
           RepID=C0YBK6_BURPS
          Length = 459

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 55/132 (41%), Positives = 76/132 (57%), Gaps = 4/132 (3%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
           T+  A APT A    P +TPAP A  P  A+ PT TP +A  PA++PA   PAPAS+PA+
Sbjct: 259 TAASAPAPTPASAPAPASTPAP-ASAPTPASAPTPTPASAPTPASIPA---PAPASAPAS 314

Query: 260 SPPAPTPASTPSTAPTPSTAGSP-PAPTPD---SLGPGPSGADTPPSPSAAFSYSKPIIA 93
           +   P PASTP+ A  P+ A +P PAPT +   S+ P  +   +   P+ A  ++  + A
Sbjct: 315 T---PAPASTPAPASAPAPASAPAPAPTTNPASSIAPAAAPFASAIPPARAEKFAPAVTA 371

Query: 92  ATALSAALFAIA 57
            TA SA+  A A
Sbjct: 372 TTAGSASTPASA 383

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 62/157 (39%), Positives = 79/157 (50%), Gaps = 10/157 (6%)
 Frame = -3

Query: 497 PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPT--ATPAPT-----AQPPAAATPPT 339
           P  ASSAA        + A +     PTA+    P   A PAP      A  P AA+ P 
Sbjct: 206 PVPASSAAPGASASSAVAAPAAAGSGPTASAPAAPVRHAAPAPASATAAASAPTAASAPA 265

Query: 338 ATPPTATPPAAVPAPAT-PAPASSPATSPP-APTPASTPSTAPTPSTAGSP-PAPTPDSL 168
            TP +A  PA+ PAPA+ P PAS+P  +P  APTPAS P+ AP  + A +P PA T    
Sbjct: 266 PTPASAPAPASTPAPASAPTPASAPTPTPASAPTPASIPAPAPASAPASTPAPAST---- 321

Query: 167 GPGPSGADTPPSPSAAFSYSKPIIAATALSAALFAIA 57
            P P+ A  P S  A    + P  ++ A +AA FA A
Sbjct: 322 -PAPASAPAPASAPAPAPTTNP-ASSIAPAAAPFASA 356

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 56/136 (41%), Positives = 65/136 (47%), Gaps = 23/136 (16%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPPAAATPPTATP------PTATPPAAVPAPATPAPASS------ 270
           AAPT P    PA +A P A+A+   A P      PTA+ PAA    A PAPAS+      
Sbjct: 198 AAPTPPAAPVPASSAAPGASASSAVAAPAAAGSGPTASAPAAPVRHAAPAPASATAAASA 257

Query: 269 -PATSPPAPTPASTPSTAPTPSTAGSP-----PAPTPDSLG-----PGPSGADTPPSPSA 123
             A S PAPTPAS P+ A TP+ A +P     P PTP S       P P+ A  P S  A
Sbjct: 258 PTAASAPAPTPASAPAPASTPAPASAPTPASAPTPTPASAPTPASIPAPAPASAPASTPA 317

Query: 122 AFSYSKPIIAATALSA 75
             S   P  A    SA
Sbjct: 318 PASTPAPASAPAPASA 333

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 50/139 (35%), Positives = 69/139 (49%), Gaps = 15/139 (10%)
 Frame = -3

Query: 428 AQAPTAAP--TKPPTATPAPTAQPPAAATP---PTATPPTATPPAAVPAPATPAPAS--- 273
           A AP +AP  T  P +TPAP + P  A+ P   PT  P ++  PAA P  +   PA    
Sbjct: 305 APAPASAPASTPAPASTPAPASAPAPASAPAPAPTTNPASSIAPAAAPFASAIPPARAEK 364

Query: 272 -SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPPSPSAAFSYSKP 102
            +PA +      ASTP++A  PS+  SP +P+   L P   P  +   PSP A  + + P
Sbjct: 365 FAPAVTATTAGSASTPASAAAPSSPSSPSSPSSPWLPPLLPPLLSPDAPSPPADTARTAP 424

Query: 101 II----AATALSAALFAIA 57
           +      ATA +AA  A A
Sbjct: 425 LAPAASPATAAAAATNATA 443

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 53/134 (39%), Positives = 66/134 (49%), Gaps = 15/134 (11%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           A+    AP K  T   APT  PPAA  P ++  P A+  +AV APA  A  S P  S PA
Sbjct: 184 AETAEGAPMKLKTPA-APT--PPAAPVPASSAAPGASASSAVAAPA--AAGSGPTASAPA 238

Query: 248 -------PTPASTPSTAPTPSTAGSPPAPTPDSL-----GPGPSGADTP---PSPSAAFS 114
                  P PAS  + A  P TA S PAPTP S       P P+ A TP   P+P+ A +
Sbjct: 239 APVRHAAPAPASATAAASAP-TAASAPAPTPASAPAPASTPAPASAPTPASAPTPTPASA 297

Query: 113 YSKPIIAATALSAA 72
            +   I A A ++A
Sbjct: 298 PTPASIPAPAPASA 311

[115][TOP]
>UniRef100_B8A6X3 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8A6X3_ORYSI
          Length = 775

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 55/134 (41%), Positives = 71/134 (52%), Gaps = 9/134 (6%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPA---AATPPTATPPTATPPAAVPA--PATPAPASSPA 264
           A+AP+   T P  ATPA  A PPA   +++P T   P   PP   PA  PA   P+S PA
Sbjct: 308 ARAPSQR-TPPTPATPAKAASPPATNSSSSPRTPAAPAPRPPQPPPATSPAPTKPSSPPA 366

Query: 263 T---SPPAPTPASTPSTAPTPSTAGSPPAPTPDSL-GPGPSGADTPPSPSAAFSYSKPII 96
               SPPAP+P++TPS+ P P  +  PPA TP +   P PS   +PP+P    S S    
Sbjct: 367 PKPPSPPAPSPSTTPSSPPAPKPSSPPPAATPTTKPSPPPS---SPPAPKTVSSSSSSDA 423

Query: 95  AATALSAALFAIAF 54
            ATA  +    I+F
Sbjct: 424 TATAAGSGTETISF 437

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 42/112 (37%), Positives = 60/112 (53%), Gaps = 1/112 (0%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
           +S   + P A   +PP   PA +  P   ++PP   PP  +PPA  P+P+T  P+S PA 
Sbjct: 333 SSSSPRTPAAPAPRPPQPPPATSPAPTKPSSPPAPKPP--SPPA--PSPST-TPSSPPAP 387

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAP-TPDSLGPGPSGADTPPSPSAAFSYS 108
            P +P PA+TP+T P+P  + SPPAP T  S     + A    S +   S+S
Sbjct: 388 KPSSPPPAATPTTKPSPPPS-SPPAPKTVSSSSSSDATATAAGSGTETISFS 438

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 44/112 (39%), Positives = 57/112 (50%), Gaps = 26/112 (23%)
 Frame = -3

Query: 359 AAATPPTATPPTATP-PAA--------------VPAPATPAPASSP-----ATSP----- 255
           AA +  ++ PP+++P PAA               P PATPA A+SP     ++SP     
Sbjct: 283 AAGSGSSSQPPSSSPAPAASSATPAARAPSQRTPPTPATPAKAASPPATNSSSSPRTPAA 342

Query: 254 PAPTPAS-TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           PAP P    P+T+P P+   SPPAP P S  P PS + TP SP A    S P
Sbjct: 343 PAPRPPQPPPATSPAPTKPSSPPAPKPPS-PPAPSPSTTPSSPPAPKPSSPP 393

[116][TOP]
>UniRef100_B6SXS9 Receptor protein kinase PERK1 n=1 Tax=Zea mays RepID=B6SXS9_MAIZE
          Length = 689

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 54/128 (42%), Positives = 68/128 (53%), Gaps = 21/128 (16%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-----------AVP 300
           +++   A APTA P  P  AT  P A P  +A+PPT TPP  TPP            +VP
Sbjct: 1   MSSPTAAPAPTAPPAPPANATIPPPATP--SASPPTPTPPKPTPPPPAPSAPPPSSPSVP 58

Query: 299 APATPA-----PASSPAT----SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS-G 150
            PATPA     P+S+PAT    SP +P+  +TP+T   PS   SPP+ TP      PS  
Sbjct: 59  PPATPAVSPPSPSSTPATPSAPSPSSPSSPATPATPSPPSDTPSPPSDTPSPPSDTPSPP 118

Query: 149 ADTPPSPS 126
           +DTP  PS
Sbjct: 119 SDTPSPPS 126

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 44/106 (41%), Positives = 57/106 (53%), Gaps = 3/106 (2%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATP-APASSPATSPP 252
           A  PT  P KP    PAP+A PP++ + P    P  +PP+    PATP AP+ S  +SP 
Sbjct: 30  ASPPTPTPPKPTPPPPAPSAPPPSSPSVPPPATPAVSPPSPSSTPATPSAPSPSSPSSPA 89

Query: 251 APTPASTPSTAPT-PSTAGSPPAPTPDSLGPGPS-GADTPPSPSAA 120
            P   S PS  P+ PS   SPP+ TP      PS  +DTP  PS++
Sbjct: 90  TPATPSPPSDTPSPPSDTPSPPSDTPSPPSDTPSPPSDTPSPPSSS 135

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 43/99 (43%), Positives = 53/99 (53%), Gaps = 1/99 (1%)
 Frame = -3

Query: 395 PTATPAPTAQPPAAATPPTAT-PPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTA 219
           PTA PAPTA P   A P  AT PP ATP A+ P P  P P + P  +P AP P S+PS  
Sbjct: 4   PTAAPAPTAPP---APPANATIPPPATPSASPPTPTPPKP-TPPPPAPSAPPP-SSPSVP 58

Query: 218 PTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           P  + A SPP+P+     P      +P SP+   + S P
Sbjct: 59  PPATPAVSPPSPSSTPATPSAPSPSSPSSPATPATPSPP 97

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 41/109 (37%), Positives = 56/109 (51%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           A  P++    PP ATPA  + P  ++TP T + P+ + P++   PATP+P S    SPP+
Sbjct: 49  APPPSSPSV-PPPATPA-VSPPSPSSTPATPSAPSPSSPSSPATPATPSPPSD-TPSPPS 105

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            TP+    T   PS   SPP+ TP    P  SG    P PS+    S P
Sbjct: 106 DTPSPPSDTPSPPSDTPSPPSDTPSP--PSSSGGGRSP-PSSGGERSTP 151

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 41/118 (34%), Positives = 58/118 (49%), Gaps = 14/118 (11%)
 Frame = -3

Query: 419 PTAAPTKPPTATPA------------PTAQPPAAATPPTATPPTATPPAAVPAPATPAPA 276
           P ++P+ PP ATPA            P+A  P++ + P ATP T +PP+  P+P +  P 
Sbjct: 51  PPSSPSVPPPATPAVSPPSPSSTPATPSAPSPSSPSSP-ATPATPSPPSDTPSPPSDTP- 108

Query: 275 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD--TPPSPSAAFSYS 108
                SPP+ TP+    T   PS   SPP+ +     P  SG +  TP S S   S+S
Sbjct: 109 -----SPPSDTPSPPSDTPSPPSDTPSPPSSSGGGRSPPSSGGERSTPSSHSPPKSHS 161

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 32/106 (30%), Positives = 50/106 (47%), Gaps = 12/106 (11%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQP--PAAATPP--TATPPTATPPAAVPAPATPAPASSPATSP 255
           +P++ P  P   +P+  + P  PA  +PP  T +PP+ TP      P+ P+   SP +  
Sbjct: 69  SPSSTPATPSAPSPSSPSSPATPATPSPPSDTPSPPSDTPSPPSDTPSPPSDTPSPPSDT 128

Query: 254 PAP--------TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 141
           P+P        +P S+     TPS+   P + +P   G G SG  T
Sbjct: 129 PSPPSSSGGGRSPPSSGGERSTPSSHSPPKSHSPGGEGGGSSGPST 174

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 35/108 (32%), Positives = 50/108 (46%), Gaps = 13/108 (12%)
 Frame = -3

Query: 410 APTKPPTATPAPT-AQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAS 234
           +P+  P    AP+ + P + ATP T +PP+ TP      P+ P+   SP +  P+P P+ 
Sbjct: 69  SPSSTPATPSAPSPSSPSSPATPATPSPPSDTPSPPSDTPSPPSDTPSPPSDTPSP-PSD 127

Query: 233 TPSTAPTPSTAGSPPA-----PTPDSLGP-------GPSGADTPPSPS 126
           TPS   +     SPP+      TP S  P       G  G  + PS S
Sbjct: 128 TPSPPSSSGGGRSPPSSGGERSTPSSHSPPKSHSPGGEGGGSSGPSTS 175

[117][TOP]
>UniRef100_B6SUZ1 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6SUZ1_MAIZE
          Length = 284

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 55/162 (33%), Positives = 69/162 (42%), Gaps = 39/162 (24%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAA---ATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
           AP  AP KPP  TP P   PPA    ATPP   PP   PPAA P P    PA +PA+ PP
Sbjct: 125 APAVAPAKPPPVTPPPVTPPPATPPPATPPAVLPPAVLPPAAAPPPTATPPAEAPASLPP 184

Query: 251 APTPA--------------------------------STPSTAPTPSTAGSPPAPTP--- 177
           A TP                                   P+ AP P +  +P AP+P   
Sbjct: 185 ATTPPPVAEAPAELPPAEAPSKGKNKHKRRRKQHGKKEAPAEAPQPLSPPAPAAPSPADL 244

Query: 176 -DSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAALFAIAF 54
            D  GP PS AD   S      +   ++  TA++A L ++A+
Sbjct: 245 EDVSGPAPS-ADVNAS-CRQHQHWASVVVQTAMAALLLSLAW 284

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 51/119 (42%), Positives = 60/119 (50%), Gaps = 6/119 (5%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKP-PTATP-APTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
           AT      P   PT P PTATP AP   PP A     A PP  TPP   P PATP PA+ 
Sbjct: 94  ATPVAPANPPPVPTTPAPTATPVAPAKPPPVAPAVAPAKPPPVTPPPVTPPPATPPPATP 153

Query: 269 PATSPPA--PTPASTPSTA--PTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSK 105
           PA  PPA  P  A+ P TA  P  + A  PPA TP  +   P  A+ PP+ + +   +K
Sbjct: 154 PAVLPPAVLPPAAAPPPTATPPAEAPASLPPATTPPPVAEAP--AELPPAEAPSKGKNK 210

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 50/122 (40%), Positives = 64/122 (52%), Gaps = 3/122 (2%)
 Frame = -3

Query: 458 ILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTA-TPPAAVPAPATPA 282
           +LGL   + +AQ+P  APT     TPA    P A  TP T T P A T PAA   PATP 
Sbjct: 18  LLGLHLIAAVAQSPPTAPT-----TPAAPTTPAAPTTPATPTTPAAPTTPAAPTTPATPT 72

Query: 281 PASSPATSPPAPTPASTPST-APTP-STAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYS 108
             ++P T+P APT  + P+T A TP + A  PP PT  +    P     PP  + A + +
Sbjct: 73  TPAAP-TTPIAPTTPAAPTTPAATPVAPANPPPVPTTPAPTATPVAPAKPPPVAPAVAPA 131

Query: 107 KP 102
           KP
Sbjct: 132 KP 133

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 44/115 (38%), Positives = 50/115 (43%), Gaps = 9/115 (7%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATP-PTATP--PTATPPAAV------PAPAT 288
           T+ +A    AAPT P     AP   PP   TP PTATP  P   PP A       P P T
Sbjct: 78  TTPIAPTTPAAPTTPAATPVAPANPPPVPTTPAPTATPVAPAKPPPVAPAVAPAKPPPVT 137

Query: 287 PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
           P P + P  +PP  TP +    A  P  A  PP  TP +  P      T P P A
Sbjct: 138 PPPVTPPPATPPPATPPAVLPPAVLPPAAAPPPTATPPAEAPASLPPATTPPPVA 192

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 50/132 (37%), Positives = 59/132 (44%), Gaps = 24/132 (18%)
 Frame = -3

Query: 443 ATSCLAQAPT--AAPTKPPT-ATPAPTAQPPAAATPPTATPPTATPPAAV---PAPATPA 282
           AT     APT  AAPT P T  TPA    P A  TP   T P ATP A     P P TPA
Sbjct: 51  ATPTTPAAPTTPAAPTTPATPTTPAAPTTPIAPTTPAAPTTPAATPVAPANPPPVPTTPA 110

Query: 281 PAS-----------SPATSPPAPTPASTPSTAPTPST-------AGSPPAPTPDSLGPGP 156
           P +           +PA +P  P P + P   P P+T       A  PPA  P +  P P
Sbjct: 111 PTATPVAPAKPPPVAPAVAPAKPPPVTPPPVTPPPATPPPATPPAVLPPAVLPPAAAPPP 170

Query: 155 SGADTPPSPSAA 120
           +   TPP+ + A
Sbjct: 171 TA--TPPAEAPA 180

[118][TOP]
>UniRef100_A9SB35 Non-specific lipid-transfer protein n=1 Tax=Physcomitrella patens
           subsp. patens RepID=A9SB35_PHYPA
          Length = 341

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 50/119 (42%), Positives = 68/119 (57%), Gaps = 11/119 (9%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATP-------PTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           PT  P+ TPA    PPAA+TP       PT+T P+A  PA+ P  +TPAP S+P  +P A
Sbjct: 207 PTMSPSTTPAAPQMPPAASTPSSAPVEAPTSTTPSAA-PASAPTSSTPAPTSTPVAAPTA 265

Query: 248 P--TPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSG-ADTPPSPSAAFSYSKPIIAATA 84
           P  TPA+TP+ AP   T+ SP P+  P+  G  P+  A   P P AA + + P + A +
Sbjct: 266 PSTTPATTPTMAPISPTSESPTPSLAPNGPGSSPAADAAQAPGPQAAGTSAAPAMVAAS 324

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 50/135 (37%), Positives = 67/135 (49%), Gaps = 13/135 (9%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPT---AQPPAAATPPT-ATPPT--ATPPAAVPAPATPA 282
           A+ C   AP      PPT  PA     A PP  A+PP  ATPP+   +PP     P T +
Sbjct: 151 ASKCTDSAPPPMAATPPTTVPASPPMGATPPTVASPPMGATPPSVPVSPPVVGGVPPTMS 210

Query: 281 PASSPAT---SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS----GADTPPSPSA 123
           P+++PA     P A TP+S P  APT +T  + PA  P S  P P+     A T PS + 
Sbjct: 211 PSTTPAAPQMPPAASTPSSAPVEAPTSTTPSAAPASAPTSSTPAPTSTPVAAPTAPSTTP 270

Query: 122 AFSYSKPIIAATALS 78
           A + +   I+ T+ S
Sbjct: 271 ATTPTMAPISPTSES 285

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 46/120 (38%), Positives = 70/120 (58%), Gaps = 4/120 (3%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATP-PTATPPAAVPAPATPAPASSPATSPP 252
           A  P++AP + PT+T  P+A P  A+ P ++TP PT+TP AA  AP+T  PA++P  +P 
Sbjct: 224 ASTPSSAPVEAPTST-TPSAAP--ASAPTSSTPAPTSTPVAAPTAPST-TPATTPTMAPI 279

Query: 251 APTPASTPSTAPTPSTAGSPPAPTP---DSLGPGPSGADTPPSPSAAFSYSKPIIAATAL 81
           +PT     S +PTPS A + P  +P    +  PGP  A T  +P+   + S  + +A A+
Sbjct: 280 SPT-----SESPTPSLAPNGPGSSPAADAAQAPGPQAAGTSAAPAMVAASSVVVGSAAAV 334

[119][TOP]
>UniRef100_A7PAK3 Chromosome chr14 scaffold_9, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PAK3_VITVI
          Length = 717

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 49/122 (40%), Positives = 66/122 (54%), Gaps = 12/122 (9%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAP--TAQPPAAATPPTAT-PPTATPPAAVPAPATPAPASSPAT 261
           +A +  + P+ PPT +P P  TA PP +  PP A+ PP  +PP + PA   P+P +SP  
Sbjct: 45  VAPSTPSNPSPPPTQSPPPSVTASPPESPPPPPASIPPPTSPPPSPPASPPPSPPASPPP 104

Query: 260 SPPAPTPASTPSTAPTPSTAGSPP---APTPDSLG-PGP-----SGADTPPSPSAAFSYS 108
           SPPA  P S P++AP P+   +PP   +P P S G P P         TPPSP A    +
Sbjct: 105 SPPASPPPSPPTSAPPPAVNSTPPPVLSPPPPSEGSPSPRVSPAPPVGTPPSPPAVSPST 164

Query: 107 KP 102
            P
Sbjct: 165 PP 166

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 43/127 (33%), Positives = 62/127 (48%), Gaps = 21/127 (16%)
 Frame = -3

Query: 419 PTAAPTKPPTATPA--PTAQPPAAATPPTATPPTATPPAAV------------PAPATPA 282
           PT+ P  PP + P   P + PP+    P  +PPT+ PP AV            P+  +P+
Sbjct: 83  PTSPPPSPPASPPPSPPASPPPSPPASPPPSPPTSAPPPAVNSTPPPVLSPPPPSEGSPS 142

Query: 281 PASSPAT------SPPAPTPAS-TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
           P  SPA       SPPA +P++  P   P+P+++ SPP P   S    P  + +PP PS 
Sbjct: 143 PRVSPAPPVGTPPSPPAVSPSTPPPDNVPSPTSSSSPPPPVASS----PQNSPSPPPPSG 198

Query: 122 AFSYSKP 102
           +   S P
Sbjct: 199 SEPLSPP 205

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 46/117 (39%), Positives = 58/117 (49%), Gaps = 13/117 (11%)
 Frame = -3

Query: 410 APTKPPTATPAPTAQPPAAAT--PPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPA 237
           AP+ P   +P PT  PP + T  PP + PP   PPA++P P +P P  SP  SPP   PA
Sbjct: 46  APSTPSNPSPPPTQSPPPSVTASPPESPPP---PPASIPPPTSPPP--SPPASPPPSPPA 100

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP-----------SPSAAFSYSKPI 99
           S P     PS   SPP P+P +  P P+   TPP           SPS   S + P+
Sbjct: 101 SPP-----PSPPASPP-PSPPTSAPPPAVNSTPPPVLSPPPPSEGSPSPRVSPAPPV 151

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 53/142 (37%), Positives = 69/142 (48%), Gaps = 27/142 (19%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPA------PTAQPPAA--ATPP---TATPPTATPPAAVPAPATPA 282
           A  P + P  PP + PA      PT+ PP A  +TPP   +  PP+   P+   +PA P 
Sbjct: 92  ASPPPSPPASPPPSPPASPPPSPPTSAPPPAVNSTPPPVLSPPPPSEGSPSPRVSPAPPV 151

Query: 281 ------PASSPATSPPAPTPASTPSTAPTPSTAGSP---PAPTPDS----LGPGPSGAD- 144
                 PA SP+T PP   P+ T S++P P  A SP   P+P P S    L P P+ A  
Sbjct: 152 GTPPSPPAVSPSTPPPDNVPSPTSSSSPPPPVASSPQNSPSPPPPSGSEPLSPPPTPARS 211

Query: 143 --TPPSPSAAFSYSKPIIAATA 84
             +PP PS   S S P I+  A
Sbjct: 212 TISPPPPSVPSSSSPPSISPPA 233

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 34/104 (32%), Positives = 54/104 (51%), Gaps = 2/104 (1%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTAT-PAPTAQPPAAATPPT-ATPPTATPPAAVPAPATPAPASSPA 264
           S  + + +++ ++PP  + P  T+   A +TP   + PPT +PP +V A    +P   PA
Sbjct: 19  SSSSSSNSSSNSQPPAGSDPNQTSDQVAPSTPSNPSPPPTQSPPPSVTASPPESPPPPPA 78

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
           + PP  +P  +P  +P PS   SPP   P S  P P  +  PP+
Sbjct: 79  SIPPPTSPPPSPPASPPPSPPASPPPSPPASPPPSPPTSAPPPA 122

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 32/100 (32%), Positives = 46/100 (46%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           +P  +P  P    P+P A  P+  TPP    P+ T  ++ P P   +P +SP+  PP+ +
Sbjct: 142 SPRVSPAPPVGTPPSPPAVSPS--TPPPDNVPSPTSSSSPPPPVASSPQNSPSPPPPSGS 199

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
              +P   P  ST   PP   P S  P       PPS S+
Sbjct: 200 EPLSPPPTPARSTISPPPPSVPSSSSPPSISPPAPPSNSS 239

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 45/139 (32%), Positives = 62/139 (44%), Gaps = 23/139 (16%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQP-PAAATPPT--ATPPTATPPAAVPAPAT-----PAPASSPA 264
           P  +P  P   +P+P   P P   TPP+  A  P+  PP  VP+P +     P  ASSP 
Sbjct: 129 PVLSPPPPSEGSPSPRVSPAPPVGTPPSPPAVSPSTPPPDNVPSPTSSSSPPPPVASSPQ 188

Query: 263 TSP------------PAPTPASTPSTAPTPS--TAGSPPAPTPDSLGPGPSGADTP-PSP 129
            SP            P PTPA +  + P PS  ++ SPP+ +P +     S   TP  SP
Sbjct: 189 NSPSPPPPSGSEPLSPPPTPARSTISPPPPSVPSSSSPPSISPPAPPSNSSDTGTPTSSP 248

Query: 128 SAAFSYSKPIIAATALSAA 72
             +    KP   +T  + A
Sbjct: 249 LPSIPSEKPTARSTTNTTA 267

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 38/117 (32%), Positives = 56/117 (47%), Gaps = 17/117 (14%)
 Frame = -3

Query: 392 TATPAPTAQPPAAATPPTAT----------PPTATPPAAVP---APATPAPASSPATSPP 252
           +A+P+P + PP+ AT P+++          PP  + P       AP+TP+  S P T  P
Sbjct: 3   SASPSPNS-PPSTATSPSSSSSSNSSSNSQPPAGSDPNQTSDQVAPSTPSNPSPPPTQSP 61

Query: 251 APTPASTPSTAPTPSTAGSPPA----PTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
            P+  ++P  +P P  A  PP     P+P +  P    A  PPSP A+   S P  A
Sbjct: 62  PPSVTASPPESPPPPPASIPPPTSPPPSPPASPPPSPPASPPPSPPASPPPSPPTSA 118

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 29/86 (33%), Positives = 46/86 (53%), Gaps = 4/86 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPT---AQPPAAATPPTATPPT-ATPPAAVPAPATPAPASSPATSP 255
           +PT++ + PP    +P    + PP + + P + PPT A    + P P+ P+ +S P+ SP
Sbjct: 172 SPTSSSSPPPPVASSPQNSPSPPPPSGSEPLSPPPTPARSTISPPPPSVPSSSSPPSISP 231

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTP 177
           PAP   S+ +  PT S   S P+  P
Sbjct: 232 PAPPSNSSDTGTPTSSPLPSIPSEKP 257

[120][TOP]
>UniRef100_A4S1Y9 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901
           RepID=A4S1Y9_OSTLU
          Length = 1065

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 48/119 (40%), Positives = 60/119 (50%)
 Frame = -3

Query: 458 ILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAP 279
           +L   A + LA APT  PT  PT +P P+  P    +PP + PP  +PP + P    P+P
Sbjct: 456 VLAPNAAAALAAAPTPTPTPTPTPSPPPSPPPSPPPSPPPSPPP--SPPPSPPPSPPPSP 513

Query: 278 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
             SP  SPP+P P+  PS  P PS   SPP   P S  P P     PPSP  +   S P
Sbjct: 514 PPSPPPSPPSPPPSPPPS--PPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPPPSPP 569

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 32/94 (34%), Positives = 46/94 (48%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P+ PP+  P+P   PP +  P   +PP + PP+  P+P    P S P + PP+P P
Sbjct: 495 PSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 554

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 138
           +  PS  P+P  +  P  P P    P    A  P
Sbjct: 555 SPPPSPPPSPPPSPPPSPPPPPHFAPFVPLASVP 588

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 43/98 (43%), Positives = 51/98 (52%), Gaps = 2/98 (2%)
 Frame = -3

Query: 389 ATPAPTAQPPAAATP-PTATP-PTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAP 216
           A  AP A    AA P PT TP PT +PP + P    P+P  SP  SPP P+P  +P  +P
Sbjct: 455 AVLAPNAAAALAAAPTPTPTPTPTPSPPPSPP----PSPPPSPPPSPP-PSPPPSPPPSP 509

Query: 215 TPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            PS   SPP P+P S  P P     PPSP  +   S P
Sbjct: 510 PPSPPPSPP-PSPPSPPPSPP-PSPPPSPPPSPPPSPP 545

[121][TOP]
>UniRef100_B9PLD5 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1
           RepID=B9PLD5_TOXGO
          Length = 1112

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 49/110 (44%), Positives = 68/110 (61%), Gaps = 8/110 (7%)
 Frame = -3

Query: 425 QAPTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPP 252
           Q P + P   PP  +P+P +  P A +PP  +PP+ +PPA + PAP+ PAP S P+ +PP
Sbjct: 260 QLPPSPPAPSPPAPSPSPPSVSPPAPSPPAPSPPSVSPPAPSPPAPSPPAP-SPPSVAPP 318

Query: 251 APTPASTPSTAPTPSTAG--SPPAPT--PDSLG-PGPSGAD-TPPSPSAA 120
           AP+P S    AP+P +    +PPAP+  P SL  P PS    +PP+PSAA
Sbjct: 319 APSPPSVSPPAPSPPSVAPPAPPAPSVAPPSLSPPAPSPPSVSPPAPSAA 368

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 49/126 (38%), Positives = 68/126 (53%), Gaps = 2/126 (1%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           A+S    +P   P  PP  +P     P  + +PP+ +PP  +PPA  P   +P   S PA
Sbjct: 250 ASSLQGVSPVQLPPSPPAPSP-----PAPSPSPPSVSPPAPSPPAPSPPSVSPPAPSPPA 304

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPPSPSAAFSYSKPIIAA 90
            SPPAP+P S    AP+P +  SPPAP+P S+ P   P+ +  PPS S   + S P ++ 
Sbjct: 305 PSPPAPSPPSVAPPAPSPPSV-SPPAPSPPSVAPPAPPAPSVAPPSLSPP-APSPPSVSP 362

Query: 89  TALSAA 72
            A SAA
Sbjct: 363 PAPSAA 368

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 44/107 (41%), Positives = 55/107 (51%), Gaps = 4/107 (3%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           A S  A +P+     PP   P+P A  P + +PP  +PP  +PPA  P    P   S P+
Sbjct: 267 APSPPAPSPSPPSVSPP--APSPPAPSPPSVSPPAPSPPAPSPPAPSPPSVAPPAPSPPS 324

Query: 263 TSPPAPTPAS-TPSTAPTPSTAG---SPPAPTPDSLGPGPSGADTPP 135
            SPPAP+P S  P   P PS A    SPPAP+P S+ P    A  PP
Sbjct: 325 VSPPAPSPPSVAPPAPPAPSVAPPSLSPPAPSPPSVSPPAPSAAPPP 371

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 53/131 (40%), Positives = 68/131 (51%), Gaps = 24/131 (18%)
 Frame = -3

Query: 446 LATSCLAQAPTAA--------PTKPPTATPAPT---AQPPAAATPPTATP-----PTATP 315
           + TS   + P AA        P KP +A+PA     A PP A    +A+      P   P
Sbjct: 203 MTTSLHVRRPEAAKPATTPVPPRKPQSASPASRVSFAPPPEAKVKSSASSLQGVSPVQLP 262

Query: 314 PAAVPAPATPAPASSP------ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLG-PGP 156
           P+  PAP+ PAP+ SP      A SPPAP+P S    AP+P  A SPPAP+P S+  P P
Sbjct: 263 PSP-PAPSPPAPSPSPPSVSPPAPSPPAPSPPSVSPPAPSP-PAPSPPAPSPPSVAPPAP 320

Query: 155 SGAD-TPPSPS 126
           S    +PP+PS
Sbjct: 321 SPPSVSPPAPS 331

[122][TOP]
>UniRef100_B6KLS9 Voltage gated chloride channel domain-containing protein n=1
           Tax=Toxoplasma gondii ME49 RepID=B6KLS9_TOXGO
          Length = 1779

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 39/112 (34%), Positives = 76/112 (67%), Gaps = 7/112 (6%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPT-ATPPTATPPAAVPAPATPAPASSPA 264
           +S  + + + +P+ PP+++P P++ PP+++T P+ ++PP+++PP+  P P++P  +S P+
Sbjct: 187 SSSPSSSTSPSPSSPPSSSP-PSSSPPSSSTSPSPSSPPSSSPPSPSPPPSSPPSSSPPS 245

Query: 263 TSPPAPT--PASTPSTAPTPSTAGSPPAPTPDSLGP----GPSGADTPPSPS 126
           +SPP+P+  P S+P ++ +PS++  PP+ +P S  P     PS +  PPS S
Sbjct: 246 SSPPSPSSPPPSSPPSSSSPSSSSPPPSSSPPSSSPPSSSSPSSSSPPPSSS 297

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 39/113 (34%), Positives = 75/113 (66%), Gaps = 4/113 (3%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPP 252
           + + + +P+ PP+++P   + PP++  PP+++PP+++PP+ + P P++P  +SSP++S P
Sbjct: 213 SSSTSPSPSSPPSSSPPSPSPPPSS--PPSSSPPSSSPPSPSSPPPSSPPSSSSPSSSSP 270

Query: 251 APT---PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P+   P+S+P ++ +PS++  PP+ +P    P P  + T PSPS+  S S P
Sbjct: 271 PPSSSPPSSSPPSSSSPSSSSPPPSSSPPP--PSPPSSSTSPSPSSPPSSSPP 321

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 37/106 (34%), Positives = 69/106 (65%), Gaps = 2/106 (1%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA-PTPA 237
           ++ + PP+++P P + P ++ +P  ++PP+++PP+  P P++P  +S P++SPP+ P+P+
Sbjct: 288 SSSSPPPSSSPPPPSPPSSSTSPSPSSPPSSSPPSPSPPPSSPPSSSPPSSSPPSPPSPS 347

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGPGPS-GADTPPSPSAAFSYSKP 102
           S P ++P  S++ S  +P P S  P PS  + +PPS S+  S   P
Sbjct: 348 SPPPSSPPSSSSPSSSSPPPSSSPPPPSPPSSSPPSSSSPSSSPSP 393

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 45/137 (32%), Positives = 81/137 (59%), Gaps = 21/137 (15%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS--------- 270
           +P+  P+ PP+++P P++ PP+ ++PP ++PP+++ P++   P + +P SS         
Sbjct: 230 SPSPPPSSPPSSSP-PSSSPPSPSSPPPSSPPSSSSPSSSSPPPSSSPPSSSPPSSSSPS 288

Query: 269 -----PATSPPAPTPASTPSTAPTPST--AGSPPAP-----TPDSLGPGPSGADTPPSPS 126
                P++SPP P+P S+ ST+P+PS+  + SPP+P     +P S  P  S   +PPSPS
Sbjct: 289 SSSPPPSSSPPPPSPPSS-STSPSPSSPPSSSPPSPSPPPSSPPSSSPPSSSPPSPPSPS 347

Query: 125 AAFSYSKPIIAATALSA 75
           +    S P  ++ + S+
Sbjct: 348 SPPPSSPPSSSSPSSSS 364

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 40/124 (32%), Positives = 73/124 (58%), Gaps = 28/124 (22%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTAT-------PPAAVPAP-------ATPAPASS 270
           P+ PP+++   ++ PP +++PP+++PP+++       PP++ P P        +P+P+S 
Sbjct: 256 PSSPPSSSSPSSSSPPPSSSPPSSSPPSSSSPSSSSPPPSSSPPPPSPPSSSTSPSPSSP 315

Query: 269 PATSPPAPTP--ASTPSTAPTPSTAGSPPAPT------------PDSLGPGPSGADTPPS 132
           P++SPP+P+P  +S PS++P  S+  SPP+P+            P S  P PS +  PPS
Sbjct: 316 PSSSPPSPSPPPSSPPSSSPPSSSPPSPPSPSSPPPSSPPSSSSPSSSSPPPSSSPPPPS 375

Query: 131 PSAA 120
           P ++
Sbjct: 376 PPSS 379

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 38/113 (33%), Positives = 69/113 (61%), Gaps = 8/113 (7%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATP------PTATPPTATPPAAVPAPATPAP 279
           +S  + +P++ P+  P +   P + PP+++ P      P++ PP++ P ++ P+ ++P P
Sbjct: 213 SSSTSPSPSSPPSSSPPSPSPPPSSPPSSSPPSSSPPSPSSPPPSSPPSSSSPSSSSPPP 272

Query: 278 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG--ADTPPSPS 126
           +SSP +S P P+ +S  S++P PS++  PP+P   S  P PS   + +PPSPS
Sbjct: 273 SSSPPSSSP-PSSSSPSSSSPPPSSSPPPPSPPSSSTSPSPSSPPSSSPPSPS 324

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 34/99 (34%), Positives = 60/99 (60%), Gaps = 1/99 (1%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP-AST 231
           P  PP+++ +P+   P +++PP+ +PP ++PP++ P  ++P    SP++ PP+  P +S+
Sbjct: 300 PPSPPSSSTSPSPSSPPSSSPPSPSPPPSSPPSSSPPSSSPPSPPSPSSPPPSSPPSSSS 359

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
           PS++  P ++  PP   P S  P  S   + PSPSA  S
Sbjct: 360 PSSSSPPPSSSPPPPSPPSSSPPSSSSPSSSPSPSADLS 398

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 35/111 (31%), Positives = 70/111 (63%), Gaps = 5/111 (4%)
 Frame = -3

Query: 419 PTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATP-APASSPATSPPA 249
           P+++P  + PP+++ +P+   P +++PP+ +PP ++PP++ P  ++P +P+S P +SPP+
Sbjct: 202 PSSSPPSSSPPSSSTSPSPSSPPSSSPPSPSPPPSSPPSSSPPSSSPPSPSSPPPSSPPS 261

Query: 248 PTPASTPSTAP--TPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            +  S+ S  P  +P ++  P + +P S  P PS +  PPSP ++ +   P
Sbjct: 262 SSSPSSSSPPPSSSPPSSSPPSSSSPSSSSPPPSSSPPPPSPPSSSTSPSP 312

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 36/116 (31%), Positives = 74/116 (63%), Gaps = 4/116 (3%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP--APATPAPASSPATSPPAPT--P 240
           P+  P ++ +P++ P ++ +P  ++PP+++PP++ P  +  +P+P+S P++SPP+P+  P
Sbjct: 176 PSLSPPSSSSPSSSPSSSTSPSPSSPPSSSPPSSSPPSSSTSPSPSSPPSSSPPSPSPPP 235

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
           +S PS++P  S+  SP +P P S     S + + P PS++   S P  +++  S++
Sbjct: 236 SSPPSSSPPSSSPPSPSSPPPSSPPSSSSPSSSSPPPSSSPPSSSPPSSSSPSSSS 291

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 4/105 (3%)
 Frame = -3

Query: 398 PPTATPAPT--AQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA--PTPAST 231
           PP++   P   + PP+   PP++ PP+++   + P P +P+ +SS ++SPP+  P P   
Sbjct: 627 PPSSPSMPLLPSSPPSVPVPPSSPPPSSS--LSAPVPPSPSSSSSHSSSPPSVLPLPPHV 684

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPII 96
           PS +P+PS+A SP  P P S    PS    P SPS   S S P +
Sbjct: 685 PS-SPSPSSASSPSMPLPTSSSSPPS--SPPSSPSVPLSSSSPSV 726

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 39/109 (35%), Positives = 70/109 (64%), Gaps = 8/109 (7%)
 Frame = -3

Query: 377 PTAQPPAAAT---PPTATPPTATPPAAVPAPAT-PAPASSPATSPPAPTPASTPSTAPTP 210
           PT++P   A     P+ +PP+++ P++ P+ +T P+P+S P++SPP+ +P S+ ST+P+P
Sbjct: 162 PTSEPFVHADLKMRPSLSPPSSSSPSSSPSSSTSPSPSSPPSSSPPSSSPPSS-STSPSP 220

Query: 209 ST--AGSPPAPTPDSLGPGPSG--ADTPPSPSAAFSYSKPIIAATALSA 75
           S+  + SPP+P+P    P  S   + +PPSPS+    S P  ++ + S+
Sbjct: 221 SSPPSSSPPSPSPPPSSPPSSSPPSSSPPSPSSPPPSSPPSSSSPSSSS 269

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 34/107 (31%), Positives = 65/107 (60%), Gaps = 5/107 (4%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTK-PPTATPAPTAQP---PAAATPPTATPPTATPPAAVPAPATPAPAS 273
           +S  + +P++ P+  PP+ +P P++ P   P +++PP+   P++ PP++ P+ ++P+ +S
Sbjct: 305 SSSTSPSPSSPPSSSPPSPSPPPSSPPSSSPPSSSPPSPPSPSSPPPSSPPSSSSPSSSS 364

Query: 272 -SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
             P++SPP P+P S  S+ P+ S+  S P+P+ D        AD  P
Sbjct: 365 PPPSSSPPPPSPPS--SSPPSSSSPSSSPSPSADLSERAQGPADEAP 409

 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 37/148 (25%), Positives = 77/148 (52%), Gaps = 13/148 (8%)
 Frame = -3

Query: 503  LHPKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPT 324
            +HP    S++  + +     +   L  +P + P  P +  P+ +   P   +P +++  +
Sbjct: 612  VHPSSPYSSSPSVPVPPSSPSMPLLPSSPPSVPVPPSSPPPSSSLSAPVPPSPSSSSSHS 671

Query: 323  ATPPAAVP----APATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGP 156
            ++PP+ +P     P++P+P+S+ + S P PT +S+P ++P PS+   P + +  S+ P P
Sbjct: 672  SSPPSVLPLPPHVPSSPSPSSASSPSMPLPTSSSSPPSSP-PSSPSVPLSSSSPSVPPSP 730

Query: 155  SG--------ADTPP-SPSAAFSYSKPI 99
            S         + +P  SP +A S+S+ +
Sbjct: 731  SSPVSVLLSRSSSPSFSPDSAPSFSESL 758

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 32/104 (30%), Positives = 50/104 (48%), Gaps = 2/104 (1%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTAT--PPTATPPAAVPAPATPAPASSPATSPPAPTPAS 234
           P+  P    +P +  P+   PP++   P   + P +VP P +  P SS  ++P  P+P+S
Sbjct: 607 PSFSPVHPSSPYSSSPSVPVPPSSPSMPLLPSSPPSVPVPPSSPPPSSSLSAPVPPSPSS 666

Query: 233 TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           + S + +P +    P   P S  P PS A +P  P    S S P
Sbjct: 667 SSSHSSSPPSVLPLPPHVPSS--PSPSSASSPSMPLPTSSSSPP 708

[123][TOP]
>UniRef100_B4JDR2 GH10507 n=1 Tax=Drosophila grimshawi RepID=B4JDR2_DROGR
          Length = 1112

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 56/131 (42%), Positives = 68/131 (51%), Gaps = 2/131 (1%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA--PATPAPASS 270
            A +  A AP AAP     A  AP A  PAAA  P A  P A P AA PA  PA  APA +
Sbjct: 784  ALASAAVAPAAAPAAAAPAA-APAAAAPAAA--PAAAAPAAAPAAAAPAAAPAAAAPAPA 840

Query: 269  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAA 90
            PA + PAP PA+  + AP P+ A   PAP   +  P P+ A  PP+  A  S     +AA
Sbjct: 841  PAAAAPAPAPAAA-APAPAPAAAAPVPAPAAIAPAPAPAAAALPPAADAPASPPATAVAA 899

Query: 89   TALSAALFAIA 57
            +A + A  A A
Sbjct: 900  SAAAPAPAAAA 910

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 61/151 (40%), Positives = 76/151 (50%), Gaps = 9/151 (5%)
 Frame = -3

Query: 497  PKMASSA-AVQIFLILGLLATSCLAQA--PTAAPTKPPTATPAPTAQPPAAA--TPPTAT 333
            P  AS+A A  +  +   LA++ +A A  P AA      A  AP A P AAA    P A 
Sbjct: 767  PAPASAASAPAVDAVAPALASAAVAPAAAPAAAAPAAAPAAAAPAAAPAAAAPAAAPAAA 826

Query: 332  PPTATPPAAVPAPA--TPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTP--DSLG 165
             P A P AA PAPA    APA +PA + PAP PA+    AP P+ A   PAP P   +L 
Sbjct: 827  APAAAPAAAAPAPAPAAAAPAPAPAAAAPAPAPAAA---APVPAPAAIAPAPAPAAAALP 883

Query: 164  PGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
            P      +PP+ + A S + P  AA A S A
Sbjct: 884  PAADAPASPPATAVAASAAAPAPAAAAPSPA 914

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 59/162 (36%), Positives = 72/162 (44%), Gaps = 33/162 (20%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQ--------------PPAAATPPT----------- 339
            A +  A APTAA   P T TPAP A               P +AA+ P            
Sbjct: 729  APAAAASAPTAAAPAPATDTPAPAAAVLAPDLALVAPAPAPASAASAPAVDAVAPALASA 788

Query: 338  ----ATPPTATPPAAVPAPATPAPA---SSPATSPPAPTPASTPSTA-PTPSTAGSPPAP 183
                A  P A  PAA PA A PA A   ++PA +P A  PA+ P+ A P P+ A + PAP
Sbjct: 789  AVAPAAAPAAAAPAAAPAAAAPAAAPAAAAPAAAPAAAAPAAAPAAAAPAPAPAAAAPAP 848

Query: 182  TPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAALFAIA 57
             P +  P P+ A   P P+ A     P  AA AL  A  A A
Sbjct: 849  APAAAAPAPAPAAAAPVPAPAAIAPAPAPAAAALPPAADAPA 890

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 61/159 (38%), Positives = 79/159 (49%), Gaps = 12/159 (7%)
 Frame = -3

Query: 497  PKMASSAAVQIFLILGLL-ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATP--- 330
            P  A SA   +     L+ A + LA AP AA    P +TPA  A    A+TP  A P   
Sbjct: 615  PAAADSAPAALASTPALVPAAAALASAPAAAA---PASTPAAAAP---ASTPAAAAPVSA 668

Query: 329  PTATPP-------AAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDS 171
            P A  P       AA PAPAT APA +PA + PAP PA   + AP  + A + PAP P +
Sbjct: 669  PAAAAPALALAAAAAAPAPATAAPAPAPAAAAPAPVPA---AVAPASAPAVAVPAPAPTA 725

Query: 170  LGPGPSGADTPPSPSA-AFSYSKPIIAATALSAALFAIA 57
              P P+ A + P+ +A A +   P  AA  L+  L  +A
Sbjct: 726  AVPAPAAAASAPTAAAPAPATDTPAPAAAVLAPDLALVA 764

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 53/134 (39%), Positives = 62/134 (46%), Gaps = 10/134 (7%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
            A +  A AP AAP     A PAP A  PA A    A  P     A VPAPA  APA +PA
Sbjct: 820  AAAPAAAAPAAAPAAAAPA-PAPAAAAPAPAPAAAAPAPAPAAAAPVPAPAAIAPAPAPA 878

Query: 263  TS---PPAPTPASTPST-------APTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
             +   P A  PAS P+T       AP P+ A   PAPT  +  P P+ A   P+ + A S
Sbjct: 879  AAALPPAADAPASPPATAVAASAAAPAPAAAAPSPAPTLAAAAPAPTPAAAAPASAPAAS 938

Query: 113  YSKPIIAATALSAA 72
                  AA    AA
Sbjct: 939  TPSSDSAAAPTPAA 952

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 55/149 (36%), Positives = 67/149 (44%), Gaps = 20/149 (13%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP----ATPAPA 276
            A   LA A  AA   P TA PAP     A A  P A  P + P  AVPAP    A PAPA
Sbjct: 672  AAPALALAAAAAAPAPATAAPAPAPAAAAPAPVPAAVAPASAPAVAVPAPAPTAAVPAPA 731

Query: 275  S----------SPATSPPAPTPA----STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 138
            +          +PAT  PAP  A         AP P+ A +  AP  D++ P  + A   
Sbjct: 732  AAASAPTAAAPAPATDTPAPAAAVLAPDLALVAPAPAPASAASAPAVDAVAPALASAAVA 791

Query: 137  P--SPSAAFSYSKPIIAATALSAALFAIA 57
            P  +P+AA   + P  AA A + A  A A
Sbjct: 792  PAAAPAAAAPAAAPAAAAPAAAPAAAAPA 820

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 50/137 (36%), Positives = 63/137 (45%), Gaps = 13/137 (9%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP 267
            A +  A AP AAP    P A PA  A  PA A    A  P A  PA  PAPA  AP  +P
Sbjct: 811  AAAPAAAAPAAAPAAAAPAAAPAAAAPAPAPAAAAPAPAPAAAAPA--PAPAAAAPVPAP 868

Query: 266  ATSPPAPTPAS--------TPSTAPTPSTAGSPPAPTPDSLGPGP----SGADTPPSPSA 123
            A   PAP PA+         P++ P  + A S  AP P +  P P    + A   P+P+A
Sbjct: 869  AAIAPAPAPAAAALPPAADAPASPPATAVAASAAAPAPAAAAPSPAPTLAAAAPAPTPAA 928

Query: 122  AFSYSKPIIAATALSAA 72
            A   S P  +  +  +A
Sbjct: 929  AAPASAPAASTPSSDSA 945

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 48/122 (39%), Positives = 60/122 (49%), Gaps = 2/122 (1%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
            A +  A AP AAP     A  AP A  PAAA    A  P     A  PAPA  APA +PA
Sbjct: 802  AAAPAAAAPAAAPAAAAPAA-APAAAAPAAAPAAAAPAPAPAAAAPAPAPAAAAPAPAPA 860

Query: 263  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT--PPSPSAAFSYSKPIIAA 90
             + P P PA+  + AP P+ A  PPA    +  P  + A +   P+P+AA     P +AA
Sbjct: 861  AAAPVPAPAAI-APAPAPAAAALPPAADAPASPPATAVAASAAAPAPAAAAPSPAPTLAA 919

Query: 89   TA 84
             A
Sbjct: 920  AA 921

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 49/132 (37%), Positives = 61/132 (46%), Gaps = 8/132 (6%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
            A +  A AP AA      A  AP A P AAA  P    P A  PA  PA A PAPA + A
Sbjct: 806  AAAAPAAAPAAAAPAAAPAAAAPAAAPAAAAPAPA---PAAAAPAPAPAAAAPAPAPAAA 862

Query: 263  TSPPAP---TPASTPSTAPTPSTAGSPPAP-----TPDSLGPGPSGADTPPSPSAAFSYS 108
               PAP    PA  P+ A  P  A +P +P        +  P P+ A   P+P+ A +  
Sbjct: 863  APVPAPAAIAPAPAPAAAALPPAADAPASPPATAVAASAAAPAPAAAAPSPAPTLAAAAP 922

Query: 107  KPIIAATALSAA 72
             P  AA A ++A
Sbjct: 923  APTPAAAAPASA 934

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 44/106 (41%), Positives = 53/106 (50%), Gaps = 9/106 (8%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV--------PAPAT 288
            A +  A AP AA   P  A  AP   P AAA PP A  P + P  AV        PA A 
Sbjct: 851  AAAAPAPAPAAAAPVPAPAAIAPAPAPAAAALPPAADAPASPPATAVAASAAAPAPAAAA 910

Query: 287  PAPASSPATSPPAPTP-ASTPSTAPTPSTAGSPPAPTPDSLGPGPS 153
            P+PA + A + PAPTP A+ P++AP  ST  S  A  P    P P+
Sbjct: 911  PSPAPTLAAAAPAPTPAAAAPASAPAASTPSSDSAAAPTPAAPAPT 956

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 52/155 (33%), Positives = 70/155 (45%), Gaps = 31/155 (20%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA-------PATP 285
            A +    AP AA + P  A  AP A   A A   +A    A+ PA VPA       PA  
Sbjct: 586  APAAADSAPAAADSAPAAADSAPAAADSAPAAADSAPAALASTPALVPAAAALASAPAAA 645

Query: 284  APASSPATSPPAPTPAS-----------------------TPST-APTPSTAGSPPAPTP 177
            APAS+PA + PA TPA+                        P+T AP P+ A + PAP P
Sbjct: 646  APASTPAAAAPASTPAAAAPVSAPAAAAPALALAAAAAAPAPATAAPAPAPAAAAPAPVP 705

Query: 176  DSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
             ++ P  + A   P+P+   +   P  AA+A +AA
Sbjct: 706  AAVAPASAPAVAVPAPAPTAAVPAPAAAASAPTAA 740

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 47/119 (39%), Positives = 59/119 (49%), Gaps = 5/119 (4%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTAT----PAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA 276
            A +  A AP AA   P  A     PAP A  PA A    A PP A  PA+ PA A  A A
Sbjct: 842  AAAAPAPAPAAAAPAPAPAAAAPVPAPAAIAPAPAPAAAALPPAADAPASPPATAVAASA 901

Query: 275  SSPATSPPAPTPAST-PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            ++PA +  AP+PA T  + AP P+ A + PA  P +  P    A   P+P+A     KP
Sbjct: 902  AAPAPAAAAPSPAPTLAAAAPAPTPAAAAPASAPAASTPSSDSA-AAPTPAAPAPTQKP 959

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 54/155 (34%), Positives = 64/155 (41%), Gaps = 31/155 (20%)
 Frame = -3

Query: 428 AQAPTAAPTK---PPTATPAPTAQ--PPAAAT-------PPTATPPTATPPAAVPAPATP 285
           A  PT  P K   P   TP P  Q  PPA           P A  P+A  P A PA A  
Sbjct: 533 AGTPTPQPAKQASPKQVTPPPAKQVTPPAELKIMEQQLQKPVAAAPSAAAPVAAPAAADS 592

Query: 284 APA-----------------SSPATSPPAPTP-ASTPSTAPTPST-AGSPPAPTPDSLGP 162
           APA                 S+PA +  AP   ASTP+  P  +  A +P A  P S   
Sbjct: 593 APAAADSAPAAADSAPAAADSAPAAADSAPAALASTPALVPAAAALASAPAAAAPAST-- 650

Query: 161 GPSGADTPPSPSAAFSYSKPIIAATALSAALFAIA 57
            P+ A    +P+AA   S P  AA AL+ A  A A
Sbjct: 651 -PAAAAPASTPAAAAPVSAPAAAAPALALAAAAAA 684

[124][TOP]
>UniRef100_C0NQ83 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus
           G186AR RepID=C0NQ83_AJECG
          Length = 642

 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 48/114 (42%), Positives = 54/114 (47%), Gaps = 12/114 (10%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPP----TATPPTATPPAAVPAPAT----PAPASSPATSPP 252
           P  PPT+ PAP   PPA A  P    + TPP   PP   PAPA+    P P   P T  P
Sbjct: 431 PAPPPTSAPAPPPPPPAPAPGPVPSSSPTPPPPPPPPPAPAPASTGPVPPPPPPPTTGLP 490

Query: 251 APTPASTPSTA----PTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P P S PS +    P P + G+PP P P S G  P     PP  SAA S   P
Sbjct: 491 RPPPRSAPSNSVPPPPPPPSGGAPPPPPPPSAGAPPPPPPPPPPGSAANSAGPP 544

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 50/121 (41%), Positives = 56/121 (46%), Gaps = 15/121 (12%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATP------PTATPPAAVPAPATPAPASSPA-- 264
           P A P K P ATP P   PP     PT+TP      P  T P  +P    P P S+PA  
Sbjct: 385 PPALPPKIPHATPPP--PPPRPQASPTSTPQSQHLLPPQTVPVPLPVRPAPPPTSAPAPP 442

Query: 263 TSPPAPTPASTPSTAPT-PSTAGSPPAPTPDSLGPGPSGADTP------PSPSAAFSYSK 105
             PPAP P   PS++PT P     PPAP P S GP P     P      P P +A S S 
Sbjct: 443 PPPPAPAPGPVPSSSPTPPPPPPPPPAPAPASTGPVPPPPPPPTTGLPRPPPRSAPSNSV 502

Query: 104 P 102
           P
Sbjct: 503 P 503

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 39/127 (30%), Positives = 49/127 (38%), Gaps = 19/127 (14%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQP------PAAATPPTATPPTATPPAA-------------V 303
           Q P+  P  PP    +P   P      P A  PP    P A+P +              V
Sbjct: 366 QLPSRNPVLPPRREVSPGLPPALPPKIPHATPPPPPPRPQASPTSTPQSQHLLPPQTVPV 425

Query: 302 PAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
           P P  PAP  + A +PP P PA  P   P+ S    PP P P +  P  +G   PP P  
Sbjct: 426 PLPVRPAPPPTSAPAPPPPPPAPAPGPVPSSSPTPPPPPPPPPAPAPASTGPVPPPPPPP 485

Query: 122 AFSYSKP 102
                +P
Sbjct: 486 TTGLPRP 492

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 39/106 (36%), Positives = 44/106 (41%), Gaps = 3/106 (2%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS--- 258
           A AP   P+  PT  P P   PPA A   T   P   PP     P  P P S+P+ S   
Sbjct: 447 APAPGPVPSSSPTPPPPPPP-PPAPAPASTGPVPPPPPPPTTGLP-RPPPRSAPSNSVPP 504

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
           PP P     P   P PS    PP P P   G   + A  PP P A+
Sbjct: 505 PPPPPSGGAPPPPPPPSAGAPPPPPPPPPPGSAANSAGPPPPPPAS 550

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 40/110 (36%), Positives = 44/110 (40%), Gaps = 4/110 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTA----TPPTATPPAAVPAPATPAPASSPATSPP 252
           P   P  PP   PA T   P    PPT      PP + P  +VP P  P P S  A  PP
Sbjct: 460 PPPPPPPPPAPAPASTGPVPPPPPPPTTGLPRPPPRSAPSNSVPPP--PPPPSGGAPPPP 517

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P  A  P   P P     PP    +S GP P     PP  S+A   S P
Sbjct: 518 PPPSAGAPPPPPPP----PPPGSAANSAGPPP-----PPPASSARPSSLP 558

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 38/138 (27%), Positives = 55/138 (39%), Gaps = 22/138 (15%)
 Frame = -3

Query: 416 TAAPTKPPTATPA----PTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           T  P  PP + P+    P   PP+   PP   PP+A  P   P P  P  A++ A  PP 
Sbjct: 487 TGLPRPPPRSAPSNSVPPPPPPPSGGAPPPPPPPSAGAPPPPPPPPPPGSAANSA-GPPP 545

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPG------------------PSGADTPPSPSA 123
           P PAS+   +  P + G+         G G                   + ++TP SP++
Sbjct: 546 PPPASSARPSSLPKSPGNDDLLASIRAGTGLRKVKDSEKRDRSAAMVPGASSETPSSPAS 605

Query: 122 AFSYSKPIIAATALSAAL 69
               + P     +L AAL
Sbjct: 606 GAGSADPNSMLGSLQAAL 623

[125][TOP]
>UniRef100_Q7TLR4 Putative uncharacterized protein n=1 Tax=Choristoneura fumiferana
           MNPV RepID=Q7TLR4_NPVCF
          Length = 251

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 50/102 (49%), Positives = 60/102 (58%), Gaps = 3/102 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAPT 243
           PT +PT PPT  P+PT  P  + TPP    PT  P  +   P TP+P   P  SP P PT
Sbjct: 49  PTPSPTPPPT--PSPTPPPTPSPTPPPTPSPTPPPTPSPTLPPTPSPTLPPTPSPTPPPT 106

Query: 242 PASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSA 123
           P+ TPS  PTPS   SP P+PTP S  P P+ + TP P+PSA
Sbjct: 107 PSPTPS--PTPSPTPSPTPSPTP-SPTPSPTPSATPSPTPSA 145

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 48/103 (46%), Positives = 59/103 (57%), Gaps = 8/103 (7%)
 Frame = -3

Query: 419 PTAAPTKPPTA--TPAPTAQPPAAATPPTATPPTATP-----PAAVPAPATPAPASSPAT 261
           PT +PT PPT   TP PT  P    TP    PPT +P     P+  P P TP+P  SP  
Sbjct: 57  PTPSPTPPPTPSPTPPPTPSPTPPPTPSPTLPPTPSPTLPPTPSPTPPP-TPSPTPSPTP 115

Query: 260 SP-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           SP P+PTP+ TPS  P+P T  + P+PTP S  P P+ + TPP
Sbjct: 116 SPTPSPTPSPTPSPTPSP-TPSATPSPTP-SATPLPTSSPTPP 156

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 55/121 (45%), Positives = 65/121 (53%), Gaps = 8/121 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTA--TPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSPPA 249
           PT  PT PPT   TP PT  P    TP    PPT +P P   P+P TP P  SP T PP 
Sbjct: 33  PTPWPTPPPTPPPTPPPTPSPTPPPTPSPTPPPTPSPTPPPTPSP-TPPPTPSP-TLPPT 90

Query: 248 PTPASTPSTAPTPSTAGSP-PAPTPD---SLGPGPSGADTP-PSPSAAFSYSKPIIAATA 84
           P+P   P+ +PTP    SP P+PTP    S  P P+ + TP P+PSA  S   P  +AT 
Sbjct: 91  PSPTLPPTPSPTPPPTPSPTPSPTPSPTPSPTPSPTPSPTPSPTPSATPS---PTPSATP 147

Query: 83  L 81
           L
Sbjct: 148 L 148

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 8/93 (8%)
 Frame = -3

Query: 419 PTAAPTKPPTA------TPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPAT 261
           PT +PT PPT       TP+PT  P  + TPP    PT +P P+  P+P TP+P  SP  
Sbjct: 73  PTPSPTPPPTPSPTLPPTPSPTLPPTPSPTPPPTPSPTPSPTPSPTPSP-TPSPTPSPTP 131

Query: 260 SP-PAPTPASTPSTAPTPSTAGSPPAPTPDSLG 165
           SP P+ TP+ TPS  P P+++ +PP PTP  LG
Sbjct: 132 SPTPSATPSPTPSATPLPTSSPTPP-PTPSPLG 163

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 41/93 (44%), Positives = 49/93 (52%), Gaps = 2/93 (2%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSPPAPTPASTPST 222
           PPT  P P   PP   TPP   PPT +P P   P+P TP P  SP T PP P+P   P+ 
Sbjct: 32  PPTPWPTP---PP---TPPPTPPPTPSPTPPPTPSP-TPPPTPSP-TPPPTPSPTPPPTP 83

Query: 221 APTPSTAGSPPAPTPDSLGPGPSGADTP-PSPS 126
           +PT     SP  P   S  P P+ + TP P+PS
Sbjct: 84  SPTLPPTPSPTLPPTPSPTPPPTPSPTPSPTPS 116

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 34/70 (48%), Positives = 42/70 (60%), Gaps = 6/70 (8%)
 Frame = -3

Query: 419 PTAAPTKPPTA--TPAPTAQPPAAATP-PTATPPTATPPAAVPAP---ATPAPASSPATS 258
           PT +PT PPT   TP+PT  P  + TP PT +P  +  P+A P+P   ATP P SSP T 
Sbjct: 97  PTPSPTPPPTPSPTPSPTPSPTPSPTPSPTPSPTPSPTPSATPSPTPSATPLPTSSP-TP 155

Query: 257 PPAPTPASTP 228
           PP P+P   P
Sbjct: 156 PPTPSPLGEP 165

[126][TOP]
>UniRef100_Q0GYD2 Putative uncharacterized protein n=1 Tax=Plutella xylostella
           multiple nucleopolyhedrovirus RepID=Q0GYD2_9ABAC
          Length = 250

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 52/139 (37%), Positives = 66/139 (47%), Gaps = 19/139 (13%)
 Frame = -3

Query: 419 PTAAPTKPPTATP------------APTAQPPAAATPPTATP----PTATPPAAVPAPAT 288
           PT  PT PP+ +P             PT  PP +  PPT TP    PT TPP + P P T
Sbjct: 66  PTPTPTPPPSPSPIFPTPSPSPIPPTPTPTPPPSPIPPTPTPSPIPPTPTPPPS-PIPPT 124

Query: 287 PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG---PSGADTPPSPSAAF 117
           P P   P+  PP PTP  TP  +P P T    P P+P+ LG     PS  DT     A  
Sbjct: 125 PTPTPPPSPIPPTPTPTPTPPASPIPPTPTPSPPPSPNPLGEPMYYPSNIDT---NEALT 181

Query: 116 SYSKPIIAATALSAALFAI 60
            + +P + AT  + A +A+
Sbjct: 182 DFLRP-LCATDRTRATYAV 199

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 47/123 (38%), Positives = 62/123 (50%), Gaps = 9/123 (7%)
 Frame = -3

Query: 467 IFLILGLLA-TSCLAQAPTAAPTKPPTATPAPTAQPPAA--ATPPTATPPTATP-PAAVP 300
           I+L L +L  T  L   P   P  PP+ TP P+  PP    + PP+  PPT TP P   P
Sbjct: 17  IYLTLKILDDTQELHPDPPIVPPLPPSPTPPPSPLPPTPTPSPPPSPIPPTPTPTPPPSP 76

Query: 299 APATPAPASSPATSPPAPTPAS-----TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           +P  P P+ SP    P PTP       TP+ +P P T   PP+P P +  P P  +  PP
Sbjct: 77  SPIFPTPSPSPIPPTPTPTPPPSPIPPTPTPSPIPPTPTPPPSPIPPTPTPTPPPSPIPP 136

Query: 134 SPS 126
           +P+
Sbjct: 137 TPT 139

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 45/111 (40%), Positives = 57/111 (51%), Gaps = 11/111 (9%)
 Frame = -3

Query: 431 LAQAPTAAPTK-PPTATPAPTAQPPAAATP-PTATPPTA-----TPPAAVPAPATPAPAS 273
           L  +PT  P+  PPT TP+P   PP+   P PT TPP +       P+  P P TP P  
Sbjct: 40  LPPSPTPPPSPLPPTPTPSP---PPSPIPPTPTPTPPPSPSPIFPTPSPSPIPPTPTPTP 96

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPT----PDSLGPGPSGADTPPS 132
            P+  PP PTP+  P T PTP  +  PP PT    P  + P P+   TPP+
Sbjct: 97  PPSPIPPTPTPSPIPPT-PTPPPSPIPPTPTPTPPPSPIPPTPTPTPTPPA 146

 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 30/79 (37%), Positives = 37/79 (46%), Gaps = 4/79 (5%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATP---PAAVPAPATPAPASS 270
           S +   PT +P  P PT  P+P    P    PP+  PPT TP   P A P P TP P   
Sbjct: 99  SPIPPTPTPSPIPPTPTPPPSPIPPTPTPTPPPSPIPPTPTPTPTPPASPIPPTPTP--- 155

Query: 269 PATSPPAPTPASTPSTAPT 213
             + PP+P P   P   P+
Sbjct: 156 --SPPPSPNPLGEPMYYPS 172

[127][TOP]
>UniRef100_Q0KDN2 Putative uncharacterized protein h16_A0741 n=1 Tax=Ralstonia
           eutropha H16 RepID=Q0KDN2_RALEH
          Length = 257

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 46/119 (38%), Positives = 58/119 (48%), Gaps = 6/119 (5%)
 Frame = -3

Query: 494 KMASSAAVQIFLILGLLATSCLAQAPTA----APTKPPTATPAPTAQPPAAATPPTATPP 327
           ++  + +  +  +L L+  +  AQAP      AP  P  ATPA T  P   AT P A P 
Sbjct: 28  RLVIALSAGVVALLALVPAASHAQAPVVEANPAPAAPAPATPAGTMAPTPGATMPAAPPA 87

Query: 326 TATPPAAVPAP--ATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGP 156
              PPA  PAP  A PA A+ P T+ PAP P  TP  AP P+   +P  P P    P P
Sbjct: 88  DTMPPATQPAPGIAAPATAAPPPTASPAPAPTGTPPAAPAPAPMAAPAQPRPPLTTPPP 146

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 45/94 (47%), Positives = 49/94 (52%), Gaps = 8/94 (8%)
 Frame = -3

Query: 452 GLLATSCLAQAPTAAP--TKPPTATPAP-TAQPPAAATPPTATP---PTATPPAA-VPAP 294
           G +A +  A  P A P  T PP   PAP  A P  AA PPTA+P   PT TPPAA  PAP
Sbjct: 71  GTMAPTPGATMPAAPPADTMPPATQPAPGIAAPATAAPPPTASPAPAPTGTPPAAPAPAP 130

Query: 293 -ATPAPASSPATSPPAPTPASTPSTAPTPSTAGS 195
            A PA    P T+PP P P      A    TAGS
Sbjct: 131 MAAPAQPRPPLTTPPPPPPRD----AMVQRTAGS 160

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 46/122 (37%), Positives = 53/122 (43%)
 Frame = -3

Query: 467 IFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT 288
           I L  G++A   L  A + A      A PAP A  PA      A  P AT PAA PA   
Sbjct: 31  IALSAGVVALLALVPAASHAQAPVVEANPAPAAPAPATPAGTMAPTPGATMPAAPPADTM 90

Query: 287 PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYS 108
           P     PAT P AP  A+ P+TA  P TA   PAPT            TPP+  A    +
Sbjct: 91  P-----PATQP-APGIAA-PATAAPPPTASPAPAPT-----------GTPPAAPAPAPMA 132

Query: 107 KP 102
            P
Sbjct: 133 AP 134

[128][TOP]
>UniRef100_A0PMP7 Conserved hypothetical secreted protein n=1 Tax=Mycobacterium
           ulcerans Agy99 RepID=A0PMP7_MYCUA
          Length = 403

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 59/143 (41%), Positives = 64/143 (44%), Gaps = 26/143 (18%)
 Frame = -3

Query: 422 APTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATP------PAAVPAPATPAPASSPA 264
           AP AAP   PP + PAP A  PA+A P TA  P A P      PA  PA A PAPA +PA
Sbjct: 160 APVAAPAGAPPASAPAPAAAAPASA-PGTAPAPAAAPGPAPAAPAPAPAAAAPAPAPAPA 218

Query: 263 TSP----------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
             P          PAP PA  P+ AP P  A   PAP P        G D PP+    F 
Sbjct: 219 APPAAPVAAPVAAPAPVPAPAPAAAPAPEAAAPAPAPAPAPAAAPGFGPDAPPTQD--FM 276

Query: 113 YSK---------PIIAATALSAA 72
           Y             I ATALS A
Sbjct: 277 YPSIGTNCLADGSNIIATALSVA 299

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 53/130 (40%), Positives = 65/130 (50%), Gaps = 8/130 (6%)
 Frame = -3

Query: 422 APTAAPTK--PPTATP-----APTAQPPAAATPPTATPPT-ATPPAAVPAPATPAPASSP 267
           AP AAP +  PP + P     AP A+P   A  P    P  A  PA V APA   PAS+P
Sbjct: 115 APAAAPVEVAPPASAPVPHVPAPGAEPGTLAHLPAGIDPAHAAGPAPVAAPAGAPPASAP 174

Query: 266 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAAT 87
           A  P A  PAS P TAP P+ A   P P P +  P P+ A   P+P+ A   + P+ A  
Sbjct: 175 A--PAAAAPASAPGTAPAPAAA---PGPAPAAPAPAPAAAAPAPAPAPAAPPAAPVAAPV 229

Query: 86  ALSAALFAIA 57
           A  A + A A
Sbjct: 230 AAPAPVPAPA 239

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 46/113 (40%), Positives = 49/113 (43%), Gaps = 17/113 (15%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPP--AAVPAPA-TPAPAS 273
           A +  A AP  AP  PP A   P A P AA  P  A  P A P   AA PAPA  PAPA+
Sbjct: 205 APAAAAPAPAPAPAAPPAA---PVAAPVAAPAPVPAPAPAAAPAPEAAAPAPAPAPAPAA 261

Query: 272 SPATSPPAPTPAS--TPS------------TAPTPSTAGSPPAPTPDSLGPGP 156
           +P   P AP       PS             A   S AG    PTP   GPGP
Sbjct: 262 APGFGPDAPPTQDFMYPSIGTNCLADGSNIIATALSVAGPATIPTP---GPGP 311

[129][TOP]
>UniRef100_B9RLA3 ATP binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RLA3_RICCO
          Length = 811

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 44/110 (40%), Positives = 57/110 (51%), Gaps = 1/110 (0%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATP-APTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
           +Q P+A    PP A   APT QPP A+ PPT +PP  +P A  P   +P P  SP   PP
Sbjct: 91  SQTPSAVVVSPPPANASAPTPQPPVASPPPTTSPPPPSPNADPPTSNSPPPPQSPVQLPP 150

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P  ++ P+T   P T+  PP+ TP +  P PS A  P +     S S P
Sbjct: 151 PPVSSTPPATPSDPPTSPPPPSNTP-TTSPPPSSARPPANSPPPASLSPP 199

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 42/110 (38%), Positives = 57/110 (51%), Gaps = 4/110 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPP-TATPPAAVPAPATPAPASSPATSPPAPT 243
           P  + T P T +  PT+ PP + TP T+ PP +A PPA  P PA+ +P      SPP P+
Sbjct: 151 PPVSSTPPATPSDPPTSPPPPSNTPTTSPPPSSARPPANSPPPASLSPPQESPPSPPPPS 210

Query: 242 ---PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
              P + PS  P P+T   PP  +P S  P P+    PP+ S+    S P
Sbjct: 211 SKPPENPPSPPPPPATPSEPPTNSPPSPPPPPATPSEPPTNSSPPPVSVP 260

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 44/101 (43%), Positives = 57/101 (56%), Gaps = 6/101 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAA-ATPPTATPPTATPPAAVPAP--ATPAPASSPATSPPA 249
           P A P++PPT +P     PPA  + PPT + P   PP +VP P  + P PA++P T+ P 
Sbjct: 223 PPATPSEPPTNSPPSPPPPPATPSEPPTNSSP---PPVSVPPPRRSPPGPAATPPTTSP- 278

Query: 248 PTPASTPSTAPTPSTAGSPP---APTPDSLGPGPSGADTPP 135
           P PASTP  +  P  A +PP    P P S+ P PS A  PP
Sbjct: 279 PPPASTPPASSPPPPASAPPENSPPPPASIAPTPSNAPPPP 319

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 46/107 (42%), Positives = 62/107 (57%), Gaps = 7/107 (6%)
 Frame = -3

Query: 419 PTAAPTKPPT-ATPAPTAQPPAAATPP--TATPPTATPPAAVPAPATPAPASS---PATS 258
           P A P++PPT ++P P + PP   +PP   ATPPT +PP     PA+  PASS   PA++
Sbjct: 241 PPATPSEPPTNSSPPPVSVPPPRRSPPGPAATPPTTSPPP----PASTPPASSPPPPASA 296

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTP-DSLGPGPSGADTPPSPSAA 120
           PP  +P    S APTPS A  PP  TP     P PS +++ P+ S +
Sbjct: 297 PPENSPPPPASIAPTPSNAPPPPGRTPFPPSQPTPSPSNSTPNASTS 343

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 46/127 (36%), Positives = 63/127 (49%), Gaps = 17/127 (13%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAP-----TAQPPAAATPPTATPPTA--TPPAAVPAPATPAPAS 273
           ++  P A P+ PPT+ P P     T+ PP++A PP  +PP A  +PP   P P+ P P+S
Sbjct: 153 VSSTPPATPSDPPTSPPPPSNTPTTSPPPSSARPPANSPPPASLSPPQESP-PSPPPPSS 211

Query: 272 SPATSPPA-PTPASTPSTAPTPSTAGSPPAPTPDSLGPG---------PSGADTPPSPSA 123
            P  +PP+ P P +TPS  PT S    PP P   S  P          P    +PP P+A
Sbjct: 212 KPPENPPSPPPPPATPSEPPTNSPPSPPPPPATPSEPPTNSSPPPVSVPPPRRSPPGPAA 271

Query: 122 AFSYSKP 102
               + P
Sbjct: 272 TPPTTSP 278

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 40/119 (33%), Positives = 59/119 (49%), Gaps = 6/119 (5%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATP--APASSPATSPPA 249
           +P  +  +PP  +P P +  P   +PP+  PP++ PP   P+P  P   P+  P  SPP+
Sbjct: 178 SPPPSSARPPANSPPPASLSPPQESPPSPPPPSSKPPENPPSPPPPPATPSEPPTNSPPS 237

Query: 248 -PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG---ADTPPSPSAAFSYSKPIIAATA 84
            P P +TPS  PT S+      P P    PGP+      +PP P++    S P   A+A
Sbjct: 238 PPPPPATPSEPPTNSSPPPVSVPPPRRSPPGPAATPPTTSPPPPASTPPASSPPPPASA 296

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 45/117 (38%), Positives = 58/117 (49%), Gaps = 12/117 (10%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATP---PTATPPTAT--PPAAVPAPATPAPAS 273
           S +  +P  A    PT  P   + PP  + P   P A PPT+   PP   P    P P S
Sbjct: 95  SAVVVSPPPANASAPTPQPPVASPPPTTSPPPPSPNADPPTSNSPPPPQSPVQLPPPPVS 154

Query: 272 S--PAT--SPPA--PTPASTPSTAPTPSTAGSPP-APTPDSLGPGPSGADTPPSPSA 123
           S  PAT   PP   P P++TP+T+P PS+A  P  +P P SL P      +PP PS+
Sbjct: 155 STPPATPSDPPTSPPPPSNTPTTSPPPSSARPPANSPPPASLSPPQESPPSPPPPSS 211

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 40/114 (35%), Positives = 53/114 (46%), Gaps = 10/114 (8%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAAT----PPTATPPTATPPAAVPAPATPAPASSPA 264
           L  +P   P     +TP+P +Q P+A      P  A+ PT  PP A P P T  P  SP 
Sbjct: 71  LTTSPIPQPNVTTPSTPSPPSQTPSAVVVSPPPANASAPTPQPPVASPPPTTSPPPPSPN 130

Query: 263 TSPP---APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP---PSPSAA 120
             PP   +P P  +P   P P  + +PPA   D     P  ++TP   P PS+A
Sbjct: 131 ADPPTSNSPPPPQSPVQLPPPPVSSTPPATPSDPPTSPPPPSNTPTTSPPPSSA 184

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 50/159 (31%), Positives = 73/159 (45%), Gaps = 18/159 (11%)
 Frame = -3

Query: 548 LSFTHTTFLSKF*ISLHPKMASSAAVQI------------FLILGLLATSCLAQAPTAAP 405
           L+F H  ++S+  + L P    S + ++            FL+L +      +    ++P
Sbjct: 7   LNFAHY-YISRVKLKLRPPKEKSKSEEVQEQSKPVQKDFSFLLLRIKEVVIESPPLQSSP 65

Query: 404 TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPS 225
             P   T +P  QP    TP T +PP+ TP A V +P  PA AS+P   PP  +P  T S
Sbjct: 66  PPPDPLTTSPIPQPNVT-TPSTPSPPSQTPSAVVVSP-PPANASAPTPQPPVASPPPTTS 123

Query: 224 TAP-----TPSTAGSPPAP-TPDSLGPGPSGADTPPSPS 126
             P      P T+ SPP P +P  L P P  +  P +PS
Sbjct: 124 PPPPSPNADPPTSNSPPPPQSPVQLPPPPVSSTPPATPS 162

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 40/101 (39%), Positives = 54/101 (53%), Gaps = 12/101 (11%)
 Frame = -3

Query: 395 PTATPAPTAQPPAAATPPTATPP---TATPPAAVPAPATPAPASSPATSPP--APTPAST 231
           P ATP  T+ PP A+TPP ++PP   +A P  + P PA+ AP  S A  PP   P P S 
Sbjct: 269 PAATPPTTSPPPPASTPPASSPPPPASAPPENSPPPPASIAPTPSNAPPPPGRTPFPPSQ 328

Query: 230 PSTAP---TPSTAGSPP----APTPDSLGPGPSGADTPPSP 129
           P+ +P   TP+ + SPP    +P P SL   P   +   +P
Sbjct: 329 PTPSPSNSTPNASTSPPLITLSPPPPSLSSAPPSDNNTSAP 369

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 40/102 (39%), Positives = 48/102 (47%), Gaps = 5/102 (4%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTA----TPPAAVPAPA-TPAPASSPA 264
           A  PT +P  P +  PA +  PPA+A P  + PP A    TP  A P P  TP P S P 
Sbjct: 271 ATPPTTSPPPPASTPPASSPPPPASAPPENSPPPPASIAPTPSNAPPPPGRTPFPPSQPT 330

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 138
            SP   TP    ST+P P    SPP P+  S  P  +    P
Sbjct: 331 PSPSNSTP--NASTSP-PLITLSPPPPSLSSAPPSDNNTSAP 369

[130][TOP]
>UniRef100_A9SIY2 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SIY2_PHYPA
          Length = 741

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 62/156 (39%), Positives = 74/156 (47%), Gaps = 36/156 (23%)
 Frame = -3

Query: 419 PTAAPTKPPTATPA---PTAQPPAAATPPT--ATPPTATPPAAV---PAPATPAPAS--- 273
           P A P   P ATP    PTA  P AATPP   A PPTATPPA V   PA + PAP +   
Sbjct: 36  PVATPPTIPPATPVVNPPTATVPPAATPPVPVAVPPTATPPAPVAVSPALSPPAPVAVPP 95

Query: 272 ------------------SPATSPPAPTPASTPSTAPTPSTA--GSPPAPTPDSLGP--- 162
                              PA SPP+PT +S P   P P +A  G+PP+P   S  P   
Sbjct: 96  TLSPPPPDALPPSVSTPPPPALSPPSPTSSSPPQPTPVPPSAPGGTPPSPILLSPPPAVN 155

Query: 161 --GPSGADTPPSPSAAFSYSKPIIAATALSAALFAI 60
              P  A TPP+ +++ S S  IIA      AL A+
Sbjct: 156 RTSPPAALTPPASTSSNSSSTAIIAGVVGGGALLAL 191

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 50/116 (43%), Positives = 56/116 (48%), Gaps = 15/116 (12%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           A  PT+    P  + P P A PP A  PP   PP ATPP  +P PATP      AT PPA
Sbjct: 3   ATPPTSGGVPPVVSPPTPNAVPPVAVNPPVVPPPVATPP-TIP-PATPVVNPPTATVPPA 60

Query: 248 ---PTPASTPSTAPTP-----STAGSPPAP--TPDSLGPGPSGA-----DTPPSPS 126
              P P + P TA  P     S A SPPAP   P +L P P  A      TPP P+
Sbjct: 61  ATPPVPVAVPPTATPPAPVAVSPALSPPAPVAVPPTLSPPPPDALPPSVSTPPPPA 116

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 41/108 (37%), Positives = 49/108 (45%), Gaps = 3/108 (2%)
 Frame = -3

Query: 392 TATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPT 213
           +ATP  +   P   +PPT   P A PP AV  P  P P ++P T      P +TP     
Sbjct: 2   SATPPTSGGVPPVVSPPT---PNAVPPVAVNPPVVPPPVATPPT-----IPPATP--VVN 51

Query: 212 PSTAGSPPAPTPDSLGPGPSGADTPPSP---SAAFSYSKPIIAATALS 78
           P TA  PPA TP      P  A TPP+P   S A S   P+     LS
Sbjct: 52  PPTATVPPAATPPVPVAVPPTA-TPPAPVAVSPALSPPAPVAVPPTLS 98

[131][TOP]
>UniRef100_C9S569 Predicted protein n=1 Tax=Verticillium albo-atrum VaMs.102
           RepID=C9S569_9PEZI
          Length = 459

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 54/120 (45%), Positives = 63/120 (52%), Gaps = 5/120 (4%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-P 252
           A AP  AP   P   PAP A  PA A  P   P  A  PA  PAPA PAPA +PA +P P
Sbjct: 322 APAPAPAPKPAPAPKPAP-APKPAPAPAPAPAPKPAPAPAPAPAPA-PAPAPAPAPAPAP 379

Query: 251 APTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTP-PSPSAAFSYSKPIIAATA 84
           AP PA  P+ AP P+ A +P   PAP P+   P P  A  P P P  A   +KP +  T+
Sbjct: 380 APAPAPAPAPAPAPAPAPAPAPAPAPAPE---PAPKPAPAPKPVPVPAPEPAKPTVVDTS 436

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 50/107 (46%), Positives = 57/107 (53%), Gaps = 4/107 (3%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPATPAPASSPATSP- 255
           A AP  AP   P   PAP   P PA A  P   P  A  PA  PAP  PAPA +PA +P 
Sbjct: 308 APAPKPAPAPKPAPAPAPAPAPKPAPAPKPAPAPKPAPAPAPAPAPK-PAPAPAPAPAPA 366

Query: 254 PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
           PAP PA  P+ AP P+ A +P PAP P    P P+ A  P P+P  A
Sbjct: 367 PAPAPAPAPAPAPAPAPAPAPAPAPAP---APAPAPAPAPAPAPEPA 410

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 50/110 (45%), Positives = 59/110 (53%), Gaps = 7/110 (6%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP---PAAVPAPAT-PAPASSPAT 261
           A AP  AP   P   PAP  +P  A  P  A  P   P   PA  PAPA  PAPA +PA 
Sbjct: 292 APAPAPAPAPAPAPKPAPAPKPAPAPKPAPAPAPAPAPKPAPAPKPAPAPKPAPAPAPAP 351

Query: 260 SP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
           +P PAP PA  P+ AP P+ A +P PAP P    P P+ A  P P+P+ A
Sbjct: 352 APKPAPAPAPAPAPAPAPAPAPAPAPAPAP---APAPAPAPAPAPAPAPA 398

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 50/109 (45%), Positives = 58/109 (53%), Gaps = 6/109 (5%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPATPAPASSPATSP- 255
           A AP  AP   P   PAP  +P PA A  P   P  A  PA  P PA PAPA +PA  P 
Sbjct: 298 APAPAPAPKPAPAPKPAPAPKPAPAPAPAPAPKPAPAPKPAPAPKPA-PAPAPAPAPKPA 356

Query: 254 --PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
             PAP PA  P+ AP P+ A +P PAP P    P P+ A  P P+P+ A
Sbjct: 357 PAPAPAPAPAPAPAPAPAPAPAPAPAPAP---APAPAPAPAPAPAPAPA 402

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 50/109 (45%), Positives = 56/109 (51%), Gaps = 6/109 (5%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPATPAPASSPATSP- 255
           A AP  AP   P   PAP   P PA A  P   P  A  PA  PAP  PAPA  PA +P 
Sbjct: 284 APAPQPAPAPAPAPAPAPAPAPKPAPAPKPAPAPKPAPAPAPAPAPK-PAPAPKPAPAPK 342

Query: 254 --PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
             PAP PA  P  AP P+ A +P PAP P    P P+ A  P P+P+ A
Sbjct: 343 PAPAPAPAPAPKPAPAPAPAPAPAPAPAP---APAPAPAPAPAPAPAPA 388

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 48/106 (45%), Positives = 54/106 (50%), Gaps = 6/106 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPATPAPASSPATSP---P 252
           P  AP   P   PAP   P PA A  P   P  A  P   PAPA PAPA  PA +P   P
Sbjct: 281 PVPAPAPQPAPAPAPAPAPAPAPAPKPAPAPKPAPAPKPAPAPA-PAPAPKPAPAPKPAP 339

Query: 251 APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
           AP PA  P+ AP P  A +P PAP P    P P+ A  P P+P+ A
Sbjct: 340 APKPAPAPAPAPAPKPAPAPAPAPAP---APAPAPAPAPAPAPAPA 382

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 47/121 (38%), Positives = 56/121 (46%), Gaps = 10/121 (8%)
 Frame = -3

Query: 452 GLLATSCLAQAPTAAPTK-----PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT 288
           G   T+ +   PT  P       PP  T  P    PA A  P   P  A  PA  PAP  
Sbjct: 248 GKKTTTTIPSKPTQVPVPNCPACPPQVTYVPVVPVPAPAPQPAPAPAPAPAPAPAPAPK- 306

Query: 287 PAPASSPATSP-PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTP-PSPSA 123
           PAPA  PA +P PAP PA  P+  P P+   +P   PAP P +  P P  A  P P+P+ 
Sbjct: 307 PAPAPKPAPAPKPAPAPAPAPAPKPAPAPKPAPAPKPAPAP-APAPAPKPAPAPAPAPAP 365

Query: 122 A 120
           A
Sbjct: 366 A 366

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 40/90 (44%), Positives = 44/90 (48%), Gaps = 2/90 (2%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPATPAPASSPATSP- 255
           A AP  AP   P   PAP   P PA A  P   P  A  PA  PAPA PAPA +PA +P 
Sbjct: 350 APAPKPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPA-PAPAPAPAPAPE 408

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLG 165
           PAP PA  P   P P+   + P     S G
Sbjct: 409 PAPKPAPAPKPVPVPAPEPAKPTVVDTSAG 438

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 38/83 (45%), Positives = 41/83 (49%), Gaps = 5/83 (6%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPAT-PAPASSPATSP 255
           A AP  AP   P   PAP   P PA A  P   P  A  PA  PAPA  PAP  +PA  P
Sbjct: 360 APAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPEPAPKPAPAPKP 419

Query: 254 ---PAPTPASTPSTAPTPSTAGS 195
              PAP PA  P+   T  +AGS
Sbjct: 420 VPVPAPEPAK-PTVVDT--SAGS 439

[132][TOP]
>UniRef100_A8PA86 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130
           RepID=A8PA86_COPC7
          Length = 1049

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 52/113 (46%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = -3

Query: 440 TSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-TPAPASS 270
           +S +   P  AP  T  P A PAPT  PPAA  P  A  PT  PP A PAPA  PAPA +
Sbjct: 146 SSVVPHPPALAPARTPSPAAAPAPTGAPPAAPAPAVAPAPTGAPPPA-PAPAVAPAPAGA 204

Query: 269 PATSPPAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPSPSAA 120
           P   PPAP PA  P+ AP P  AG+P   P P P +  P P G  +    S A
Sbjct: 205 P---PPAPAPAGAPAVAPAP--AGAPATGPVPAPPAPTPAPRGQTSHAQNSMA 252

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 53/145 (36%), Positives = 66/145 (45%), Gaps = 26/145 (17%)
 Frame = -3

Query: 428 AQAPTAAP--TKPPTATPAPTAQPPAAATP-----PTATPPTATPPAAVPAPATPAPASS 270
           A APT AP     P   PAPT  PP A  P     P   PP A  PA  PA A PAPA +
Sbjct: 166 APAPTGAPPAAPAPAVAPAPTGAPPPAPAPAVAPAPAGAPPPAPAPAGAPAVA-PAPAGA 224

Query: 269 PAT----SPPAPTPASTPSTAPTPSTAGSPPAP----------TPDSLGPGPSGADTPPS 132
           PAT    +PPAPTPA    T+   ++   PP P          TP  + P P+      +
Sbjct: 225 PATGPVPAPPAPTPAPRGQTSHAQNSMAPPPVPVNQSPQKKTRTPRKVVPIPNRYSLRNT 284

Query: 131 P-----SAAFSYSKPIIAATALSAA 72
           P     SA+ + S P+ A    S++
Sbjct: 285 PKRIEASASAAASAPVPAPALASSS 309

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 45/114 (39%), Positives = 57/114 (50%), Gaps = 18/114 (15%)
 Frame = -3

Query: 407 PTKP--PTATPAPTAQPPAAATP-PTATPPTATP-PAAVPAPATPAPASSPATSPPAPTP 240
           P +P  P A  A T   P++  P P A  P  TP PAA PAP T AP ++PA +  AP P
Sbjct: 128 PPQPFDPRAIFAQTHNYPSSVVPHPPALAPARTPSPAAAPAP-TGAPPAAPAPAV-APAP 185

Query: 239 ASTPSTAPTPSTA-----GSPPAPTP---DSLGPGPSGA------DTPPSPSAA 120
              P  AP P+ A       PPAP P    ++ P P+GA        PP+P+ A
Sbjct: 186 TGAPPPAPAPAVAPAPAGAPPPAPAPAGAPAVAPAPAGAPATGPVPAPPAPTPA 239

[133][TOP]
>UniRef100_A7H9N7 Heavy metal translocating P-type ATPase n=1 Tax=Anaeromyxobacter
           sp. Fw109-5 RepID=A7H9N7_ANADF
          Length = 944

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 55/140 (39%), Positives = 67/140 (47%), Gaps = 13/140 (9%)
 Frame = -3

Query: 452 GLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPA 276
           G++AT  +   PT  PT  PTATP PT  P    TP PT TP + + P   P   TP P 
Sbjct: 577 GVVAT--VRATPTPTPTATPTATPTPTPTPTPTPTPTPTPTPTSTSTPTPTP---TPTPT 631

Query: 275 SSPATSPPAPTPASTPSTAPTP-------STAGSPPAPTPDSLG-----PGPSGADTPPS 132
           ++P T  P PTP  TP+  PTP       ST+ S P PTP         P  +   T  S
Sbjct: 632 ATP-TPTPTPTPTPTPTPTPTPTPTPTSTSTSTSTPTPTPTPTSTPTSTPTSTSTSTSTS 690

Query: 131 PSAAFSYSKPIIAATALSAA 72
            S A S S P   +T+ S A
Sbjct: 691 TSTATSTSTPTSTSTSTSTA 710

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 49/138 (35%), Positives = 65/138 (47%), Gaps = 9/138 (6%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPA---TPA 282
            AT      PT  PT  PT TP  T+ P    TP PTATP PT TP P   P P    TP 
Sbjct: 596  ATPTPTPTPTPTPTPTPTPTPTSTSTPTPTPTPTPTATPTPTPTPTPTPTPTPTPTPTPT 655

Query: 281  PAS---SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSY 111
            P S   S +T  P PTP STP++ PT ++  +  + +  +    P+   T  S + + S 
Sbjct: 656  PTSTSTSTSTPTPTPTPTSTPTSTPTSTSTSTSTSTSTATSTSTPTSTSTSTSTATSTST 715

Query: 110  SKPIIAATALSAALFAIA 57
            S+ ++       A   IA
Sbjct: 716  SRAVLIGNRALLADHGIA 733

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 46/128 (35%), Positives = 57/128 (44%), Gaps = 14/128 (10%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSP-PAPTP 240
           A P +   AT   T  P   ATP     PT TP P   P P TP P S+   +P P PTP
Sbjct: 572 AVPGRGVVATVRATPTPTPTATPTATPTPTPTPTPTPTPTP-TPTPTSTSTPTPTPTPTP 630

Query: 239 ASTPSTAPTPSTAGSP-----PAPTPDSLG-------PGPSGADTPPSPSAAFSYSKPII 96
            +TP+  PTP+   +P     P PTP S         P P+   TP S   + S S    
Sbjct: 631 TATPTPTPTPTPTPTPTPTPTPTPTPTSTSTSTSTPTPTPTPTSTPTSTPTSTSTSTSTS 690

Query: 95  AATALSAA 72
            +TA S +
Sbjct: 691 TSTATSTS 698

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 41/123 (33%), Positives = 51/123 (41%), Gaps = 5/123 (4%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP- 255
           +A+A  A P           A P           PT TP A   A  TP P  +P  +P 
Sbjct: 552 IAEAARALPEAAAVEVEGFRAVPGRGVVATVRATPTPTPTATPTATPTPTPTPTPTPTPT 611

Query: 254 --PAPTPASTPSTAPTPSTAGSP-PAPTP-DSLGPGPSGADTPPSPSAAFSYSKPIIAAT 87
             P PT  STP+  PTP+   +P P PTP  +  P P+   TP   S + S S P    T
Sbjct: 612 PTPTPTSTSTPTPTPTPTPTATPTPTPTPTPTPTPTPTPTPTPTPTSTSTSTSTPTPTPT 671

Query: 86  ALS 78
             S
Sbjct: 672 PTS 674

[134][TOP]
>UniRef100_Q9ASK4 Os01g0110500 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q9ASK4_ORYSJ
          Length = 698

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 51/123 (41%), Positives = 62/123 (50%), Gaps = 12/123 (9%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPP---AAVPAPATPAPASSPATSPPA 249
           P  A   P TATP P  QP A    P+ TPP A+PP   AA P P   +P  SP  +PP 
Sbjct: 14  PATAAAAPSTATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPDSPPPSPPPAPPV 73

Query: 248 --PTPASTP-------STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPII 96
             P PA+ P       S  PTPS    PP+P P S+   P+ A TPP PS      +P +
Sbjct: 74  AVPPPATVPPPPVPVASPPPTPSATLPPPSP-PASVPVPPTPATTPPKPSPV---QQPPV 129

Query: 95  AAT 87
           AA+
Sbjct: 130 AAS 132

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 52/127 (40%), Positives = 61/127 (48%), Gaps = 28/127 (22%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPP----AAATPPT--ATPPTATPPAAVPAPATPA---PASSP 267
           P + P  PP A P P   PP     A+ PPT  AT P  +PPA+VP P TPA   P  SP
Sbjct: 64  PPSPPPAPPVAVPPPATVPPPPVPVASPPPTPSATLPPPSPPASVPVPPTPATTPPKPSP 123

Query: 266 ------ATSPPAPTPASTPSTAP-----TPSTAGSPPAP------TP--DSLGPGPSGAD 144
                 A SPP  +PA  P   P     TP    SPP P      TP    + P PSG+ 
Sbjct: 124 VQQPPVAASPPPSSPADLPPPNPPARSDTPPVVQSPPPPHRRSPRTPWAPPMAPSPSGSP 183

Query: 143 TPPSPSA 123
           T PSP++
Sbjct: 184 TKPSPAS 190

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 46/113 (40%), Positives = 53/113 (46%), Gaps = 18/113 (15%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT-PPAAVPAPATPA------------P 279
           P A+P  P  ATP P    P  + PP   PP A  PPA VP P  P             P
Sbjct: 44  PAASPPLPSAATPPPQPDSPPPSPPPA--PPVAVPPPATVPPPPVPVASPPPTPSATLPP 101

Query: 278 ASSPATSPPAPTPAST---PSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPP 135
            S PA+ P  PTPA+T   PS    P  A SPP  +P  L P   P+ +DTPP
Sbjct: 102 PSPPASVPVPPTPATTPPKPSPVQQPPVAASPPPSSPADLPPPNPPARSDTPP 154

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 41/110 (37%), Positives = 50/110 (45%), Gaps = 10/110 (9%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPA--PTAQPPAAATPPTATP---PTATPPAAVPAPATPAPA---S 273
           A  P   P  PP + P   P A PP A  PP   P   P  TP A +P P+ PA      
Sbjct: 53  AATPPPQPDSPPPSPPPAPPVAVPPPATVPPPPVPVASPPPTPSATLPPPSPPASVPVPP 112

Query: 272 SPATSPPAPTPASTPSTA--PTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           +PAT+PP P+P   P  A  P PS+    P P P +    P    +PP P
Sbjct: 113 TPATTPPKPSPVQQPPVAASPPPSSPADLPPPNPPARSDTPPVVQSPPPP 162

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 39/123 (31%), Positives = 57/123 (46%), Gaps = 11/123 (8%)
 Frame = -3

Query: 419 PTAAPTKPPTAT----PAPTAQPPAAATPPTATP---PTATPPAAVPAP----ATPAPAS 273
           P + P  P  AT    P+P  QPP AA+PP ++P   P   PPA    P    + P P  
Sbjct: 105 PASVPVPPTPATTPPKPSPVQQPPVAASPPPSSPADLPPPNPPARSDTPPVVQSPPPPHR 164

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
               +P AP  A +PS +PT  +  SP     D + P P+   +P +  +A     P++ 
Sbjct: 165 RSPRTPWAPPMAPSPSGSPTKPSPASPSPIAGDPIIPTPNNPSSPLATPSAPGSGTPVVT 224

Query: 92  ATA 84
            +A
Sbjct: 225 PSA 227

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 45/119 (37%), Positives = 57/119 (47%), Gaps = 20/119 (16%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPP-----------TATPPTATPPAAVPAPATPAPAS 273
           PT + T PP + PA    PP  AT P            A+PP ++ PA +P P  PA + 
Sbjct: 93  PTPSATLPPPSPPASVPVPPTPATTPPKPSPVQQPPVAASPPPSS-PADLPPPNPPARSD 151

Query: 272 SP--ATSPPAPTPAS--TPSTAP-TPSTAGSPPAPTPDSLGPGPSGAD----TPPSPSA 123
           +P    SPP P   S  TP   P  PS +GSP  P+P S  P P   D    TP +PS+
Sbjct: 152 TPPVVQSPPPPHRRSPRTPWAPPMAPSPSGSPTKPSPAS--PSPIAGDPIIPTPNNPSS 208

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 38/122 (31%), Positives = 54/122 (44%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
           +A +P+ +PTKP  A+P+P A  P   TP   + P ATP A  P   TP    S   S P
Sbjct: 175 MAPSPSGSPTKPSPASPSPIAGDPIIPTPNNPSSPLATPSA--PGSGTPVVTPSAPVSGP 232

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
            P+P + P+TA   S     P     S+     G  +  S  A       I+  + + AA
Sbjct: 233 -PSPGTAPATAADRSNKSLSPNTQDGSVSSSDGGMSS--SAKAGIGVVVAILVLSLVGAA 289

Query: 71  LF 66
            +
Sbjct: 290 FW 291

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 33/80 (41%), Positives = 43/80 (53%), Gaps = 2/80 (2%)
 Frame = -3

Query: 353 ATPPTATPPTATPP--AAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPT 180
           A+ P+ +P TATP   AA P+ ATP PA+ P  +P    P+ TP  A  P  + + P P 
Sbjct: 2   ASSPSPSPGTATPATAAAAPSTATPTPATQPNATP--ADPSITPPAASPPLPSAATPPPQ 59

Query: 179 PDSLGPGPSGADTPPSPSAA 120
           PDS  P P     PP+P  A
Sbjct: 60  PDSPPPSP-----PPAPPVA 74

 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 38/119 (31%), Positives = 49/119 (41%), Gaps = 18/119 (15%)
 Frame = -3

Query: 425 QAPTAAPTKPPTA--------TPAPTAQPPAAATPPTA---------TPPTATPPAAVPA 297
           Q P  A + PP++         PA +  PP   +PP            PP A  P+  P 
Sbjct: 125 QQPPVAASPPPSSPADLPPPNPPARSDTPPVVQSPPPPHRRSPRTPWAPPMAPSPSGSPT 184

Query: 296 PATPAPASSPATSPPAPTPASTPSTAPTPSTAGS-PPAPTPDSLGPGPSGADTPPSPSA 123
             +PA  S  A  P  PTP +  S   TPS  GS  P  TP +   GP    T P+ +A
Sbjct: 185 KPSPASPSPIAGDPIIPTPNNPSSPLATPSAPGSGTPVVTPSAPVSGPPSPGTAPATAA 243

[135][TOP]
>UniRef100_C5XVG5 Putative uncharacterized protein Sb04g004330 n=1 Tax=Sorghum
           bicolor RepID=C5XVG5_SORBI
          Length = 278

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 44/122 (36%), Positives = 64/122 (52%), Gaps = 3/122 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P ++ T PP+++PAP  + P  A+PP   PP  + P   P+   PA +S PA S  +P P
Sbjct: 151 PVSSTTPPPSSSPAPPTKAPTTASPPALLPPAGSAPTKTPSTPPPASSSPPAPSASSPAP 210

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSK---PIIAATALSAAL 69
           AS+ ST P PS +    +P P + G   +   TP SP A  S  K    +  AT L+++ 
Sbjct: 211 ASSTSTPPPPSAS----SPAPSAHGATANSTGTPSSPPAGASKDKNGAALTVATGLASSF 266

Query: 68  FA 63
            A
Sbjct: 267 GA 268

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 44/100 (44%), Positives = 52/100 (52%), Gaps = 10/100 (10%)
 Frame = -3

Query: 389 ATPAPTAQPPAAATPPTATP-------PTATPPAAVPAPATPAP--ASSPATSPPA-PTP 240
           AT +    P  +  PP A+P        T  PP++ PAP T AP  AS PA  PPA   P
Sbjct: 127 ATRSNGTAPAPSTAPPPASPASPPPVSSTTPPPSSSPAPPTKAPTTASPPALLPPAGSAP 186

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
             TPST P  S+  SPPAP+  S  P  S   TPP PSA+
Sbjct: 187 TKTPSTPPPASS--SPPAPSASSPAPA-SSTSTPPPPSAS 223

[136][TOP]
>UniRef100_C5XS10 Putative uncharacterized protein Sb04g033190 n=1 Tax=Sorghum
           bicolor RepID=C5XS10_SORBI
          Length = 160

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 53/127 (41%), Positives = 62/127 (48%), Gaps = 15/127 (11%)
 Frame = -3

Query: 461 LILGLLATSCLAQ---------APTAAPTK-----PPTATPAPTAQPPAAATPPTATPPT 324
           L+L LL  SC AQ          P A P+      PP   P P  Q P A  PP A  PT
Sbjct: 8   LVLALLIASCAAQQSPPAQPPPTPNAPPSNSPPQAPPAGNPPPAPQAPPAGNPPPA--PT 65

Query: 323 ATPPAAVPAPATPAPASSPATSPPAP-TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA 147
           ATPP   PAP +  P + P T PPAP TP   P T P P+   +PP+  P    P P+ A
Sbjct: 66  ATPP---PAPTSTPPPAPPTTPPPAPTTPPPAPPTTPPPAPT-TPPSSPPSPKAPSPAAA 121

Query: 146 DTPPSPS 126
            T P+PS
Sbjct: 122 -TSPAPS 127

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 53/106 (50%), Positives = 60/106 (56%), Gaps = 4/106 (3%)
 Frame = -3

Query: 425 QAPTAA-PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           QAP A  P   PTATP     PPA    PT+TPP A P    PAP TP PA  P T PPA
Sbjct: 53  QAPPAGNPPPAPTATP-----PPA----PTSTPPPAPPTTPPPAPTTPPPA-PPTTPPPA 102

Query: 248 PT--PASTPS-TAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
           PT  P+S PS  AP+P+ A S PAP+    G  P+G D+  S  AA
Sbjct: 103 PTTPPSSPPSPKAPSPAAATS-PAPSLSPTGT-PTGEDSGASARAA 146

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 43/121 (35%), Positives = 53/121 (43%), Gaps = 8/121 (6%)
 Frame = -3

Query: 410 APTKPPTATPAPTAQPPAAATPPTATPPTA------TPPAAVPA-PATPAPASSPATSPP 252
           AP   P       A   A  +PP   PPT       +PP A PA    PAP + PA +PP
Sbjct: 2   APLLRPLVLALLIASCAAQQSPPAQPPPTPNAPPSNSPPQAPPAGNPPPAPQAPPAGNPP 61

Query: 251 APTPASTPSTAPTPSTAGSPP-APTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSA 75
            P P +TP  APT +   +PP  P P    P P+   TPP        S P   A + +A
Sbjct: 62  -PAPTATPPPAPTSTPPPAPPTTPPPAPTTPPPAPPTTPPPAPTTPPSSPPSPKAPSPAA 120

Query: 74  A 72
           A
Sbjct: 121 A 121

[137][TOP]
>UniRef100_B8ACV5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8ACV5_ORYSI
          Length = 698

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 51/123 (41%), Positives = 62/123 (50%), Gaps = 12/123 (9%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPP---AAVPAPATPAPASSPATSPPA 249
           P  A   P TATP P  QP A    P+ TPP A+PP   AA P P   +P  SP  +PP 
Sbjct: 14  PATAAAAPSTATPTPATQPNATPADPSITPPAASPPLPSAATPPPQPDSPPPSPPPAPPV 73

Query: 248 --PTPASTP-------STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPII 96
             P PA+ P       S  PTPS    PP+P P S+   P+ A TPP PS      +P +
Sbjct: 74  AVPPPATVPPPPVPVASPPPTPSATLPPPSP-PASVPVPPTPATTPPKPSPV---QQPPV 129

Query: 95  AAT 87
           AA+
Sbjct: 130 AAS 132

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 52/127 (40%), Positives = 61/127 (48%), Gaps = 28/127 (22%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPP----AAATPPT--ATPPTATPPAAVPAPATPA---PASSP 267
           P + P  PP A P P   PP     A+ PPT  AT P  +PPA+VP P TPA   P  SP
Sbjct: 64  PPSPPPAPPVAVPPPATVPPPPVPVASPPPTPSATLPPPSPPASVPVPPTPATTPPKPSP 123

Query: 266 ------ATSPPAPTPASTPSTAP-----TPSTAGSPPAP------TP--DSLGPGPSGAD 144
                 A SPP  +PA  P   P     TP    SPP P      TP    + P PSG+ 
Sbjct: 124 VQQPPVAASPPPSSPADLPPPNPPARSDTPPVVQSPPPPHRRSPRTPWAPPMAPSPSGSP 183

Query: 143 TPPSPSA 123
           T PSP++
Sbjct: 184 TKPSPAS 190

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 46/113 (40%), Positives = 53/113 (46%), Gaps = 18/113 (15%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT-PPAAVPAPATPA------------P 279
           P A+P  P  ATP P    P  + PP   PP A  PPA VP P  P             P
Sbjct: 44  PAASPPLPSAATPPPQPDSPPPSPPPA--PPVAVPPPATVPPPPVPVASPPPTPSATLPP 101

Query: 278 ASSPATSPPAPTPAST---PSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPP 135
            S PA+ P  PTPA+T   PS    P  A SPP  +P  L P   P+ +DTPP
Sbjct: 102 PSPPASVPVPPTPATTPPKPSPVQQPPVAASPPPSSPADLPPPNPPARSDTPP 154

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 41/110 (37%), Positives = 50/110 (45%), Gaps = 10/110 (9%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPA--PTAQPPAAATPPTATP---PTATPPAAVPAPATPAPA---S 273
           A  P   P  PP + P   P A PP A  PP   P   P  TP A +P P+ PA      
Sbjct: 53  AATPPPQPDSPPPSPPPAPPVAVPPPATVPPPPVPVASPPPTPSATLPPPSPPASVPVPP 112

Query: 272 SPATSPPAPTPASTPSTA--PTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           +PAT+PP P+P   P  A  P PS+    P P P +    P    +PP P
Sbjct: 113 TPATTPPKPSPVQQPPVAASPPPSSPADLPPPNPPARSDTPPVVQSPPPP 162

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 39/123 (31%), Positives = 56/123 (45%), Gaps = 11/123 (8%)
 Frame = -3

Query: 419 PTAAPTKPPTAT----PAPTAQPPAAATPPTATP---PTATPPAAVPAP----ATPAPAS 273
           P + P  P  AT    P+P  QPP AA+PP ++P   P   PPA    P    + P P  
Sbjct: 105 PASVPVPPTPATTPPKPSPVQQPPVAASPPPSSPADLPPPNPPARSDTPPVVQSPPPPHR 164

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
               +P AP  A +PS +PT  +  SP     D + P P+   +P +  +A     P++ 
Sbjct: 165 RSPRTPWAPPMAPSPSGSPTKPSPASPSPIAGDPIIPTPNNPSSPLATPSAPGSGTPVVT 224

Query: 92  ATA 84
             A
Sbjct: 225 PPA 227

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 45/119 (37%), Positives = 57/119 (47%), Gaps = 20/119 (16%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPP-----------TATPPTATPPAAVPAPATPAPAS 273
           PT + T PP + PA    PP  AT P            A+PP ++ PA +P P  PA + 
Sbjct: 93  PTPSATLPPPSPPASVPVPPTPATTPPKPSPVQQPPVAASPPPSS-PADLPPPNPPARSD 151

Query: 272 SP--ATSPPAPTPAS--TPSTAP-TPSTAGSPPAPTPDSLGPGPSGAD----TPPSPSA 123
           +P    SPP P   S  TP   P  PS +GSP  P+P S  P P   D    TP +PS+
Sbjct: 152 TPPVVQSPPPPHRRSPRTPWAPPMAPSPSGSPTKPSPAS--PSPIAGDPIIPTPNNPSS 208

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 33/80 (41%), Positives = 43/80 (53%), Gaps = 2/80 (2%)
 Frame = -3

Query: 353 ATPPTATPPTATPP--AAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPT 180
           A+ P+ +P TATP   AA P+ ATP PA+ P  +P    P+ TP  A  P  + + P P 
Sbjct: 2   ASSPSPSPGTATPATAAAAPSTATPTPATQPNATP--ADPSITPPAASPPLPSAATPPPQ 59

Query: 179 PDSLGPGPSGADTPPSPSAA 120
           PDS  P P     PP+P  A
Sbjct: 60  PDSPPPSP-----PPAPPVA 74

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 41/115 (35%), Positives = 51/115 (44%), Gaps = 13/115 (11%)
 Frame = -3

Query: 425 QAPTAAPTKPPTA-TPAPTAQPPAAA-TPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
           Q P  A + PP++    P   PPA + TPP    P      +   P  P  A SP+ SP 
Sbjct: 125 QQPPVAASPPPSSPADLPPPNPPARSDTPPVVQSPPPPHRRSPRTPWAPPMAPSPSGSPT 184

Query: 251 APTPASTPSTA-----PTPSTAGSPPAPTPDSLGPG------PSGADTPPSPSAA 120
            P+PAS    A     PTP+   SP A TP + G G      P+    PPSP  A
Sbjct: 185 KPSPASPSPIAGDPIIPTPNNPSSPLA-TPSAPGSGTPVVTPPAPVSGPPSPGTA 238

[138][TOP]
>UniRef100_B7PFZ0 Proteophosphoglycan, putative (Fragment) n=1 Tax=Ixodes scapularis
           RepID=B7PFZ0_IXOSC
          Length = 202

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 55/135 (40%), Positives = 70/135 (51%), Gaps = 6/135 (4%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTA-TPPTATPPAAVPAPAT---PAPA 276
           AT   A  P     K   ATPA  A P  AATP TA TP TA  PA    PAT   PA A
Sbjct: 33  ATPATAATPATPARKARAATPATAATPATAATPATAATPATAATPATAATPATAATPATA 92

Query: 275 SSPATS--PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           ++PAT+  P     A+TP+TA TP+T  +   P   +    P+ A TP +P+ A + ++ 
Sbjct: 93  ATPATAATPARKARAATPATAATPATPATAATPARKARAATPATAATPATPATAATPARK 152

Query: 101 IIAATALSAALFAIA 57
             AAT  +AA  A A
Sbjct: 153 ARAATPATAATPATA 167

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 56/136 (41%), Positives = 70/136 (51%), Gaps = 9/136 (6%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTA-TPPTATPPAAVPAPATPAPASSP 267
           AT   A  P  A T    ATPA  A P  AATP TA TP TA  PA     ATPA A++P
Sbjct: 57  ATPATAATPATAATPATAATPATAATPATAATPATAATPATAATPARKARAATPATAATP 116

Query: 266 ATSPPAPTPA-----STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP---PSPSAAFSY 111
           AT   A TPA     +TP+TA TP+T  +   P   +    P+ A TP    +P+ A + 
Sbjct: 117 ATPATAATPARKARAATPATAATPATPATAATPARKARAATPATAATPATAATPATAATP 176

Query: 110 SKPIIAATALSAALFA 63
           ++   AAT  +AA  A
Sbjct: 177 ARKARAATPATAATAA 192

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 56/141 (39%), Positives = 67/141 (47%), Gaps = 12/141 (8%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA----PATPAPA 276
           AT   A  P  A T    ATPA  A P  AATP TA  P     AA PA    PATPA A
Sbjct: 63  ATPATAATPATAATPATAATPATAATPATAATPATAATPARKARAATPATAATPATPATA 122

Query: 275 SSPATSPPAPTPAS-----TPSTAPTP---STAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
           ++PA    A TPA+     TP+TA TP   + A +P      +    P+ A TP   + A
Sbjct: 123 ATPARKARAATPATAATPATPATAATPARKARAATPATAATPATAATPATAATPARKARA 182

Query: 119 FSYSKPIIAATALSAALFAIA 57
              + P  AATA + A  A A
Sbjct: 183 ---ATPATAATAATPATAATA 200

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 53/126 (42%), Positives = 69/126 (54%), Gaps = 2/126 (1%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTA-TPAPTAQPPAAATPPTA-TPPTATPPAAVPAPATPAPASS 270
           A      A  A P  P TA TPA  A+   AATP TA TP TA  PA     ATPA A++
Sbjct: 20  AARAATPATAATPATPATAATPATPARKARAATPATAATPATAATPATA---ATPATAAT 76

Query: 269 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAA 90
           PAT+   P  A+TP+TA TP+TA +   P   +    P+ A TP +P+ A + ++   AA
Sbjct: 77  PATAA-TPATAATPATAATPATAAT---PARKARAATPATAATPATPATAATPARKARAA 132

Query: 89  TALSAA 72
           T  +AA
Sbjct: 133 TPATAA 138

 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 39/101 (38%), Positives = 53/101 (52%), Gaps = 1/101 (0%)
 Frame = -3

Query: 356 AATPPTATPPTATPPAAVPA-PATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPT 180
           AATP TA  P     AA PA PA  A A++PAT+   P  A+TP+TA TP+TA +P    
Sbjct: 23  AATPATAATPATPATAATPATPARKARAATPATAA-TPATAATPATAATPATAATPATAA 81

Query: 179 PDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAALFAIA 57
             +    P+ A TP + +     ++    ATA + A  A A
Sbjct: 82  TPATAATPATAATPATAATPARKARAATPATAATPATPATA 122

 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 39/90 (43%), Positives = 44/90 (48%), Gaps = 4/90 (4%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPP----TATPPTATPPAAVPAPATPAPA 276
           AT   A  P         AT A  A P  AATP      ATP TA  PA     ATPA A
Sbjct: 117 ATPATAATPARKARAATPATAATPATPATAATPARKARAATPATAATPATA---ATPATA 173

Query: 275 SSPATSPPAPTPASTPSTAPTPSTAGSPPA 186
           ++PA    A TPA T +TA TP+TA +  A
Sbjct: 174 ATPARKARAATPA-TAATAATPATAATAAA 202

[139][TOP]
>UniRef100_UPI000069F8DC UPI000069F8DC related cluster n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI000069F8DC
          Length = 171

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 43/130 (33%), Positives = 71/130 (54%), Gaps = 9/130 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS---PATSPP 252
           +P+A P  P    P+P+A PP+ + P + + P  +P A  P+P+ P P+ S   P+ S P
Sbjct: 21  SPSAPPPSPSAPPPSPSAPPPSPSAPSSPSAPPPSPSAPPPSPSAPPPSPSAPPPSPSAP 80

Query: 251 APTPASTPSTAPTPSTAGSPPA----PTPDSLGPGPSGADTPPSPSAAFSY--SKPIIAA 90
            P+P++ P +   PS    PP+    P P  L P PS +  PP+PSA + Y  + P+ + 
Sbjct: 81  PPSPSAPPPSPSAPSQPLCPPSQPLCPLPAPLPPPPSPSAPPPNPSAPYIYTITGPLYSI 140

Query: 89  TALSAALFAI 60
             ++  L++I
Sbjct: 141 YTITGPLYSI 150

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 1/97 (1%)
 Frame = -3

Query: 410 APTKPPTA-TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAS 234
           +P+ P  A    P+A PP+ + PP +  P+A PP+    P +P+  SSP+  PP+P+   
Sbjct: 3   SPSAPRRAWCDQPSAPPPSPSAPPPS--PSAPPPSPSAPPPSPSAPSSPSAPPPSPSAPP 60

Query: 233 TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
              +AP PS +  PP+P+     P PS +  PPSPSA
Sbjct: 61  PSPSAPPPSPSAPPPSPS----APPPSPSAPPPSPSA 93

[140][TOP]
>UniRef100_Q43719 Arabinogalactan n=1 Tax=Solanum lycopersicum RepID=Q43719_SOLLC
          Length = 215

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 51/129 (39%), Positives = 62/129 (48%), Gaps = 18/129 (13%)
 Frame = -3

Query: 458 ILGLLATSCLAQAPTAAPTKPPTATPAPTAQP-----PAAATPPTATPPTATPPAAVPAP 294
           IL ++  S   Q P AAP      T  P A P     PA AT P + PPTA P A V AP
Sbjct: 11  ILCIVVASVTGQTPAAAPVGAKAGTTPPAAAPTKPKTPAPATAPASAPPTAVPVAPVTAP 70

Query: 293 AT-------PAPASSPATSPPAPTPASTPST----APTPSTAGSPPAPTPDSLGP--GPS 153
            T        AP S+PA+SPP   PAS+P      AP P  A  P   TP +  P   P 
Sbjct: 71  VTAPTTPVVAAPVSAPASSPPLKAPASSPPVQSPPAPAPEVATPPAVSTPPAAAPVAAPV 130

Query: 152 GADTPPSPS 126
            ++T P+P+
Sbjct: 131 ASETTPAPA 139

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 47/121 (38%), Positives = 60/121 (49%), Gaps = 22/121 (18%)
 Frame = -3

Query: 422 APTAAPTKPPTATP--APTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           AP  APT P  A P  AP + PP  A  P ++PP  +PPA  P  ATP   S+P  + P 
Sbjct: 69  APVTAPTTPVVAAPVSAPASSPPLKA--PASSPPVQSPPAPAPEVATPPAVSTPPAAAPV 126

Query: 248 PTPASTPST-APTPSTA----------GSPPAPTPD--------SLGPGPS-GADTPPSP 129
             P ++ +T AP PS             + PAP+PD        S  PGPS  +D+ PSP
Sbjct: 127 AAPVASETTPAPAPSKGKVKGKKGKKHNASPAPSPDMMSPPAPPSEAPGPSMDSDSAPSP 186

Query: 128 S 126
           S
Sbjct: 187 S 187

[141][TOP]
>UniRef100_Q43558 Proline rich protein n=1 Tax=Medicago sativa RepID=Q43558_MEDSA
          Length = 228

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 51/107 (47%), Positives = 58/107 (54%), Gaps = 13/107 (12%)
 Frame = -3

Query: 425 QAPTAAPTKPPT--ATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA------SS 270
           Q+P   P  PP   +TP P + PPA+  PP  +PP ATPP A P PATP PA      SS
Sbjct: 98  QSPPPTPLTPPPVQSTPPPASPPPAS--PPPFSPPPATPPPATPPPATPPPALTPTPLSS 155

Query: 269 PATSPPAPTPASTPSTAPTPSTAGSP---PAPTPDSLGP--GPSGAD 144
           P  + PAP PA   S APT +   SP   PAP   SL P   PSG D
Sbjct: 156 PPATTPAPAPAKLKSKAPTLAPVLSPSDAPAPGLSSLSPSISPSGTD 202

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 41/90 (45%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS-SPATSPPAPT 243
           P    + PP + P P  Q P   TP T  P  +TPP A P PA+P P S  PAT PPA  
Sbjct: 81  PPVQSSPPPVSAPPPVQQSPPP-TPLTPPPVQSTPPPASPPPASPPPFSPPPATPPPATP 139

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPS 153
           P +TP  A TP+   SPPA TP    P P+
Sbjct: 140 PPATPPPALTPTPLSSPPATTP---APAPA 166

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 46/118 (38%), Positives = 58/118 (49%), Gaps = 4/118 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAP--TAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP-- 252
           P  +   P  +TP P  ++ PP +A PP    P  TP    P  +TP PAS P  SPP  
Sbjct: 68  PVQSSPPPAQSTPPPVQSSPPPVSAPPPVQQSPPPTPLTPPPVQSTPPPASPPPASPPPF 127

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALS 78
           +P PA+ P   P P+T   PPA TP  L   P+   T P+P+ A   SK    A  LS
Sbjct: 128 SPPPATPPPATPPPAT--PPPALTPTPLSSPPA---TTPAPAPAKLKSKAPTLAPVLS 180

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 42/110 (38%), Positives = 53/110 (48%), Gaps = 5/110 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           AP      PP   P P   PP  +TPP A+PP A+PP   P PATP PA+ P  +PP   
Sbjct: 92  APPPVQQSPP---PTPLTPPPVQSTPPPASPPPASPPPFSPPPATPPPATPPPATPP--- 145

Query: 242 PASTPSTAPTPSTAGSPPAPT-----PDSLGPGPSGADTPPSPSAAFSYS 108
           PA TP+   +P      PAP        +L P  S +D P    ++ S S
Sbjct: 146 PALTPTPLSSPPATTPAPAPAKLKSKAPTLAPVLSPSDAPAPGLSSLSPS 195

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 43/99 (43%), Positives = 51/99 (51%), Gaps = 4/99 (4%)
 Frame = -3

Query: 428 AQAPTAAPT--KPPTATPAPTAQPPAAATPPTATPPT--ATPPAAVPAPATPAPASSPAT 261
           A  P A+P    PP ATP P   PPA  TPP A  PT  ++PPA  PAPA PA   S A 
Sbjct: 117 ASPPPASPPPFSPPPATPPPATPPPA--TPPPALTPTPLSSPPATTPAPA-PAKLKSKA- 172

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
             P   P  +PS AP P  +   P+ +P   G   SGA+
Sbjct: 173 --PTLAPVLSPSDAPAPGLSSLSPSISPS--GTDDSGAE 207

[142][TOP]
>UniRef100_O49870 Extensin (Fragment) n=1 Tax=Hordeum vulgare RepID=O49870_HORVU
          Length = 330

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 48/105 (45%), Positives = 52/105 (49%), Gaps = 4/105 (3%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPA----PTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
           A  PT  P KPPT TP     PT  PPA   PPT TPP   PP   P    PA  + PA 
Sbjct: 209 APKPTPPPYKPPTPTPPAQKPPTPTPPAYK-PPTPTPPAHKPPTPTPPAHKPATPTPPAH 267

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            PP PTP +   T PTP  A  PP PTP         AD PP+P+
Sbjct: 268 KPPTPTPPAHKPTTPTP--AYKPPTPTPP--------ADKPPTPT 302

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 46/98 (46%), Positives = 49/98 (50%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           PT    KPPT  P P A  PA  TPP   PPT TPPA    P TP    +PA  PP PTP
Sbjct: 242 PTPPAHKPPT--PTPPAHKPATPTPPAHKPPTPTPPA--HKPTTP----TPAYKPPTPTP 293

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSL-GPGPSGADTPPSP 129
            +     PTP  A  PP PTP +   P PS    PP P
Sbjct: 294 PADKPPTPTP-LAHKPPTPTPPAYKAPTPS----PPPP 326

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 45/104 (43%), Positives = 51/104 (49%), Gaps = 8/104 (7%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPPAAA-TPPTATPPTATPPAAVPAPATPAPA------SSPATSP 255
           A    PP   P P   PPA   TPP   PPT TPPA  P   TP PA      + PA  P
Sbjct: 191 APKVSPPAYKPVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTP-PAYKPPTPTPPAHKP 249

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGP-GPSGADTPPSPS 126
           P PTP +     PTP  A  PP PTP +  P  P+ A  PP+P+
Sbjct: 250 PTPTPPAHKPATPTP-PAHKPPTPTPPAHKPTTPTPAYKPPTPT 292

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 41/107 (38%), Positives = 48/107 (44%), Gaps = 11/107 (10%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPP-----AAATPPTATP-PTATPPAAVPAPATPAPASSPA--TS 258
           A    PP   P+P   PP        +PP   P P  +PPA  PAP    PA  P    S
Sbjct: 147 APKVSPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPVPKPS 206

Query: 257 PPAPTPASTPSTAPTPS-TAGSPPAPTPDSLGP--GPSGADTPPSPS 126
           PPAP P   P   PTP+  A  PP PTP +  P      A  PP+P+
Sbjct: 207 PPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKPPTPT 253

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 39/102 (38%), Positives = 46/102 (45%), Gaps = 5/102 (4%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT-SPPAPTPA 237
           A    PP   PAP   PPA    P  +PP   P   VP P+ PAP  +P    PP PTP 
Sbjct: 169 APKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKP---VPKPSPPAPKPTPPPYKPPTPTPP 225

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGP----GPSGADTPPSPSA 123
           +     PTP  A  PP PTP +  P     P+     P+P A
Sbjct: 226 AQKPPTPTP-PAYKPPTPTPPAHKPPTPTPPAHKPATPTPPA 266

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 43/107 (40%), Positives = 47/107 (43%), Gaps = 11/107 (10%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPPAAATPPTATPPT------ATPPAAVPAPATPAPASSPA--TS 258
           A    PP   PAP   PPA    P  +PP        +PPA  PAP    PA  PA   S
Sbjct: 125 APKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVS 184

Query: 257 PPAPTPA---STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           PPA  PA   S P+  P P    SPPAP P    P P    TP  P+
Sbjct: 185 PPAYKPAPKVSPPAYKPVPKP--SPPAPKPT---PPPYKPPTPTPPA 226

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 46/121 (38%), Positives = 51/121 (42%), Gaps = 15/121 (12%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPT------ATPPAAVPAPATPAPA--SSPA 264
           PT     PP   PAP   PPA    P  +PP        +PPA  PAP    PA   SP 
Sbjct: 101 PTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPSPK 160

Query: 263 TSPPAPTPA---STPSTAPTPSTAGSPPA--PTPDSLGPG--PSGADTPPSPSAAFSYSK 105
            SPPA  PA   S P+  P P    SPPA  P P    P   P    +PP+P       K
Sbjct: 161 VSPPAYKPAPKVSPPAYKPAPKV--SPPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPPYK 218

Query: 104 P 102
           P
Sbjct: 219 P 219

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 48/122 (39%), Positives = 55/122 (45%), Gaps = 16/122 (13%)
 Frame = -3

Query: 419 PTAAPT----KPPTATPAPTAQPPAAATP-----PTATPPTATPPAAVPAPATPAPASSP 267
           PTA PT    KP   T AP  +PP  + P     P   PPT  PP   P P+ PA   +P
Sbjct: 57  PTAKPTPPAPKPAPPTYAPIPKPPKPSPPAYHPTPKPAPPTYKPPTQ-PKPSPPAYKPAP 115

Query: 266 ATSPPAPTPA---STPSTAPTPSTAGSPPA--PTPDSLGPG--PSGADTPPSPSAAFSYS 108
             SPPA  PA   S P+  P P    SPPA  P P    P   PS   +PP+   A   S
Sbjct: 116 KVSPPAYKPAPKVSPPAYKPAPKV--SPPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVS 173

Query: 107 KP 102
            P
Sbjct: 174 PP 175

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 47/117 (40%), Positives = 54/117 (46%), Gaps = 13/117 (11%)
 Frame = -3

Query: 413 AAPT-KPPTATPAPTAQPPAAAT-PPTATPPTATPPA----AVPAPATPAPASSPATSPP 252
           A PT  PPTA P P A  PA  T  P   PP  +PPA      PAP T  P + P  SPP
Sbjct: 50  APPTYSPPTAKPTPPAPKPAPPTYAPIPKPPKPSPPAYHPTPKPAPPTYKPPTQPKPSPP 109

Query: 251 APTPA---STPSTAPTPSTAGSPPA--PTPDSLGPG--PSGADTPPSPSAAFSYSKP 102
           A  PA   S P+  P P    SPPA  P P    P   P+   +PP+   +   S P
Sbjct: 110 AYKPAPKVSPPAYKPAPKV--SPPAYKPAPKVSPPAYKPAPKVSPPAYKPSPKVSPP 164

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 39/118 (33%), Positives = 49/118 (41%), Gaps = 16/118 (13%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQ-PPAAATPP-----------TATPPTATPPAAVPAPATPAPAS--- 273
           P  P   +PAP  + PP    PP           +  PPT +PP A P P  P PA    
Sbjct: 14  PPSPTPISPAPKHEKPPKGHKPPHHHHHAKPPVGSQAPPTYSPPTAKPTPPAPKPAPPTY 73

Query: 272 SPATSPPAPT-PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           +P   PP P+ PA  P+  P P T   P  P P      P+   +PP+   A   S P
Sbjct: 74  APIPKPPKPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPP 131

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 50/120 (41%), Positives = 57/120 (47%), Gaps = 14/120 (11%)
 Frame = -3

Query: 419 PTAAPT-KPPTATPAPTA-QPPAAATPPTATPPT---ATPPAAVPAPATPAPASSPA--T 261
           PT AP  KPP   P+P A  P     PPT  PPT    +PPA  PAP    PA  PA   
Sbjct: 71  PTYAPIPKPPK--PSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKV 128

Query: 260 SPPAPTPA---STPSTAPTPSTAGSPPA--PTPDSLGPG--PSGADTPPSPSAAFSYSKP 102
           SPPA  PA   S P+  P P    SPPA  P+P    P   P+   +PP+   A   S P
Sbjct: 129 SPPAYKPAPKVSPPAYKPAPKV--SPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPP 186

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 50/126 (39%), Positives = 58/126 (46%), Gaps = 19/126 (15%)
 Frame = -3

Query: 422 APTAAPTKP------PTATPAP-TAQPPAAA--TPPTATP-PTATPPAAVPAPATPAPAS 273
           AP   P KP      PT  PAP T +PP     +PP   P P  +PPA  PAP    PA 
Sbjct: 74  APIPKPPKPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAY 133

Query: 272 SPA--TSPPAPTPA---STPSTAPTPSTAGSPPA--PTPDSLGPG--PSGADTPPSPSAA 120
            PA   SPPA  PA   S P+  P+P    SPPA  P P    P   P+   +PP+   A
Sbjct: 134 KPAPKVSPPAYKPAPKVSPPAYKPSPKV--SPPAYKPAPKVSPPAYKPAPKVSPPAYKPA 191

Query: 119 FSYSKP 102
              S P
Sbjct: 192 PKVSPP 197

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 47/114 (41%), Positives = 55/114 (48%), Gaps = 9/114 (7%)
 Frame = -3

Query: 413 AAPT-KPPTAT-PAPTAQPPAA-ATPPTATP-PTATPPAAVPAPATPAPASSPA--TSPP 252
           A PT KPPT   P+P A  PA   +PP   P P  +PPA  PAP    PA  PA   SPP
Sbjct: 94  APPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPP 153

Query: 251 A--PTP-ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
           A  P+P  S P+  P P    SPPA  P    P  S     P+P  +    KP+
Sbjct: 154 AYKPSPKVSPPAYKPAPKV--SPPAYKP---APKVSPPAYKPAPKVSPPAYKPV 202

[143][TOP]
>UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum
           bicolor RepID=C5XPK9_SORBI
          Length = 613

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 41/103 (39%), Positives = 56/103 (54%), Gaps = 1/103 (0%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPT-AQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP 255
           L   P   P+ PP + P P+ + PP +  PP+  PP+ +PP   P P +P P S P  SP
Sbjct: 404 LPSPPLPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSP 463

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P P+P+  P + P PS    PP+P+P    P P  +  PPSPS
Sbjct: 464 PPPSPSPPPPSPPPPSP--PPPSPSPPPPSP-PPPSPPPPSPS 503

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 37/96 (38%), Positives = 51/96 (53%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           +P      PP+ +P P + PP +  PP+ +PP  +PP   P P +P P S P  SP  P 
Sbjct: 413 SPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPP 472

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           P+  P + P PS +  PP+P P S  P PS +  PP
Sbjct: 473 PSPPPPSPPPPSPSPPPPSPPPPS-PPPPSPSPPPP 507

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 35/103 (33%), Positives = 50/103 (48%), Gaps = 5/103 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS----SPATSP 255
           +P      PP+ +P P + PP +  PP+  PP+  PP+  P P +P P S    SP+  P
Sbjct: 430 SPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPP 489

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG-ADTPPSP 129
           P+P P S P  +P+P       +P    L P P    + PP P
Sbjct: 490 PSPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPPP 532

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 39/116 (33%), Positives = 54/116 (46%), Gaps = 19/116 (16%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP + +PP  +PP  +PP   P+P+ P P S P  SPP P+P
Sbjct: 446 PSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPP--PSPSPP-PPSPPPPSPPPPSP 502

Query: 239 ASTPS-----------TAPTPSTAGSPPAP----TPD----SLGPGPSGADTPPSP 129
           +  P            + P P+    PP P    +P+    S  P P   D PP P
Sbjct: 503 SPPPPYYEVSPEERYLSPPPPAYTEVPPPPYYEVSPEDRYLSPPPPPVHHDPPPPP 558

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 39/126 (30%), Positives = 51/126 (40%), Gaps = 19/126 (15%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           +P      PP  +P P + PP + +PP  +PP  +PP   P+P  P    SP     +P 
Sbjct: 462 SPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPP 521

Query: 242 PASTPSTAPTPSTAGSP------PAPTPDSLGPGP------SGAD---TPPSPSAA---- 120
           P +     P P    SP      P P P    P P      S  D   +PP PS A    
Sbjct: 522 PPAYTEVPPPPYYEVSPEDRYLSPPPPPVHHDPPPPPYYEVSPEDRYLSPPPPSPASLPK 581

Query: 119 FSYSKP 102
           + YS P
Sbjct: 582 YDYSSP 587

[144][TOP]
>UniRef100_B9RKQ3 ATP binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RKQ3_RICCO
          Length = 670

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 49/110 (44%), Positives = 66/110 (60%), Gaps = 7/110 (6%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT---PPAAVPAP----ATPAPASS 270
           A  P A P  PP A   P+A PPA ATP ++ PPT++   PP + P+P    +TP+P S 
Sbjct: 47  AAPPPATPAAPPPAPVTPSAPPPAPATP-SSPPPTSSSSPPPPSTPSPSPPTSTPSPPSP 105

Query: 269 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
           P+T+P  PT + T  + PTP+T  SPPAP P S  P P    +PPS S++
Sbjct: 106 PSTTPSPPTNSGTTPSTPTPTTR-SPPAP-PTSSSPSP---PSPPSNSSS 150

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 51/136 (37%), Positives = 67/136 (49%), Gaps = 12/136 (8%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPA------PTAQPPAAATPPTATPPTATPPAAVP-APATPAPASS 270
           A  P A P  PP ATPA      P A PPA  TP    P  ATP +  P + ++P P S+
Sbjct: 31  AAPPPATPAAPPPATPAAPPPATPAAPPPAPVTPSAPPPAPATPSSPPPTSSSSPPPPST 90

Query: 269 PATSPP--APTPASTPSTAPTPST--AGSPPAPTPDSLG-PGPSGADTPPSPSAAFSYSK 105
           P+ SPP   P+P S PST P+P T    +P  PTP +   P P  + +P  PS   + S 
Sbjct: 91  PSPSPPTSTPSPPSPPSTTPSPPTNSGTTPSTPTPTTRSPPAPPTSSSPSPPSPPSNSSS 150

Query: 104 PIIAATALSAALFAIA 57
            I     +  A+  +A
Sbjct: 151 GISTGVVVGIAIGGVA 166

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 53/123 (43%), Positives = 65/123 (52%), Gaps = 22/123 (17%)
 Frame = -3

Query: 428 AQAPTAAP----TKPPTATPA------PTAQPPAA-ATPPTAT---PPTATPPAAVPAPA 291
           A  PT+ P    T PP ATPA      P A PPA  A PP AT   PP ATP A  PAP 
Sbjct: 3   APTPTSPPSTNTTAPPPATPAAPPPSTPAAPPPATPAAPPPATPAAPPPATPAAPPPAPV 62

Query: 290 TPA--------PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           TP+        P+S P TS  +P P STPS +P P++  SPP+P   +  P  +   TP 
Sbjct: 63  TPSAPPPAPATPSSPPPTSSSSPPPPSTPSPSP-PTSTPSPPSPPSTTPSPPTNSGTTPS 121

Query: 134 SPS 126
           +P+
Sbjct: 122 TPT 124

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 31/88 (35%), Positives = 42/88 (47%)
 Frame = -3

Query: 389 ATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTP 210
           + P PT+ P    T P    P A PP+   AP    PA+ P  +P AP PA+  +  P P
Sbjct: 2   SAPTPTSPPSTNTTAPPPATPAAPPPSTPAAPPPATPAAPPPATPAAPPPATPAAPPPAP 61

Query: 209 STAGSPPAPTPDSLGPGPSGADTPPSPS 126
            T  +PP        P P+ + +PP PS
Sbjct: 62  VTPSAPPPAPATPSSPPPTSSSSPPPPS 89

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 33/78 (42%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = -3

Query: 350 TPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAP-TPD 174
           T P +T  TA PPA   AP    PA+ P  +P AP PA TP+  P  + A  PPAP TP 
Sbjct: 7   TSPPSTNTTAPPPATPAAPPPSTPAAPPPATPAAPPPA-TPAAPPPATPAAPPPAPVTPS 65

Query: 173 SLGPGPSGADTPPSPSAA 120
           +  P P+   +PP  S++
Sbjct: 66  APPPAPATPSSPPPTSSS 83

[145][TOP]
>UniRef100_B9FLY6 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9FLY6_ORYSJ
          Length = 630

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 58/137 (42%), Positives = 71/137 (51%), Gaps = 13/137 (9%)
 Frame = -3

Query: 497 PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKP-PTATPA---PTAQPPAAATPPTATP 330
           P  +SS +V + L      TS L  AP AA +   P ATPA   PT+ PPA+   P+ATP
Sbjct: 12  PSSSSSPSVALGLAATTPTTSPLPLAPAAAASSSNPNATPADTTPTSPPPASPPLPSATP 71

Query: 329 PTAT---PPAAVP----APATPAPASSPATSP-PAPTPASTPSTAPTPSTAGSPPAPTPD 174
           P A    PP   P    +P+ P P S  A SP P  T  +TP TAP P+ A  P AP+P 
Sbjct: 72  PLAASPPPPPPPPPPRNSPSPPKPPSQAAQSPLPPTTTTTTPPTAPVPAAAPPPTAPSPY 131

Query: 173 SL-GPGPSGADTPPSPS 126
           S   P P+   T P PS
Sbjct: 132 SAPSPTPTPTHTQPRPS 148

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 37/104 (35%), Positives = 54/104 (51%), Gaps = 2/104 (1%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA-PASSPA-TSPPAPTP 240
           A  +K   A+P+ ++ P  A      TP T+  P A  A A+ + P ++PA T+P +P P
Sbjct: 2   ANKSKSAAASPSSSSSPSVALGLAATTPTTSPLPLAPAAAASSSNPNATPADTTPTSPPP 61

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYS 108
           AS P  + TP  A SPP P P    P P  + +PP P +  + S
Sbjct: 62  ASPPLPSATPPLAASPPPPPPP---PPPRNSPSPPKPPSQAAQS 102

[146][TOP]
>UniRef100_B8AWI6 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8AWI6_ORYSI
          Length = 630

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 58/137 (42%), Positives = 71/137 (51%), Gaps = 13/137 (9%)
 Frame = -3

Query: 497 PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKP-PTATPA---PTAQPPAAATPPTATP 330
           P  +SS +V + L      TS L  AP AA +   P ATPA   PT+ PPA+   P+ATP
Sbjct: 12  PSSSSSPSVALGLAATTPTTSPLPLAPAAAASSSNPNATPADTTPTSPPPASPPLPSATP 71

Query: 329 PTAT---PPAAVP----APATPAPASSPATSP-PAPTPASTPSTAPTPSTAGSPPAPTPD 174
           P A    PP   P    +P+ P P S  A SP P  T  +TP TAP P+ A  P AP+P 
Sbjct: 72  PLAASPPPPPPPPPPRNSPSPPKPPSQAAQSPLPPTTTTTTPPTAPVPAAAPPPTAPSPY 131

Query: 173 SL-GPGPSGADTPPSPS 126
           S   P P+   T P PS
Sbjct: 132 SAPSPTPTPTHTQPRPS 148

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 37/104 (35%), Positives = 54/104 (51%), Gaps = 2/104 (1%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA-PASSPA-TSPPAPTP 240
           A  +K   A+P+ ++ P  A      TP T+  P A  A A+ + P ++PA T+P +P P
Sbjct: 2   ANKSKSAAASPSSSSSPSVALGLAATTPTTSPLPLAPAAAASSSNPNATPADTTPTSPPP 61

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYS 108
           AS P  + TP  A SPP P P    P P  + +PP P +  + S
Sbjct: 62  ASPPLPSATPPLAASPPPPPPP---PPPRNSPSPPKPPSQAAQS 102

[147][TOP]
>UniRef100_UPI00019829A2 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019829A2
          Length = 726

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 1/107 (0%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPP-AAVPAPATPAPASSPATSPPAPT 243
           P  +P  PP   P  T+ PP ++ PP ++PP + PP  + P P+ P P S P+ SP +P 
Sbjct: 145 PPRSPPPPPPTEPPVTSPPPPSSNPPKSSPPPSEPPKTSPPPPSKPPPVSPPSPSPSSPP 204

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
             S P   P P +  +PPAP+P    P      TPPSP++    S P
Sbjct: 205 EDSPPPPVPVPPSNSTPPAPSPSGSQPA-----TPPSPNSPPKGSPP 246

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 10/108 (9%)
 Frame = -3

Query: 419 PTAAPTKPP-TATPAPTAQPPAAATPPTATPPTATPPAAVP---APATPAPASSPATSPP 252
           P   PT+PP T+ P P++ PP ++ PP+  P T+ PP + P   +P +P+P+S P  SPP
Sbjct: 150 PPPPPTEPPVTSPPPPSSNPPKSSPPPSEPPKTSPPPPSKPPPVSPPSPSPSSPPEDSPP 209

Query: 251 APTP-----ASTPSTAPTPSTAGSPPAP-TPDSLGPGPSGADTPPSPS 126
            P P     ++ P+ +P+ S   +PP+P +P    P P    TPP P+
Sbjct: 210 PPVPVPPSNSTPPAPSPSGSQPATPPSPNSPPKGSPPPPRTPTPPPPA 257

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 44/100 (44%), Positives = 55/100 (55%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           A  PT+A T PP  +  P   PP ++TPP++ P    P  A  + ++P P S PA  P A
Sbjct: 14  AVPPTSAATPPPPLSSPPP--PPESSTPPSSQPNADPPDGAAGSTSSPPPQSPPAV-PAA 70

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P PAS P   PTPS A SP +P P S  P PS    PP+P
Sbjct: 71  PPPASPPPPPPTPSLANSPSSPPPPS-PPPPSPNAPPPTP 109

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 40/111 (36%), Positives = 53/111 (47%), Gaps = 13/111 (11%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP------APATPAPASSPAT 261
           +P A P  PP + P     PP+  +PP  TPP  +PP   P      +P  P P   P T
Sbjct: 101 SPNAPPPTPPPSPPIAPVPPPSNPSPPPLTPPPTSPPPPPPPTNPPRSPPPPPPTEPPVT 160

Query: 260 SPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA----DTPPSP 129
           SPP P+   P S+P  +  P T+  PP+  P    P PS +    D+PP P
Sbjct: 161 SPPPPSSNPPKSSPPPSEPPKTSPPPPSKPPPVSPPSPSPSSPPEDSPPPP 211

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 39/116 (33%), Positives = 52/116 (44%), Gaps = 18/116 (15%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPP----------------AAVPAP 294
           Q+P A P  PP A+P P    P+ A  P++ PP + PP                A VP P
Sbjct: 62  QSPPAVPAAPPPASPPPPPPTPSLANSPSSPPPPSPPPPSPNAPPPTPPPSPPIAPVPPP 121

Query: 293 ATPA--PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
           + P+  P + P TSPP P P + P  +P P     PP  +P      P  +  PPS
Sbjct: 122 SNPSPPPLTPPPTSPPPPPPPTNPPRSPPPPPPTEPPVTSPPPPSSNPPKSSPPPS 177

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 40/112 (35%), Positives = 49/112 (43%), Gaps = 6/112 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTA--TPPTATPPAAVPAPATPAPASSPATSPPAP 246
           P+  P  P    P P   PP A  PP +  +PP  TPP   P P  P P ++P  SPP P
Sbjct: 95  PSPPPPSPNAPPPTPPPSPPIAPVPPPSNPSPPPLTPPPTSPPP--PPPPTNPPRSPPPP 152

Query: 245 TPASTPSTAPTPSTA----GSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P   P T+P P ++     SPP   P    P P     P SP +    S P
Sbjct: 153 PPTEPPVTSPPPPSSNPPKSSPPPSEPPKTSPPPPSKPPPVSPPSPSPSSPP 204

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 44/127 (34%), Positives = 58/127 (45%), Gaps = 18/127 (14%)
 Frame = -3

Query: 428 AQAPTAAPTKPPT-------ATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA-- 276
           A  P + P  PPT       ++P P + PP +   P  TPP + P A VP P+ P+P   
Sbjct: 70  APPPASPPPPPPTPSLANSPSSPPPPSPPPPSPNAPPPTPPPSPPIAPVPPPSNPSPPPL 129

Query: 275 SSPATSPPAPTPASTPSTAPTPS-------TAGSPPAPTPDSLGPGPS--GADTPPSPSA 123
           + P TSPP P P + P  +P P        T+  PP+  P    P PS     +PP PS 
Sbjct: 130 TPPPTSPPPPPPPTNPPRSPPPPPPTEPPVTSPPPPSSNPPKSSPPPSEPPKTSPPPPSK 189

Query: 122 AFSYSKP 102
               S P
Sbjct: 190 PPPVSPP 196

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 43/103 (41%), Positives = 59/103 (57%), Gaps = 9/103 (8%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAA--TPPTATPPTATPPAAVPAP---ATPAPASSPATSPPA-- 249
           P++PP  +P P ++PP  +  +P  ++PP  +PP  VP P   +TP PA SP+ S PA  
Sbjct: 176 PSEPPKTSPPPPSKPPPVSPPSPSPSSPPEDSPPPPVPVPPSNSTP-PAPSPSGSQPATP 234

Query: 248 PTPASTPSTAPTPSTAGSPPAP--TPDSLGPGPSGADTPPSPS 126
           P+P S P  +P P    +PP P  +P  L P PS   TP SPS
Sbjct: 235 PSPNSPPKGSPPPPRTPTPPPPARSPPPLSP-PSSPQTPNSPS 276

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 43/118 (36%), Positives = 61/118 (51%), Gaps = 20/118 (16%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQP----PAAATPPTATPPTATPPA--AVPAPATP--------- 285
           P ++P  PP ++  P++QP    P  A   T++PP  +PPA  A P PA+P         
Sbjct: 26  PLSSPPPPPESSTPPSSQPNADPPDGAAGSTSSPPPQSPPAVPAAPPPASPPPPPPTPSL 85

Query: 284 --APASSPATSPPAPTP-ASTPSTAPTPSTAGSPPA--PTPDSLGPGPSGADTPPSPS 126
             +P+S P  SPP P+P A  P+  P+P  A  PP   P+P  L P P+    PP P+
Sbjct: 86  ANSPSSPPPPSPPPPSPNAPPPTPPPSPPIAPVPPPSNPSPPPLTPPPTSPPPPPPPT 143

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 41/102 (40%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPA-PTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
           A   T++P  PP + PA P A PPA+  PP  TP  A  P++ P P+ P P  SP   PP
Sbjct: 52  AAGSTSSP--PPQSPPAVPAAPPPASPPPPPPTPSLANSPSSPPPPSPPPP--SPNAPPP 107

Query: 251 APTPASTPSTAPTPSTAGSPP-APTPDSLGPGPSGADTPPSP 129
            P P+   +  P PS    PP  P P S  P P   + P SP
Sbjct: 108 TPPPSPPIAPVPPPSNPSPPPLTPPPTSPPPPPPPTNPPRSP 149

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 40/109 (36%), Positives = 48/109 (44%), Gaps = 7/109 (6%)
 Frame = -3

Query: 407 PTKPPT--ATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP-APTP- 240
           P  PP   A P P + PP   TP  A  P++ PP + P P+  AP  +P  SPP AP P 
Sbjct: 61  PQSPPAVPAAPPPASPPPPPPTPSLANSPSSPPPPSPPPPSPNAPPPTPPPSPPIAPVPP 120

Query: 239 ---ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
               S P   P P++   PP PT     P P     PP  S     S P
Sbjct: 121 PSNPSPPPLTPPPTSPPPPPPPTNPPRSPPPPPPTEPPVTSPPPPSSNP 169

 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 35/93 (37%), Positives = 44/93 (47%), Gaps = 7/93 (7%)
 Frame = -3

Query: 359 AAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTP-----STAGS 195
           A A+PP  + P+A PP +   P  P P SSP   P + TP S+   A  P     ST+  
Sbjct: 2   ATASPPPNSSPSAVPPTSAATP--PPPLSSPPPPPESSTPPSSQPNADPPDGAAGSTSSP 59

Query: 194 PP--APTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           PP   P   +  P  S    PP+PS A S S P
Sbjct: 60  PPQSPPAVPAAPPPASPPPPPPTPSLANSPSSP 92

[148][TOP]
>UniRef100_UPI00017390C7 AGP19 (ARABINOGALACTAN-PROTEIN 19) n=1 Tax=Arabidopsis thaliana
           RepID=UPI00017390C7
          Length = 248

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 58/147 (39%), Positives = 72/147 (48%), Gaps = 24/147 (16%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCL--AQAPTAAP-----TKPPTATPAP---TAQPPAAATPP 342
           M S++ +   L+   L +S    AQ P A+P     T PP  T AP    A PP   TPP
Sbjct: 1   MESNSIIWSLLLASALISSFSVNAQGPAASPVTSTTTAPPPTTAAPPTTAAPPPTTTTPP 60

Query: 341 TA---------TPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPT--PSTAGS 195
            +         TPP A  P + PAP   AP  SPAT PP P P S P++APT  P     
Sbjct: 61  VSAAQPPASPVTPPPAVTPTSPPAPKV-APVISPATPPPQP-PQSPPASAPTVSPPPVSP 118

Query: 194 PPAPT---PDSLGPGPSGADTPPSPSA 123
           PPAPT   P    P P+ A  PP+P++
Sbjct: 119 PPAPTSPPPTPASPPPAPASPPPAPAS 145

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 40/110 (36%), Positives = 51/110 (46%), Gaps = 14/110 (12%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATP------------APTAQPPAAATPPTATPPTATPPAAVPAPATP 285
           AQ P +  T PP  TP            +P   PP     P A+ PT +PP   P PA  
Sbjct: 64  AQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPT 123

Query: 284 APASSPATSPPAPTPASTPSTAPTPSTAGSPP--APTPDSLGPGPSGADT 141
           +P  +PA+ PPAP        +P P+    PP  AP+P SL P P+ A T
Sbjct: 124 SPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAPT 173

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 47/127 (37%), Positives = 59/127 (46%), Gaps = 12/127 (9%)
 Frame = -3

Query: 422 APTAAPTKPPTATPA--PTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           +P   P +PP + PA  PT  PP  + PP  T P  TP +  PAPA+P PA  PA+  P 
Sbjct: 92  SPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPA--PAS--PP 147

Query: 248 PTPASTPST-APTPSTAGSPPAPTPDS---------LGPGPSGADTPPSPSAAFSYSKPI 99
           P P S P   AP+P +    PAP P               P+ A  PPSP +    + P 
Sbjct: 148 PAPVSPPPVQAPSPISLPPAPAPAPTKHKRKHKHKRHHHAPAPAPIPPSPPSPPVLTDPQ 207

Query: 98  IAATALS 78
             A A S
Sbjct: 208 DTAPAPS 214

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 46/114 (40%), Positives = 57/114 (50%), Gaps = 13/114 (11%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV---PAPATPAP--ASSPA 264
           A APT +P  P +  PAPT+ PP  A+PP A  P + PPA     PAP +P P  A SP 
Sbjct: 106 ASAPTVSPP-PVSPPPAPTSPPPTPASPPPA--PASPPPAPASPPPAPVSPPPVQAPSPI 162

Query: 263 TSPPAPTPASTPSTAP--------TPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           + PPAP PA T              P+ A  PP+P    +   P   DT P+PS
Sbjct: 163 SLPPAPAPAPTKHKRKHKHKRHHHAPAPAPIPPSPPSPPVLTDPQ--DTAPAPS 214

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 43/113 (38%), Positives = 53/113 (46%), Gaps = 16/113 (14%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPA-PTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP 267
           A++     P  +P   PT+ P  P + PPA A+PP A  P + PPA V  P  P  A SP
Sbjct: 106 ASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPA--PASPPPAPVSPP--PVQAPSP 161

Query: 266 ATSPPAPTPAST--------------PSTAPTPSTAGSPPAPT-PDSLGPGPS 153
            + PPAP PA T              P+ AP P +  SPP  T P    P PS
Sbjct: 162 ISLPPAPAPAPTKHKRKHKHKRHHHAPAPAPIPPSPPSPPVLTDPQDTAPAPS 214

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 36/101 (35%), Positives = 49/101 (48%), Gaps = 15/101 (14%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP---- 255
           APT+ P  P +  PAP + PPA A+PP A  P + PP   P+P +  PA +PA +     
Sbjct: 121 APTSPPPTPASPPPAPASPPPAPASPPPA--PVSPPPVQAPSPISLPPAPAPAPTKHKRK 178

Query: 254 -----------PAPTPASTPSTAPTPSTAGSPPAPTPDSLG 165
                      PAP P S PS         + PAP+P++ G
Sbjct: 179 HKHKRHHHAPAPAPIPPSPPSPPVLTDPQDTAPAPSPNTNG 219

[149][TOP]
>UniRef100_UPI0001553800 PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI0001553800
          Length = 371

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 51/117 (43%), Positives = 68/117 (58%), Gaps = 9/117 (7%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPA--PTAQPPAAATPPTATPPTATP---PAAVPAPA-TPAPA 276
           S  A AP +AP   P + PA  P + P +A     A+ P + P   PA+ PAPA  PAPA
Sbjct: 223 SAPASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPAPAPAPAPA 282

Query: 275 SSPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAAFS 114
            +PA +P PAP PA  P+ AP P+ A +P PAP P +  P P+ A  P P+P+ AF+
Sbjct: 283 PAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAP-APAPAPAPAPAPAPAPAPAFA 338

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 48/109 (44%), Positives = 64/109 (58%), Gaps = 3/109 (2%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           S  A AP +AP   P + PA +A   A A+ P + P +A   A   APA+ APAS+PA++
Sbjct: 215 SAPASAPASAPASAPASAPA-SAPASAPASAPASAPASAPASAPASAPAS-APASAPASA 272

Query: 257 P-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
           P PAP PA  P+ AP P+ A +P PAP P    P P+ A  P P+P+ A
Sbjct: 273 PAPAPAPAPAPAPAPAPAPAPAPAPAPAP---APAPAPAPAPAPAPAPA 318

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 48/111 (43%), Positives = 64/111 (57%), Gaps = 5/111 (4%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           S  A AP +AP   P + PA +A   A A+ P + P +A   A   APA+ APAS+PA++
Sbjct: 211 SAPASAPASAPASAPASAPA-SAPASAPASAPASAPASAPASAPASAPAS-APASAPASA 268

Query: 257 P---PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
           P   PAP PA  P+ AP P+ A +P PAP P    P P+ A  P P+P+ A
Sbjct: 269 PASAPAPAPAPAPAPAPAPAPAPAPAPAPAP---APAPAPAPAPAPAPAPA 316

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 48/111 (43%), Positives = 65/111 (58%), Gaps = 5/111 (4%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           S  A AP +AP   P + PA +A   A A+ P + P +A   A   APA+ APAS+PA++
Sbjct: 199 SAPASAPASAPASAPASAPA-SAPASAPASAPASAPASAPASAPASAPAS-APASAPASA 256

Query: 257 P---PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
           P   PA  PAS P++AP P+ A +P PAP P    P P+ A  P P+P+ A
Sbjct: 257 PASAPASAPASAPASAPAPAPAPAPAPAPAP---APAPAPAPAPAPAPAPA 304

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 51/135 (37%), Positives = 70/135 (51%), Gaps = 6/135 (4%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           + S  A AP +AP   P + PA +A   A A+ P + P +A   A   APA+ APAS+PA
Sbjct: 125 SASASASAPASAPASAPASAPA-SAPASAPASAPASAPASAPASAPASAPAS-APASAPA 182

Query: 263 TSP---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           ++P   PA  PAS P++AP  + A +P   PA  P S  P  + A  P S  A+   S P
Sbjct: 183 SAPASAPASAPASAPASAPASAPASAPASAPASAPAS-APASAPASAPASAPASAPASAP 241

Query: 101 IIAATALSAALFAIA 57
             A  +  A+  A A
Sbjct: 242 ASAPASAPASAPASA 256

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 52/141 (36%), Positives = 71/141 (50%), Gaps = 12/141 (8%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPA--PTAQPPAAATPPTATPPTATP---PAAVPAPA-TPA 282
           + S  A AP +AP   P + PA  P + P +A     A+ P + P   PA+ PA A   A
Sbjct: 129 SASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPASA 188

Query: 281 PASSPATSP---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPSPSAA 120
           PAS+PA++P   PA  PAS P++AP  + A +P   PA  P S  P  + A  P S  A+
Sbjct: 189 PASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPAS-APASAPASAPASAPAS 247

Query: 119 FSYSKPIIAATALSAALFAIA 57
              S P  A  +  A+  A A
Sbjct: 248 APASAPASAPASAPASAPASA 268

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 51/133 (38%), Positives = 69/133 (51%), Gaps = 6/133 (4%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           S  A AP +AP   P + PA +A   A A+ P + P +A   A   APA+ APAS+PA++
Sbjct: 143 SAPASAPASAPASAPASAPA-SAPASAPASAPASAPASAPASAPASAPAS-APASAPASA 200

Query: 257 P---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPSPSAAFSYSKPII 96
           P   PA  PAS P++AP  + A +P   PA  P S  P  + A  P S  A+   S P  
Sbjct: 201 PASAPASAPASAPASAPASAPASAPASAPASAPAS-APASAPASAPASAPASAPASAPAS 259

Query: 95  AATALSAALFAIA 57
           A  +  A+  A A
Sbjct: 260 APASAPASAPASA 272

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 43/110 (39%), Positives = 62/110 (56%), Gaps = 4/110 (3%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           S  A AP +AP   P + PA +A   A A+ P + P +A   A   APA+ APAS+PA++
Sbjct: 183 SAPASAPASAPASAPASAPA-SAPASAPASAPASAPASAPASAPASAPAS-APASAPASA 240

Query: 257 P---PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSPSAA 120
           P   PA  PAS P++AP  + A +P +    +  P P+ A  P P+P+ A
Sbjct: 241 PASAPASAPASAPASAPASAPASAPASAPASAPAPAPAPAPAPAPAPAPA 290

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 47/118 (39%), Positives = 63/118 (53%), Gaps = 6/118 (5%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           S  A AP +AP   P + PA +A   A A+ P + P +A   A   APA+ APAS+PA++
Sbjct: 159 SAPASAPASAPASAPASAPA-SAPASAPASAPASAPASAPASAPASAPAS-APASAPASA 216

Query: 257 P---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           P   PA  PAS P++AP  + A +P   PA  P S  P  + A  P S  A+   S P
Sbjct: 217 PASAPASAPASAPASAPASAPASAPASAPASAPAS-APASAPASAPASAPASAPASAP 273

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 47/116 (40%), Positives = 64/116 (55%), Gaps = 10/116 (8%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           S  A AP +AP   P + PA +A   A A+ P + P +A   A   APA+ APAS+PA++
Sbjct: 175 SAPASAPASAPASAPASAPA-SAPASAPASAPASAPASAPASAPASAPAS-APASAPASA 232

Query: 257 P---PAPTPASTPSTAPTPSTAGSP---PAPTPDSL---GPGPSGADTP-PSPSAA 120
           P   PA  PAS P++AP  + A +P   PA  P S     P P+ A  P P+P+ A
Sbjct: 233 PASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPAPAPAPAPAPAPAPA 288

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 46/113 (40%), Positives = 63/113 (55%), Gaps = 7/113 (6%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           S  A AP +AP   P + PA +A   A A+ P + P +A   A   APA+ APAS+PA++
Sbjct: 171 SAPASAPASAPASAPASAPA-SAPASAPASAPASAPASAPASAPASAPAS-APASAPASA 228

Query: 257 P---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTP-PSPSAA 120
           P   PA  PAS P++AP  + A +P   PA  P S  P  + A  P P+P+ A
Sbjct: 229 PASAPASAPASAPASAPASAPASAPASAPASAPAS-APASAPASAPAPAPAPA 280

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 47/150 (31%), Positives = 77/150 (51%), Gaps = 6/150 (4%)
 Frame = -3

Query: 488 ASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA 309
           ++SA+          A++  + + +A+ +   +A+ + +A   A+A+ P + P +A   A
Sbjct: 85  SASASASASASASASASASASASASASASASASASASASASASASASAPASAPASAPASA 144

Query: 308 AVPAPATPAPASSPATSP---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGA 147
              APA+ APAS+PA++P   PA  PAS P++AP  + A +P   PA  P S  P  + A
Sbjct: 145 PASAPAS-APASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPAS-APASAPA 202

Query: 146 DTPPSPSAAFSYSKPIIAATALSAALFAIA 57
             P S  A+   S P  A  +  A+  A A
Sbjct: 203 SAPASAPASAPASAPASAPASAPASAPASA 232

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 47/150 (31%), Positives = 76/150 (50%), Gaps = 6/150 (4%)
 Frame = -3

Query: 488 ASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA 309
           ++SA+          A++  + + +A+ +   +A+ + +A   A A+ P + P +A   A
Sbjct: 89  SASASASASASASASASASASASASASASASASASASASASASAPASAPASAPASAPASA 148

Query: 308 AVPAPATPAPASSPATSP---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGA 147
              APA+ APAS+PA++P   PA  PAS P++AP  + A +P   PA  P S  P  + A
Sbjct: 149 PASAPAS-APASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPAS-APASAPA 206

Query: 146 DTPPSPSAAFSYSKPIIAATALSAALFAIA 57
             P S  A+   S P  A  +  A+  A A
Sbjct: 207 SAPASAPASAPASAPASAPASAPASAPASA 236

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 44/132 (33%), Positives = 62/132 (46%), Gaps = 3/132 (2%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           + S  A A  +A      +  AP + P +A     A+ P + P +A  +    APAS+PA
Sbjct: 111 SASASASASASASASASASASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPA 170

Query: 263 TSPPAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
            S PA  PAS P++AP  + A +P   PA  P S  P  + A  P S  A+   S P  A
Sbjct: 171 -SAPASAPASAPASAPASAPASAPASAPASAPAS-APASAPASAPASAPASAPASAPASA 228

Query: 92  ATALSAALFAIA 57
             +  A+  A A
Sbjct: 229 PASAPASAPASA 240

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 46/151 (30%), Positives = 77/151 (50%), Gaps = 7/151 (4%)
 Frame = -3

Query: 488 ASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA 309
           ++SA+          A++  + + +A+ +   +A+ + +A   A+A+   +   +A+ PA
Sbjct: 75  SASASASASASASASASASASASASASASASASASASASASASASASASASASASASAPA 134

Query: 308 AVPAPA-TPAPASSPATSP---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSG 150
           + PA A   APAS+PA++P   PA  PAS P++AP  + A +P   PA  P S  P  + 
Sbjct: 135 SAPASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPAS-APASAP 193

Query: 149 ADTPPSPSAAFSYSKPIIAATALSAALFAIA 57
           A  P S  A+   S P  A  +  A+  A A
Sbjct: 194 ASAPASAPASAPASAPASAPASAPASAPASA 224

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 45/150 (30%), Positives = 77/150 (51%), Gaps = 6/150 (4%)
 Frame = -3

Query: 488 ASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA 309
           ++SA+          A++  + + +A+ +   +A+ + +A   A+A+   +   +A+  A
Sbjct: 69  SASASASASASASASASASASASASASASASASASASASASASASASASASASASASASA 128

Query: 308 AVPAPATPAPASSPATSP---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGA 147
           +  APA+ APAS+PA++P   PA  PAS P++AP  + A +P   PA  P S  P  + A
Sbjct: 129 SASAPAS-APASAPASAPASAPASAPASAPASAPASAPASAPASAPASAPAS-APASAPA 186

Query: 146 DTPPSPSAAFSYSKPIIAATALSAALFAIA 57
             P S  A+   S P  A  +  A+  A A
Sbjct: 187 SAPASAPASAPASAPASAPASAPASAPASA 216

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 44/147 (29%), Positives = 74/147 (50%), Gaps = 3/147 (2%)
 Frame = -3

Query: 488 ASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA 309
           ++SA+          A++  + + +A+ +   +A+ + +A   A+A+   +   +A+  A
Sbjct: 65  SASASASASASASASASASASASASASASASASASASASASASASASASASASASASASA 124

Query: 308 AVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTP 138
           +  A A+ APAS+PA S PA  PAS P++AP  + A +P   PA  P S  P  + A  P
Sbjct: 125 SASASAS-APASAPA-SAPASAPASAPASAPASAPASAPASAPASAPAS-APASAPASAP 181

Query: 137 PSPSAAFSYSKPIIAATALSAALFAIA 57
            S  A+   S P  A  +  A+  A A
Sbjct: 182 ASAPASAPASAPASAPASAPASAPASA 208

 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 39/147 (26%), Positives = 72/147 (48%), Gaps = 3/147 (2%)
 Frame = -3

Query: 488 ASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA 309
           ++SA+          A++  + + +A+ +   +A+ + +A   A+A+   +   +A+  A
Sbjct: 55  SASASASASASASASASASASASASASASASASASASASASASASASASASASASASASA 114

Query: 308 AVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTP 138
           +  A A+ + ++S + S PA  PAS P++AP  + A +P   PA  P S  P  + A  P
Sbjct: 115 SASASASASASASASASAPASAPASAPASAPASAPASAPASAPASAPAS-APASAPASAP 173

Query: 137 PSPSAAFSYSKPIIAATALSAALFAIA 57
            S  A+   S P  A  +  A+  A A
Sbjct: 174 ASAPASAPASAPASAPASAPASAPASA 200

[150][TOP]
>UniRef100_Q4A263 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
           RepID=Q4A263_EHV86
          Length = 403

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 40/122 (32%), Positives = 64/122 (52%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           SC    P   P  PP ++P P+  PP++   P  + P ++PP+  P+P   +P S P +S
Sbjct: 131 SCCLTPPPPPPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSS 190

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALS 78
           PP+P P+  PS+ P+ S   SPP+  P S  P  S   +PPSP     ++  ++     +
Sbjct: 191 PPSPPPSPPPSSPPS-SPPSSPPSSPPSS--PPSSPPSSPPSPPLQPGFTMTVVVKFTYN 247

Query: 77  AA 72
           A+
Sbjct: 248 AS 249

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 40/103 (38%), Positives = 54/103 (52%)
 Frame = -3

Query: 410 APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAST 231
           AP      TP P   PP    PP++ PP+  PP++ P+P   +P SSP + PP+P P+S 
Sbjct: 127 APMLSCCLTPPPPPPPPP---PPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSP 183

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           PS  P PS+  SPP   P S  P    +  P SP ++   S P
Sbjct: 184 PS--PPPSSPPSPPPSPPPSSPPSSPPSSPPSSPPSSPPSSPP 224

[151][TOP]
>UniRef100_C1E8G6 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E8G6_9CHLO
          Length = 3204

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 51/122 (41%), Positives = 58/122 (47%), Gaps = 9/122 (7%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTA------TPPAAVPAPATPAPASSPAT 261
            AP A    PP A PAP+  PP A   P+  PP A       PP A PAP+ P P + PA 
Sbjct: 989  APPAPSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPDAPAPPPPDAPPAPSPPPPDAPPAP 1048

Query: 260  SPPAPTP-ASTPSTAPTPSTAGSPPAP--TPDSLGPGPSGADTPPSPSAAFSYSKPIIAA 90
            SPP P+P A  PS  P    A SPP P   P    P    A +PP P A  + S P   A
Sbjct: 1049 SPPPPSPDAPPPSPPPLAPPAPSPPPPPVVPSPPPPNAPTAPSPPPPDAPMAPSPPPPGA 1108

Query: 89   TA 84
             A
Sbjct: 1109 PA 1110

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 42/103 (40%), Positives = 52/103 (50%), Gaps = 1/103 (0%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATPPTATP-PTATPPAAVPAPATPAPASSPATSPP 252
            A AP+  P   P+  P P A P  +  PP A P P+  PP A PAP+ P P + PA SPP
Sbjct: 959  APAPSPPPPDAPSPLPPPDAPPAPSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPPAPSPP 1018

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
             P        AP P    +PPAP+P      P+ +  PPSP A
Sbjct: 1019 PPDAPD----APAPPPPDAPPAPSPPPPDAPPAPSPPPPSPDA 1057

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 47/120 (39%), Positives = 57/120 (47%), Gaps = 13/120 (10%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP------------PAAVPAPATPAP 279
            AP A    PP A PAP+  PP A   P+  PP A P            PA  P  A PAP
Sbjct: 978  APPAPSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPDAPAPPPPDAPPAP 1037

Query: 278  ASSPATSPPAPTPASTPSTAPTPSTAG-SPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            +  P  +PPAP+P      AP PS    +PPAP+P    P P    +PP P+A  + S P
Sbjct: 1038 SPPPPDAPPAPSPPPPSPDAPPPSPPPLAPPAPSP----PPPPVVPSPPPPNAPTAPSPP 1093

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 44/103 (42%), Positives = 55/103 (53%), Gaps = 3/103 (2%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP---ATPAPASSPATSPP 252
            AP A    PP A PAP+  PP A  PP  +PP  +P A  P+P   A PAP+  P    P
Sbjct: 1022 APDAPAPPPPDAPPAPSPPPPDA--PPAPSPPPPSPDAPPPSPPPLAPPAPSPPPPPVVP 1079

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
            +P P + P TAP+P    +P AP+P    PG   A +PP P A
Sbjct: 1080 SPPPPNAP-TAPSPPPPDAPMAPSPPP--PGAPAAPSPPPPDA 1119

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 43/107 (40%), Positives = 56/107 (52%), Gaps = 6/107 (5%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP-ATPAPASSPATSPP 252
            A AP+  P   P A PAP+  PP A   P  +PP    P+ +P P A PAP+  P  +PP
Sbjct: 933  APAPSPPPPDAPDA-PAPSPPPPDAPDAPAPSPPPPDAPSPLPPPDAPPAPSPPPPDAPP 991

Query: 251  APTPASTPS-TAPTPSTAGSPPAPTPDSL----GPGPSGADTPPSPS 126
            AP+P    +  AP+P    +PPAP+P        P P   D PP+PS
Sbjct: 992  APSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPDAPAPPPPDAPPAPS 1038

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 43/105 (40%), Positives = 54/105 (51%), Gaps = 4/105 (3%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA--AVPAPATPAPAS--SPAT 261
            A +P   P  PP  +P P   PPA + PP   PP  +PP   A PAP+ P P +  +PA 
Sbjct: 969  APSPLPPPDAPPAPSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPDAPAP 1028

Query: 260  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             PP   PA +P     P  A SPP P+PD+  P P     PP+PS
Sbjct: 1029 PPPDAPPAPSPPPPDAP-PAPSPPPPSPDAPPPSPPPL-APPAPS 1071

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 48/123 (39%), Positives = 57/123 (46%), Gaps = 11/123 (8%)
 Frame = -3

Query: 437  SCLAQA-----PTAAPTKPPTATPAPTAQP-PAAATPPTATPPTA---TPPAAVPAPATP 285
            SC  QA     P  AP  P  + P P A P PA  +PP    PTA    PP A  AP+ P
Sbjct: 1213 SCELQAEPVIVPVPAPDPPAPSPPPPDAPPAPAEPSPPPPNAPTAPSPPPPDAPVAPSPP 1272

Query: 284  APASSPATSPPAPTPASTPSTAP--TPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSY 111
             P +  A SPP P   ++PS  P   P+    PP   P S  P P  A +PP P A  + 
Sbjct: 1273 PPNAPVAPSPPPPDAPTSPSPPPPLAPTAPSPPPPDAPSSPSPPPPDAPSPPPPDAPTAP 1332

Query: 110  SKP 102
            S P
Sbjct: 1333 SPP 1335

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 43/105 (40%), Positives = 52/105 (49%), Gaps = 6/105 (5%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSPPAP 246
            AP  +P  PP A  AP   PP    P    PP A P P+  P  A PAP+  P  +PPAP
Sbjct: 946  APAPSPP-PPDAPDAPAPSPPPPDAPSPLPPPDAPPAPSPPPPDAPPAPSPPPPDAPPAP 1004

Query: 245  TPA---STPSTAPTPSTAGSPPAPTPDSLGPGPS--GADTPPSPS 126
            +P    + P+ +P P  A   PAP P    P PS    D PP+PS
Sbjct: 1005 SPPPPDAPPAPSPPPPDAPDAPAPPPPDAPPAPSPPPPDAPPAPS 1049

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 39/98 (39%), Positives = 44/98 (44%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P A    PP A  AP   PP A   P   PP A P A  P+P  P    +PA SPP P  
Sbjct: 898  PDAPAPPPPDAPDAPAPSPPEAPDAPAPPPPDA-PDAPAPSPPPPDAPDAPAPSPPPPDA 956

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
               P+ +P P  A SP  P      P P   D PP+PS
Sbjct: 957  PDAPAPSPPPPDAPSPLPPPDAPPAPSPPPPDAPPAPS 994

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 48/108 (44%), Positives = 55/108 (50%), Gaps = 10/108 (9%)
 Frame = -3

Query: 419  PTAAPTKP-PTATPAPTA--QPPAAATPPTATP--PTATPPAAVPAPATPAP--ASSPAT 261
            PT AP  P P A PAP    QP A A PP   P  P  +PP A  APA P P    +PA 
Sbjct: 877  PTPAPGPPLPGAPPAPVVVPQPDAPAPPPPDAPDAPAPSPPEAPDAPAPPPPDAPDAPAP 936

Query: 260  SPPAPTPASTPSTAPTPSTAGSPPAPT---PDSLGPGPSGADTPPSPS 126
            SPP P     P+ +P P  A   PAP+   PD+  P P   D PP+PS
Sbjct: 937  SPPPPDAPDAPAPSPPPPDAPDAPAPSPPPPDAPSPLPP-PDAPPAPS 983

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 45/114 (39%), Positives = 53/114 (46%), Gaps = 7/114 (6%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTA------TPPAAVPAPATPAPASSPAT 261
            AP      PP A  AP+  PP A   P+  PP A       PP A  +P+ P P +  A 
Sbjct: 1243 APAEPSPPPPNAPTAPSPPPPDAPVAPSPPPPNAPVAPSPPPPDAPTSPSPPPPLAPTAP 1302

Query: 260  SPPAPTPASTPSTAPTPSTAGSPPAP-TPDSLGPGPSGADTPPSPSAAFSYSKP 102
            SPP P   S+PS  P P  A SPP P  P +  P P  A T PSP    S + P
Sbjct: 1303 SPPPPDAPSSPS--PPPPDAPSPPPPDAPTAPSPPPPNAPTAPSPPPPASPTAP 1354

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 45/113 (39%), Positives = 55/113 (48%), Gaps = 5/113 (4%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTA-TPPAAVP--APATPAPASSPATSPP 252
            APTA    PP A  AP+  PP A   P+  PP A T P+  P  AP  P+P    A S P
Sbjct: 1254 APTAPSPPPPDAPVAPSPPPPNAPVAPSPPPPDAPTSPSPPPPLAPTAPSPPPPDAPSSP 1313

Query: 251  APTPASTPSTAPTPS-TAGSPPAP-TPDSLGPGPSGADTPPSPSAAFSYSKPI 99
            +P P   PS  P  + TA SPP P  P +  P P  + T PSP    +   P+
Sbjct: 1314 SPPPPDAPSPPPPDAPTAPSPPPPNAPTAPSPPPPASPTAPSPPPPVAPQAPL 1366

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 43/109 (39%), Positives = 51/109 (46%), Gaps = 10/109 (9%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTA-TPPAAVPAPATPAPASSPATSPP-- 252
            AP A    PP A  AP   PP A   P  +PP    P A  P+P  P    +PA SPP  
Sbjct: 908  APDAPAPSPPEAPDAPAPPPPDAPDAPAPSPPPPDAPDAPAPSPPPPDAPDAPAPSPPPP 967

Query: 251  -APTPASTPST--APTPSTAGSPPAPTPD----SLGPGPSGADTPPSPS 126
             AP+P   P    AP+P    +PPAP+P        P P   D PP+PS
Sbjct: 968  DAPSPLPPPDAPPAPSPPPPDAPPAPSPPPPDAPPAPSPPPPDAPPAPS 1016

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 38/101 (37%), Positives = 46/101 (45%), Gaps = 3/101 (2%)
 Frame = -3

Query: 422  APTAAPTKPPTA-TPAPTAQPPAAATPPTATPPTATPPAAVP--APATPAPASSPATSPP 252
            AP+  P   P A  P P   PPA + PP   PP  +PP   P   P +P P + PA SPP
Sbjct: 1014 APSPPPPDAPDAPAPPPPDAPPAPSPPPPDAPPAPSPPPPSPDAPPPSPPPLAPPAPSPP 1073

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             P    +P     P+    PP   P +  P P GA   PSP
Sbjct: 1074 PPPVVPSPPPPNAPTAPSPPPPDAPMAPSPPPPGAPAAPSP 1114

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 43/120 (35%), Positives = 53/120 (44%), Gaps = 6/120 (5%)
 Frame = -3

Query: 467  IFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP-A 291
            + L+ G++    +      AP   PT TPAP  +P A   PP   P   TP    P P A
Sbjct: 831  LLLVGGIVCEVEILSGDACAPA--PTPTPAPVPEPSAPEPPPPDAPTQPTPAPGPPLPGA 888

Query: 290  TPAPASSPATSPPAPTPASTPST-APTPSTAGSPPAP----TPDSLGPGPSGADTPPSPS 126
             PAP   P    PAP P   P   AP+P  A   PAP     PD+  P P   D P +P+
Sbjct: 889  PPAPVVVPQPDAPAPPPPDAPDAPAPSPPEAPDAPAPPPPDAPDAPAPSPPPPDAPDAPA 948

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 48/122 (39%), Positives = 52/122 (42%), Gaps = 20/122 (16%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATP-APTAQPPAAATPPTATP----PTATP-PAAVPAPATPAPASSP 267
            A AP   PT  P   P AP   PP A T PT  P    P A P P  VP P  PAP    
Sbjct: 848  ACAPAPTPTPAPVPEPSAPEPPPPDAPTQPTPAPGPPLPGAPPAPVVVPQPDAPAPPPPD 907

Query: 266  ATSPPAPTPASTPST-APTPSTAGSPPAPTP------DSLGPGPSGAD-------TPPSP 129
            A   PAP+P   P   AP P  A   PAP+P      D+  P P   D       +PP P
Sbjct: 908  APDAPAPSPPEAPDAPAPPPPDAPDAPAPSPPPPDAPDAPAPSPPPPDAPDAPAPSPPPP 967

Query: 128  SA 123
             A
Sbjct: 968  DA 969

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 36/90 (40%), Positives = 44/90 (48%), Gaps = 3/90 (3%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT---PPAAVPAPATPAPASSPATSPP 252
            APT+    PP A  AP+  PP A + P+  PP A    PP A  AP+ P P +  A SPP
Sbjct: 1287 APTSPSPPPPLAPTAPSPPPPDAPSSPSPPPPDAPSPPPPDAPTAPSPPPPNAPTAPSPP 1346

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGP 162
             P   + PS  P P  A   P P P +  P
Sbjct: 1347 PPASPTAPS--PPPPVAPQAPLPVPKNACP 1374

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 39/97 (40%), Positives = 47/97 (48%), Gaps = 5/97 (5%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP---APATPAPASSPATSPP 252
            AP A    PP A  +P+  PP A T P+  PP A    + P   AP+ P P +  A SPP
Sbjct: 1276 APVAPSPPPPDAPTSPSPPPPLAPTAPSPPPPDAPSSPSPPPPDAPSPPPPDAPTAPSPP 1335

Query: 251  APTPASTPSTAPTPS-TAGSPPAP-TPDSLGPGPSGA 147
             P   + PS  P  S TA SPP P  P +  P P  A
Sbjct: 1336 PPNAPTAPSPPPPASPTAPSPPPPVAPQAPLPVPKNA 1372

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 37/98 (37%), Positives = 44/98 (44%), Gaps = 2/98 (2%)
 Frame = -3

Query: 422  APTAAPTKP--PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
            AP+  P  P  P  +P P A PPA + PP    P+  PP A  AP+ P P +  A SPP 
Sbjct: 1047 APSPPPPSPDAPPPSPPPLA-PPAPSPPPPPVVPSPPPPNAPTAPSPPPPDAPMAPSPPP 1105

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
            P   + PS  P       P AP    L P P     PP
Sbjct: 1106 PGAPAAPSPPP-------PDAPVVVVLAP-PISVPQPP 1135

[152][TOP]
>UniRef100_B9SG43 Copper ion binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9SG43_RICCO
          Length = 238

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 60/167 (35%), Positives = 75/167 (44%), Gaps = 37/167 (22%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP--------PAAVPAPAT 288
           AT+   QA  A    PP A   P + PPAAA  P +TPP ATP        P+  P  AT
Sbjct: 74  ATAPSKQAVPAPVATPPAAAVTPVSSPPAAAVTPVSTPPAATPAKSPAKSPPSPAPVAAT 133

Query: 287 PAPASS-PATSPPAPTPASTPSTA----PTPST-----------------AGSPPAPTPD 174
           P PA+S P T+PPAP P + P+ A    PTPS                    SPPAP  +
Sbjct: 134 PPPATSAPETAPPAPVPVAAPTAADVPAPTPSKKKPKKHSHATSPAPGPDVSSPPAPPME 193

Query: 173 SLGP-------GPSGADTPPSPSAAFSYSKPIIAATALSAALFAIAF 54
           + GP       GPS AD   S +      + ++   AL  A+ A  F
Sbjct: 194 APGPSLDASSPGPSVAD--DSGAETIRSLQKMVGGLALGWAVLAFIF 238

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 54/141 (38%), Positives = 67/141 (47%), Gaps = 37/141 (26%)
 Frame = -3

Query: 431 LAQAPTAAPTK---------PPTATPAPTAQPPAAATPPTATPPTAT--------PPAAV 303
           ++  P  AP+K         PP A   P + PPAAA  P +TPP AT        PP+  
Sbjct: 69  VSSPPATAPSKQAVPAPVATPPAAAVTPVSSPPAAAVTPVSTPPAATPAKSPAKSPPSPA 128

Query: 302 PAPATPAPA-SSPATSPPAPTPASTPST----APTPS-------TAGSPPAPTPD----- 174
           P  ATP PA S+P T+PPAP P + P+     APTPS       +  + PAP PD     
Sbjct: 129 PVAATPPPATSAPETAPPAPVPVAAPTAADVPAPTPSKKKPKKHSHATSPAPGPDVSSPP 188

Query: 173 ---SLGPGPSGADTPPSPSAA 120
                 PGPS   + P PS A
Sbjct: 189 APPMEAPGPSLDASSPGPSVA 209

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 52/120 (43%), Positives = 62/120 (51%), Gaps = 10/120 (8%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATP---PTATPPA--AVPAPAT--PAPASSPA 264
           AP  AP KP     AP + PPA  T P A P   P AT P+  AVPAP    PA A +P 
Sbjct: 38  APAKAPAKPEAPVAAPVSSPPAKPTTPVAAPVSSPPATAPSKQAVPAPVATPPAAAVTPV 97

Query: 263 TSPPAP--TPASTPSTA-PTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
           +SPPA   TP STP  A P  S A SPP+P P +  P P+ +    +P A    + P  A
Sbjct: 98  SSPPAAAVTPVSTPPAATPAKSPAKSPPSPAPVAATPPPATSAPETAPPAPVPVAAPTAA 157

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 51/109 (46%), Positives = 59/109 (54%), Gaps = 11/109 (10%)
 Frame = -3

Query: 419 PTAAPTKPPTAT-------PAPTAQPPAAATPPTATPPTAT-PPAAVPAPATPAPASSPA 264
           P AAP   P AT       PAP A PPAAA  P ++PP A   P + P  ATPA   SPA
Sbjct: 64  PVAAPVSSPPATAPSKQAVPAPVATPPAAAVTPVSSPPAAAVTPVSTPPAATPA--KSPA 121

Query: 263 TSPPAPTP--ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSPS 126
            SPP+P P  A+ P     P TA  PPAP P +    P+ AD P P+PS
Sbjct: 122 KSPPSPAPVAATPPPATSAPETA--PPAPVPVA---APTAADVPAPTPS 165

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 43/130 (33%), Positives = 62/130 (47%), Gaps = 4/130 (3%)
 Frame = -3

Query: 467 IFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT 288
           I LI+  +     + APT  P KP TA     A+P A    P ++PP A P   V AP +
Sbjct: 12  ICLIVAGVGGQSPSAAPTTTPAKPVTAPAKAPAKPEAPVAAPVSSPP-AKPTTPVAAPVS 70

Query: 287 PAPASSPAT----SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
             PA++P+     +P A  PA+  +   +P  A   P  TP +  P  S A +PPSP+  
Sbjct: 71  SPPATAPSKQAVPAPVATPPAAAVTPVSSPPAAAVTPVSTPPAATPAKSPAKSPPSPAPV 130

Query: 119 FSYSKPIIAA 90
            +   P  +A
Sbjct: 131 AATPPPATSA 140

[153][TOP]
>UniRef100_C7J1V0 Os04g0545250 protein n=2 Tax=Oryza sativa RepID=C7J1V0_ORYSJ
          Length = 298

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 50/110 (45%), Positives = 56/110 (50%), Gaps = 13/110 (11%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPP--AAATPPTATPPTATPPAAVPAPATP----APASSP 267
           A AP  A   PPTAT +P    P  A A PP ATPPT   P A P  ATP     PA++P
Sbjct: 129 AAAPQLAAASPPTATSSPPVSAPTLAVAAPPLATPPTVAAPVASPPLATPPAALPPATAP 188

Query: 266 ATSPPAP-------TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP 138
            TS PAP        P +TP+ AP P+     PAP P S  P P  A TP
Sbjct: 189 PTSAPAPLLAAPVLAPVATPTLAPAPAPVS--PAPAPVSPAPAPIVAPTP 236

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 69/172 (40%), Positives = 76/172 (44%), Gaps = 30/172 (17%)
 Frame = -3

Query: 497 PKMASSAAVQIFLILGLLATSCL-AQAPTAAPTKPPTATP----APTAQPPAAATPPTAT 333
           P   ++AA Q+       ATS     APT A   PP ATP    AP A PP A TPP A 
Sbjct: 124 PPTTAAAAPQLAAASPPTATSSPPVSAPTLAVAAPPLATPPTVAAPVASPPLA-TPPAAL 182

Query: 332 PPTATPP---------------------AAVPAPATPAPAS-SPATSP-PAPTPASTPST 222
           PP   PP                     A  PAP +PAPA  SPA +P  APTPA  P  
Sbjct: 183 PPATAPPTSAPAPLLAAPVLAPVATPTLAPAPAPVSPAPAPVSPAPAPIVAPTPA--PIL 240

Query: 221 APTPSTAGSPPAPTPDSLGPGPSGADTPPS--PSAAFSYSKPIIAATALSAA 72
           AP  S   +P      SL PGPS A    S   SAA      I A  AL+AA
Sbjct: 241 APELSPLMAPELSPLGSLSPGPSLAPAMASEDESAATRAPAGIAALVALAAA 292

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 56/140 (40%), Positives = 68/140 (48%), Gaps = 26/140 (18%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAP---TAQPP--AAATPP--TATPPTAT-------PPAAVPAP- 294
           A AP  +   PP A  AP    A PP  AAA P    A+PPTAT       P  AV AP 
Sbjct: 100 ASAPRVSAAAPPNAASAPQVSAAAPPTTAAAAPQLAAASPPTATSSPPVSAPTLAVAAPP 159

Query: 293 -ATPAPASSPATSPPAPTP--ASTPSTAPTPSTAGSP--------PAPTPDSLGPGPSGA 147
            ATP   ++P  SPP  TP  A  P+TAP P++A +P        P  TP +L P P  A
Sbjct: 160 LATPPTVAAPVASPPLATPPAALPPATAP-PTSAPAPLLAAPVLAPVATP-TLAPAP--A 215

Query: 146 DTPPSPSAAFSYSKPIIAAT 87
              P+P+       PI+A T
Sbjct: 216 PVSPAPAPVSPAPAPIVAPT 235

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 48/139 (34%), Positives = 63/139 (45%), Gaps = 4/139 (2%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTAAPTK---PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA 291
           L L LL  SC AQ+P ++P+    PP +   P A   ++     A P TA     V + A
Sbjct: 7   LALCLLLVSCAAQSPASSPSASNGPPLSAATPQASAASSPQVSAAAPTTAASAPQVSSAA 66

Query: 290 TPA-PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
            P   AS+P  S  APT A   + AP  S A    APT  +  P  S A  PP+ ++A  
Sbjct: 67  APTNAASAPQVSAAAPTNA---AQAPKVSAA----APTNAASAPRVSAA-APPNAASAPQ 118

Query: 113 YSKPIIAATALSAALFAIA 57
            S      TA +A   A A
Sbjct: 119 VSAAAPPTTAAAAPQLAAA 137

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 45/127 (35%), Positives = 56/127 (44%), Gaps = 10/127 (7%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPT----AQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
           A APT A   P  +  APT    A   +AA PP A        AA P  A  AP  + A 
Sbjct: 79  AAAPTNAAQAPKVSAAAPTNAASAPRVSAAAPPNAASAPQVSAAAPPTTAAAAPQLA-AA 137

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS------GADTPPSPSAAFSYSKPI 99
           SPP  T +S P +APT + A  P A  P    P  S       A  PP+ +   S   P+
Sbjct: 138 SPPTAT-SSPPVSAPTLAVAAPPLATPPTVAAPVASPPLATPPAALPPATAPPTSAPAPL 196

Query: 98  IAATALS 78
           +AA  L+
Sbjct: 197 LAAPVLA 203

[154][TOP]
>UniRef100_A9PES9 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9PES9_POPTR
          Length = 208

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 53/131 (40%), Positives = 66/131 (50%), Gaps = 6/131 (4%)
 Frame = -3

Query: 458 ILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATP-- 285
           +L ++      QAP A PT  P ATP   A P AA T PT   P ++PPAA PA + P  
Sbjct: 11  LLCIIIAGVGGQAPAATPTSTP-ATPTTPAVPVAAPTKPTTPAPVSSPPAATPAASPPKQ 69

Query: 284 ---APASSP-ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAF 117
               P ++P AT PP+ TP S+P   PTP    SPPA +P S  P  S    PP+     
Sbjct: 70  TVSVPVAAPLATPPPSATPVSSP---PTPVPVSSPPAKSPPSPEPVASPTSAPPA----- 121

Query: 116 SYSKPIIAATA 84
             S P+   TA
Sbjct: 122 --STPVAPPTA 130

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 56/147 (38%), Positives = 67/147 (45%), Gaps = 41/147 (27%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAA---ATPPTAT------PPTATPPAA---VP 300
           AT      P AAPTKP   TPAP + PPAA   A+PP  T       P ATPP +   V 
Sbjct: 33  ATPTTPAVPVAAPTKP--TTPAPVSSPPAATPAASPPKQTVSVPVAAPLATPPPSATPVS 90

Query: 299 APATPAPASS-PATSPPAPTPASTPSTAPTPSTAGSPPA--------------------- 186
           +P TP P SS PA SPP+P P ++P++AP  ST  +PP                      
Sbjct: 91  SPPTPVPVSSPPAKSPPSPEPVASPTSAPPASTPVAPPTAEVPAPSHSKKKPKKHQAPAP 150

Query: 185 -------PTPDSLGPGPSGADTPPSPS 126
                  P P +  PGPS     P PS
Sbjct: 151 GPALLSPPAPPTEAPGPSAESVSPGPS 177

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 39/108 (36%), Positives = 51/108 (47%), Gaps = 16/108 (14%)
 Frame = -3

Query: 419 PTAAP--TKPPTATPA-------PTAQPPAAATP-------PTATPPTATPPAAVPAPAT 288
           P AAP  T PP+ATP        P + PPA + P       PT+ PP +T P A P    
Sbjct: 74  PVAAPLATPPPSATPVSSPPTPVPVSSPPAKSPPSPEPVASPTSAPPAST-PVAPPTAEV 132

Query: 287 PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
           PAP+ S         PA  P+    P+     P P+ +S+ PGPS +D
Sbjct: 133 PAPSHSKKKPKKHQAPAPGPALLSPPAPPTEAPGPSAESVSPGPSLSD 180

[155][TOP]
>UniRef100_A9PD05 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
           RepID=A9PD05_POPTR
          Length = 208

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 53/131 (40%), Positives = 66/131 (50%), Gaps = 6/131 (4%)
 Frame = -3

Query: 458 ILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATP-- 285
           +L ++      QAP A PT  P ATP   A P AA T PT   P ++PPAA PA + P  
Sbjct: 11  LLCIIIAGVGGQAPAATPTSTP-ATPTTPAVPVAAPTKPTTPAPVSSPPAATPAASPPKQ 69

Query: 284 ---APASSP-ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAF 117
               P ++P AT PP+ TP S+P   PTP    SPPA +P S  P  S    PP+     
Sbjct: 70  TVSVPVAAPLATPPPSATPVSSP---PTPVPVSSPPAKSPPSPEPVASPTSAPPA----- 121

Query: 116 SYSKPIIAATA 84
             S P+   TA
Sbjct: 122 --STPVAPPTA 130

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 56/147 (38%), Positives = 67/147 (45%), Gaps = 41/147 (27%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAA---ATPPTAT------PPTATPPAA---VP 300
           AT      P AAPTKP   TPAP + PPAA   A+PP  T       P ATPP +   V 
Sbjct: 33  ATPTTPAVPVAAPTKP--TTPAPVSSPPAATPAASPPKQTVSVPVAAPLATPPPSATPVS 90

Query: 299 APATPAPASS-PATSPPAPTPASTPSTAPTPSTAGSPPA--------------------- 186
           +P TP P SS PA SPP+P P ++P++AP  ST  +PP                      
Sbjct: 91  SPPTPVPVSSPPAKSPPSPEPVASPTSAPPASTPVAPPTAEVPAPSHSKKKPKKHQAPAP 150

Query: 185 -------PTPDSLGPGPSGADTPPSPS 126
                  P P +  PGPS     P PS
Sbjct: 151 GPALLSPPAPPTEAPGPSAESVSPGPS 177

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 45/138 (32%), Positives = 61/138 (44%), Gaps = 16/138 (11%)
 Frame = -3

Query: 419 PTAAP--TKPPTATPA-------PTAQPPAAATP-------PTATPPTATPPAAVPAPAT 288
           P AAP  T PP+ATP        P + PPA + P       PT+ PP +T P A P    
Sbjct: 74  PVAAPLATPPPSATPVSSPPTPVPVSSPPAKSPPSPEPVASPTSAPPAST-PVAPPTAEV 132

Query: 287 PAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYS 108
           PAP+ S         PA  P+    P+     P P+ +S+ PGPS +D   S +      
Sbjct: 133 PAPSHSKKKPKKHQAPAPGPALLSPPAPPTEAPGPSAESVSPGPSLSDN--SGAETIRCL 190

Query: 107 KPIIAATALSAALFAIAF 54
           + +    AL   L A+ F
Sbjct: 191 QKMAGGLALGWGLLALIF 208

[156][TOP]
>UniRef100_A7P9B2 Chromosome chr3 scaffold_8, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7P9B2_VITVI
          Length = 1068

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 44/118 (37%), Positives = 58/118 (49%), Gaps = 17/118 (14%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAA-TPPTATPPTA----TPPAAVPAPATPAPASSPA 264
           A  P + PT  P   P+P+  PP     PP +TPPT     +PP +VP+   P P+ SP 
Sbjct: 412 ASTPRSPPTPKPQPHPSPSPSPPKPQPAPPKSTPPTPKPRPSPPKSVPSTPKPQPSPSPV 471

Query: 263 TSPPAPTPASTPSTAPTPST------------AGSPPAPTPDSLGPGPSGADTPPSPS 126
           ++PP PTP  TP+  P PS               +PP PTP    P P+   +PP PS
Sbjct: 472 SAPPTPTPTPTPTPKPKPSPHPPKTSSPPPPHKATPPTPTPK---PSPAPISSPPQPS 526

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 40/98 (40%), Positives = 49/98 (50%), Gaps = 4/98 (4%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA-- 264
           S ++  PT  PT  PT  P P+  PP  ++PP   P  ATPP   P P +PAP SSP   
Sbjct: 469 SPVSAPPTPTPTPTPTPKPKPSPHPPKTSSPP--PPHKATPPTPTPKP-SPAPISSPPQP 525

Query: 263 --TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGP 156
              SPP+ + A +PS  P P     PPA  PD     P
Sbjct: 526 SHPSPPSDSAAPSPSPKPAPIPQVPPPAFPPDPKNYSP 563

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 38/107 (35%), Positives = 47/107 (43%), Gaps = 11/107 (10%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPA--- 237
           P + PT  PA T + P    P     P+ +PP   PAP    P S+P T  P P+P    
Sbjct: 403 PVRSPTPPPASTPRSPPTPKPQPHPSPSPSPPKPQPAP----PKSTPPTPKPRPSPPKSV 458

Query: 236 -STPSTAPTPSTAGSPPAPTPDSL-------GPGPSGADTPPSPSAA 120
            STP   P+PS   +PP PTP           P P    +PP P  A
Sbjct: 459 PSTPKPQPSPSPVSAPPTPTPTPTPTPKPKPSPHPPKTSSPPPPHKA 505

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 41/119 (34%), Positives = 55/119 (46%), Gaps = 14/119 (11%)
 Frame = -3

Query: 440 TSCLAQAP---TAAPTKPPTATPAPTAQP-------PAAATPP--TATPPTATPPAAVPA 297
           ++CL+  P   +A    P  + P   ++        P    PP  + TPP A+ P + P 
Sbjct: 361 SNCLSDRPKQKSARTCLPVVSRPVDCSKSKCGGKSSPPKPRPPVRSPTPPPASTPRSPPT 420

Query: 296 PATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPP--APTPDSLGPGPSGADTPPSPS 126
           P  P P  SP+ SPP P PA   ST PTP    SPP   P+     P PS    PP+P+
Sbjct: 421 PK-PQPHPSPSPSPPKPQPAPPKSTPPTPKPRPSPPKSVPSTPKPQPSPSPVSAPPTPT 478

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 40/118 (33%), Positives = 55/118 (46%), Gaps = 13/118 (11%)
 Frame = -3

Query: 419 PTAAPTKP-PTATPAPTAQPPAAATPPTAT---------PPTATPP---AAVPAPATPAP 279
           P + P+ P P  +P+P + PP     PT T         P T++PP    A P   TP P
Sbjct: 455 PKSVPSTPKPQPSPSPVSAPPTPTPTPTPTPKPKPSPHPPKTSSPPPPHKATPPTPTPKP 514

Query: 278 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSK 105
           + +P +SPP P+  S PS +  PS +   P P P    P P+    P + S  FS  K
Sbjct: 515 SPAPISSPPQPSHPSPPSDSAAPSPS---PKPAPIPQVPPPAFPPDPKNYSPIFSPPK 569

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 39/110 (35%), Positives = 48/110 (43%), Gaps = 9/110 (8%)
 Frame = -3

Query: 419 PTAAPTKPP----TATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP---AT 261
           PT  P   P     +TP P   P   + PPT TP     P   P+P  P  +S P     
Sbjct: 446 PTPKPRPSPPKSVPSTPKPQPSPSPVSAPPTPTPTPTPTPKPKPSPHPPKTSSPPPPHKA 505

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS--GADTPPSPSAAF 117
           +PP PTP  +P+   +P    S P+P  DS  P PS   A  P  P  AF
Sbjct: 506 TPPTPTPKPSPAPISSPPQP-SHPSPPSDSAAPSPSPKPAPIPQVPPPAF 554

[157][TOP]
>UniRef100_A0N015 Vegetative cell wall protein n=1 Tax=Chlamydomonas incerta
           RepID=A0N015_CHLIN
          Length = 613

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 44/116 (37%), Positives = 65/116 (56%), Gaps = 7/116 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPP-----TATPPTATPPAAVPAPATPAPA-SSPATS 258
           P+  P+ PP   P+P + PP +  PP     T  PP+  PP+  P+P  P+PA  SP  S
Sbjct: 330 PSPPPSPPPPTPPSPPSPPPPSPVPPSPAPGTPVPPSPAPPSPAPSPIPPSPAPPSPPPS 389

Query: 257 PPAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
           P  P+P+ +PS +P+PS + SP P+P+P S  P PS + +P   S    ++   IA
Sbjct: 390 PAPPSPSPSPSPSPSPSPSPSPSPSPSP-SPKPSPSPSPSPSPVSVKLVWADDAIA 444

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 42/99 (42%), Positives = 56/99 (56%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           AP + P  P   +PAP +  P + TPP+  PP+  PP+  P+PA P+PA  P+  PP+P 
Sbjct: 49  APPSPPPSPLPPSPAPPSPAPPSPTPPSPEPPSPAPPSPPPSPAPPSPA-PPSPVPPSPA 107

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P   PS  P PS A  PP+P P S  P    +  PPSP+
Sbjct: 108 PPLPPSPVP-PSPA--PPSPVPPSPAPPVPPSPAPPSPA 143

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 41/111 (36%), Positives = 56/111 (50%), Gaps = 12/111 (10%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-----------APATPAPA 276
           +P  +P  P  A P+P    PA   PP+  PP+  PP+ VP           AP +PAP 
Sbjct: 86  SPPPSPAPPSPAPPSPVPPSPAPPLPPSPVPPSPAPPSPVPPSPAPPVPPSPAPPSPAPP 145

Query: 275 SSPATSPPAPTPASTPSTA-PTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P+  PP+P P + PS A P+P+    PP+P P S  P      +PPSP+
Sbjct: 146 LPPSPVPPSPAPPAPPSPAPPSPAPPSPPPSPAPPSPEPPSPAPPSPPSPA 196

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 2/109 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAA--TPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           P+ AP  PP +   P+ +PP+ A  +PP+  PP+  PP+  PAP +PAP   P+ +PP+P
Sbjct: 166 PSPAPPSPPPSPAPPSPEPPSPAPPSPPSPAPPSPAPPS--PAPPSPAPPVPPSPAPPSP 223

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
            P S P +   PS    PP+P P S  P PS     P+P +    S PI
Sbjct: 224 APPSPPPSPAPPSP--EPPSPVPPSPAP-PSPVPPSPAPPSPVPPSPPI 269

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 39/99 (39%), Positives = 50/99 (50%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTA-TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           P+  P  PP   +PAP +  P +  PP+  PP+  PP+ VP    P P+  P   P  P 
Sbjct: 260 PSPVPPSPPIPPSPAPPSPAPPSPVPPSPAPPSPVPPSPVPPSPPPPPSPPPPPPPRPPF 319

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           PA+TP     PS   SPP PTP S    P  +  PPSP+
Sbjct: 320 PANTPMPPSPPSPPPSPPPPTPPSPPSPPPPSPVPPSPA 358

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 56/135 (41%), Positives = 72/135 (53%), Gaps = 9/135 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS----SPATSP- 255
           P   P  P   +P P+  PP   +PP+  PP+  PP+  PAP TP P S    SPA SP 
Sbjct: 320 PANTPMPPSPPSPPPSPPPPTPPSPPSPPPPSPVPPS--PAPGTPVPPSPAPPSPAPSPI 377

Query: 254 -PAPTPASTPSTAPTPSTAGSP-PAPTPD-SLGPGPSGADTP-PSPSAAFSYSKPIIAAT 87
            P+P P S P +   PS + SP P+P+P  S  P PS + +P PSPS + S   P   + 
Sbjct: 378 PPSPAPPSPPPSPAPPSPSPSPSPSPSPSPSPSPSPSPSPSPKPSPSPSPS---PSPVSV 434

Query: 86  ALSAALFAIAF*DLS 42
            L  A  AIAF DL+
Sbjct: 435 KLVWADDAIAFDDLN 449

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 48/111 (43%), Positives = 58/111 (52%), Gaps = 13/111 (11%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQP------PAAATPPTATPPTATPPA----AVPAPATPAPASS 270
           P+ AP  P   +PAP   P      PA   PP+  PP+  PPA    A P+PA P+P  S
Sbjct: 117 PSPAPPSPVPPSPAPPVPPSPAPPSPAPPLPPSPVPPSPAPPAPPSPAPPSPAPPSPPPS 176

Query: 269 PA---TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           PA     PP+P P S PS AP PS A  PP+P P S  P    +  PPSP+
Sbjct: 177 PAPPSPEPPSPAPPSPPSPAP-PSPA--PPSPAPPSPAPPVPPSPAPPSPA 224

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 42/105 (40%), Positives = 54/105 (51%), Gaps = 8/105 (7%)
 Frame = -3

Query: 419 PTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-------TPAPASSPA 264
           P+ AP  P P   P+P    PA   PP+  PP+  PP+  P+PA       +PAP S P+
Sbjct: 135 PSPAPPSPAPPLPPSPVPPSPAPPAPPSPAPPSPAPPSPPPSPAPPSPEPPSPAPPSPPS 194

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            +PP+P P S    +P P    SP  P+P    P PS A  PPSP
Sbjct: 195 PAPPSPAPPSPAPPSPAPPVPPSPAPPSPAPPSPPPSPA--PPSP 237

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 41/99 (41%), Positives = 53/99 (53%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPASSPATSPPAPT 243
           P+ AP  P   +P P+  PP+ A PP+  PP+ TPP+  P +PA P+P  SPA   PAP 
Sbjct: 41  PSPAPPSPAPPSPPPSPLPPSPA-PPSPAPPSPTPPSPEPPSPAPPSPPPSPAPPSPAPP 99

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
               PS AP    +  PP+P P S  P       PPSP+
Sbjct: 100 SPVPPSPAPPLPPSPVPPSPAPPSPVPPSPAPPVPPSPA 138

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 41/109 (37%), Positives = 54/109 (49%), Gaps = 2/109 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+ AP  P   +P P +  P +  PP+  PP+  PP + P P  P P   PA +P  P+P
Sbjct: 271 PSPAPPSPAPPSPVPPSPAPPSPVPPSPVPPSPPPPPSPPPPPPPRP-PFPANTPMPPSP 329

Query: 239 ASTPST--APTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
            S P +   PTP +  SPP P+P    P P G   PPSP+       PI
Sbjct: 330 PSPPPSPPPPTPPSPPSPPPPSPVPPSPAP-GTPVPPSPAPPSPAPSPI 377

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 44/116 (37%), Positives = 57/116 (49%), Gaps = 18/116 (15%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA----TPAPAS--SPATS 258
           P+ AP  P   +PAP +  P +  PP+  PP + PP   P P     TP P S  SP  S
Sbjct: 276 PSPAPPSPVPPSPAPPSPVPPSPVPPSPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPS 335

Query: 257 PPAPTPASTPS--------TAPTPST----AGSPPAPTPDSLGPGPSGADTPPSPS 126
           PP PTP S PS         +P P T    + +PP+P P  + P P+    PPSP+
Sbjct: 336 PPPPTPPSPPSPPPPSPVPPSPAPGTPVPPSPAPPSPAPSPIPPSPAPPSPPPSPA 391

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 41/108 (37%), Positives = 58/108 (53%), Gaps = 1/108 (0%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
           P+ AP  PP + PAP +  P +  PP+  PP+  PP+ A P+P  P+P   P+ +PP+P 
Sbjct: 221 PSPAPPSPPPS-PAPPSPEPPSPVPPSPAPPSPVPPSPAPPSPVPPSPPIPPSPAPPSPA 279

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
           P S    +P P +   PP+P P S  P PS    PP P   F  + P+
Sbjct: 280 PPSPVPPSPAPPSP-VPPSPVPPSPPPPPS-PPPPPPPRPPFPANTPM 325

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 40/101 (39%), Positives = 53/101 (52%), Gaps = 3/101 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPAS--SPATSPPA 249
           P+  P  P   +PAP + PP+ A PP+  PP+  PP+ A P P +P P S   P+  PP+
Sbjct: 70  PSPTPPSPEPPSPAPPSPPPSPA-PPSPAPPSPVPPSPAPPLPPSPVPPSPAPPSPVPPS 128

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P P   PS AP       PP+P P S  P    +  PPSP+
Sbjct: 129 PAPPVPPSPAPPSPAPPLPPSPVPPSPAPPAPPSPAPPSPA 169

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 41/110 (37%), Positives = 57/110 (51%), Gaps = 10/110 (9%)
 Frame = -3

Query: 425 QAPTAAPTKPPT------ATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS-- 270
           + P+ AP  PP+      A P+P    PA   PP+  PP+  PP+  P+PA P+P     
Sbjct: 183 EPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPVPPSPAPPSPAPPSPPPSPAPPSPEPPSP 242

Query: 269 --PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P+ +PP+P P S    +P P +   PP+P P S  P PS    PPSP+
Sbjct: 243 VPPSPAPPSPVPPSPAPPSPVPPSPPIPPSPAPPSPAP-PS--PVPPSPA 289

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 45/102 (44%), Positives = 61/102 (59%), Gaps = 4/102 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTA---TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           P+ AP  PP+    +PAP + PP+ A PP+  PP+  PP+  P+PA P+PA  P+ +PP+
Sbjct: 153 PSPAPPAPPSPAPPSPAPPSPPPSPA-PPSPEPPSPAPPSP-PSPAPPSPA-PPSPAPPS 209

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS-GADTPPSPS 126
           P P   PS AP PS A  PP+P P    P P   +  PPSP+
Sbjct: 210 PAPPVPPSPAP-PSPA--PPSPPPSPAPPSPEPPSPVPPSPA 248

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 38/105 (36%), Positives = 52/105 (49%), Gaps = 6/105 (5%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPTATP--PTATPPAAV---PAPATPAPASSPAT 261
           + P+ AP  PP +   P+  PP+   P  A P  P+  PP+     P P +PAP   P+ 
Sbjct: 78  EPPSPAPPSPPPSPAPPSPAPPSPVPPSPAPPLPPSPVPPSPAPPSPVPPSPAPPVPPSP 137

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDS-LGPGPSGADTPPSP 129
           +PP+P P   PS  P      +PP+P P S   P P  +  PPSP
Sbjct: 138 APPSPAPPLPPSPVPPSPAPPAPPSPAPPSPAPPSPPPSPAPPSP 182

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 41/103 (39%), Positives = 52/103 (50%), Gaps = 6/103 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTA---TPAPTAQPPAAATPPTATPPTATPPAAV---PAPATPAPASSPATS 258
           P+ AP  PP+    +PAP + PP+ A PP+  PP+  PP+     P P +PAP S    S
Sbjct: 208 PSPAPPVPPSPAPPSPAPPSPPPSPA-PPSPEPPSPVPPSPAPPSPVPPSPAPPSPVPPS 266

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           PP P   + PS AP      SP  P+P    P P     PPSP
Sbjct: 267 PPIPPSPAPPSPAPPSPVPPSPAPPSPVPPSPVPPSPPPPPSP 309

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 43/121 (35%), Positives = 58/121 (47%), Gaps = 17/121 (14%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTA---------TPPTATPPAAVPAPATPAPASSP 267
           P+ AP  P   +P P + PP  + PP           TP   +PP+  P+P  P P S P
Sbjct: 286 PSPAPPSPVPPSPVPPSPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPPPPTPPSPP 345

Query: 266 ATSPPAPTPAST-------PSTAP-TPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSY 111
           +  PP+P P S        PS AP +P+ +  PP+P P S  P P+     PSPS + S 
Sbjct: 346 SPPPPSPVPPSPAPGTPVPPSPAPPSPAPSPIPPSPAPPSPPPSPAPPSPSPSPSPSPSP 405

Query: 110 S 108
           S
Sbjct: 406 S 406

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 39/104 (37%), Positives = 53/104 (50%), Gaps = 7/104 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV----PAPATPAPASS--PATS 258
           P+ AP  P   +P P +  P +  PP+  PP+  PP+      PAP +PAP S   P+ +
Sbjct: 230 PSPAPPSPEPPSPVPPSPAPPSPVPPSPAPPSPVPPSPPIPPSPAPPSPAPPSPVPPSPA 289

Query: 257 PPAPTPAS-TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           PP+P P S  P + P P +   PP P P    P P+    PPSP
Sbjct: 290 PPSPVPPSPVPPSPPPPPSPPPPPPPRP----PFPANTPMPPSP 329

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 42/105 (40%), Positives = 55/105 (52%), Gaps = 7/105 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQP---PAAATPPTATPPTATPPA----AVPAPATPAPASSPAT 261
           P+ AP  P   +PAP + P   P +  PP+  PP+  PP     A P+PA P+P  SPA 
Sbjct: 175 PSPAPPSPEPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPVPPSPAPPSPAPPSPPPSPA- 233

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            PP+P P S    +P P +   PP+P P S  P P     PPSP+
Sbjct: 234 -PPSPEPPSPVPPSPAPPSP-VPPSPAPPS--PVPPSPPIPPSPA 274

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 47/128 (36%), Positives = 70/128 (54%), Gaps = 17/128 (13%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAP-TAQPPAAATP---PTATPPTATPPAAVPAPATPAPASSPATSP- 255
           P+  P  P   +PAP T  PP+ A P   P+  PP+  PP+  P+PA P+P+ SP+ SP 
Sbjct: 345 PSPPPPSPVPPSPAPGTPVPPSPAPPSPAPSPIPPSPAPPSPPPSPAPPSPSPSPSPSPS 404

Query: 254 --PAPTPASTPSTAPTPSTAGSPPAPTPDSLG----------PGPSGADTPPSPSAAFSY 111
             P+P+P+ +PS +P PS + S P+P+P S+              +G  T P  SA+   
Sbjct: 405 PSPSPSPSPSPSPSPKPSPSPS-PSPSPVSVKLVWADDAIAFDDLNGTSTKPG-SASRMI 462

Query: 110 SKPIIAAT 87
            +P IA+T
Sbjct: 463 GEPNIAST 470

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 32/82 (39%), Positives = 45/82 (54%), Gaps = 3/82 (3%)
 Frame = -3

Query: 362 PAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTA---GSP 192
           P +  PP+  PP+  P    P+PA P+PA  P+ +PP+P P S    +P PS A    +P
Sbjct: 40  PPSPAPPSPAPPSPPPSPLPPSPAPPSPA-PPSPTPPSPEPPSPAPPSPPPSPAPPSPAP 98

Query: 191 PAPTPDSLGPGPSGADTPPSPS 126
           P+P P S  P    +  PPSP+
Sbjct: 99  PSPVPPSPAPPLPPSPVPPSPA 120

[158][TOP]
>UniRef100_B6KAY2 Putative uncharacterized protein n=2 Tax=Toxoplasma gondii
           RepID=B6KAY2_TOXGO
          Length = 1112

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 49/126 (38%), Positives = 66/126 (52%), Gaps = 2/126 (1%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           A+S    +P   P  PP  +P P   PPA + P  +  P + PPA  P   +P   S P+
Sbjct: 250 ASSLQGVSPVQLPPSPPAPSP-PAPSPPAPSPPAPSPSPASAPPAPSPPSVSPPAPSPPS 308

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP--GPSGADTPPSPSAAFSYSKPIIAA 90
            SPPAP+P S    AP P +  SPPAP+P S+ P   P+ +  PPS S   + S P ++ 
Sbjct: 309 VSPPAPSPPSVSPPAPPPPSV-SPPAPSPPSVAPPAPPAPSVAPPSLSPP-APSPPSVSP 366

Query: 89  TALSAA 72
            A SAA
Sbjct: 367 PAPSAA 372

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 44/107 (41%), Positives = 57/107 (53%), Gaps = 4/107 (3%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           A S  A +P A    P +A PAP+   P + +PP  +PP+ +PPA  P   +P     P+
Sbjct: 272 APSPPAPSPPAPSPSPASAPPAPS---PPSVSPPAPSPPSVSPPAPSPPSVSPPAPPPPS 328

Query: 263 TSPPAPTPAS-TPSTAPTPSTAG---SPPAPTPDSLGPGPSGADTPP 135
            SPPAP+P S  P   P PS A    SPPAP+P S+ P    A  PP
Sbjct: 329 VSPPAPSPPSVAPPAPPAPSVAPPSLSPPAPSPPSVSPPAPSAAPPP 375

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 52/134 (38%), Positives = 72/134 (53%), Gaps = 27/134 (20%)
 Frame = -3

Query: 446 LATSCLAQAPTAA--------PTKPPTATPAPT---AQPPAAATPPTAT----------- 333
           + TS   + P AA        P KP +A+PA     A PP A    +A+           
Sbjct: 203 MTTSLHVRRPEAAKPATTPVPPRKPQSASPASRVSFAPPPEAKVKSSASSLQGVSPVQLP 262

Query: 332 --PPTATPPA-AVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP 162
             PP  +PPA + PAP+ PAP+ SPA++PPAP+P S    AP+P +  SPPAP+P S+ P
Sbjct: 263 PSPPAPSPPAPSPPAPSPPAPSPSPASAPPAPSPPSVSPPAPSPPSV-SPPAPSPPSVSP 321

Query: 161 --GPSGADTPPSPS 126
              P  + +PP+PS
Sbjct: 322 PAPPPPSVSPPAPS 335

[159][TOP]
>UniRef100_B3MVK1 GF23569 n=1 Tax=Drosophila ananassae RepID=B3MVK1_DROAN
          Length = 708

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 42/102 (41%), Positives = 52/102 (50%), Gaps = 7/102 (6%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAAT----PPTATPPTATPPAAVPAPATPAPASSPATSPPAPT- 243
           PT+PP   P PT  PP  +T    PPT  PPT TP    P P    P ++P T+PP PT 
Sbjct: 171 PTEPPPTLPPPTCNPPPTSTTSAPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTPPPPTC 230

Query: 242 --PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
             P +TP T P P T  +PP  TP +  P P+      +P A
Sbjct: 231 NPPTTTPRTTPPPPTC-NPPTTTPRTTPPPPTCNPPKTTPQA 271

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 48/121 (39%), Positives = 57/121 (47%), Gaps = 17/121 (14%)
 Frame = -3

Query: 419 PTAAP--TKPPTATPAPTAQPPAAAT-----PPTATPPTATPPAAVPAPATPAPASSPAT 261
           PT  P  T P T  P PT  PP   T     PPT  PPT TP    P P    P ++P T
Sbjct: 404 PTCNPHTTTPRTTPPPPTCNPPTTTTRTTPPPPTCNPPTTTPRTTPPPPTCNPPTTTPRT 463

Query: 260 SPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGADTPPSPSAAFSY 111
           +PP PT   P +TP T   P T  +PP  TP +  P P       +   TPP P+ A +Y
Sbjct: 464 TPPPPTCNPPTTTPRTTQPPPTC-NPPTTTPRTTPPPPTCNPPTKTPRTTPPPPTYASNY 522

Query: 110 S 108
           S
Sbjct: 523 S 523

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 41/110 (37%), Positives = 52/110 (47%), Gaps = 10/110 (9%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT- 243
           PT+  + PP     PT  P     PPT  PPT TP    P P    P ++P T+PP PT 
Sbjct: 187 PTSTTSAPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTPPPPTC 246

Query: 242 --PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGADTPPSPSAA 120
             P +TP T P P T  +PP  TP +  P P       +   TPP P+ +
Sbjct: 247 NPPTTTPRTTPPPPTC-NPPKTTPQATQPPPTCNPPTMTPRTTPPPPTCS 295

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 48/137 (35%), Positives = 59/137 (43%), Gaps = 27/137 (19%)
 Frame = -3

Query: 455 LGLLATSCLAQAPTAAPT---KPPTATP----------APTAQPPAAATPPTATPPTATP 315
           L  +  S     PT +PT    PPT  P           PT  PP    PPT  PPT  P
Sbjct: 126 LSTITESTTDPTPTDSPTCKPPPPTCNPPPTTTTSTPPPPTCNPPPTEPPPTLPPPTCNP 185

Query: 314 P----AAVPAPATPAPASSPATSPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGP 156
           P     + P P    P ++P T+PP PT   P +TP T P P T  +PP  TP +  P P
Sbjct: 186 PPTSTTSAPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTPPPPTC-NPPTTTPRTTPPPP 244

Query: 155 -------SGADTPPSPS 126
                  +   TPP P+
Sbjct: 245 TCNPPTTTPRTTPPPPT 261

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 45/115 (39%), Positives = 53/115 (46%), Gaps = 17/115 (14%)
 Frame = -3

Query: 419 PTAAP--TKPPTATPAPTAQPP-----AAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
           PT  P  T P T  P PT  PP     A   PPT  PPT TP    P P    P ++  T
Sbjct: 244 PTCNPPTTTPRTTPPPPTCNPPKTTPQATQPPPTCNPPTMTPRTTPPPPTCSPPTTTTRT 303

Query: 260 SPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGADTPPSPS 126
           +PP PT   P +TP T P P T  +PP  TP +  P P       +   TPP P+
Sbjct: 304 TPPPPTCNPPTTTPRTTPPPPTC-NPPTTTPRTTQPPPTCNPPTRTPRTTPPPPT 357

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 44/118 (37%), Positives = 53/118 (44%), Gaps = 17/118 (14%)
 Frame = -3

Query: 428 AQAPTAAP--TKPPTATPAPTAQPPAAAT-----PPTATPPTATPPAAVPAPATPAPASS 270
           A  PT  P  T P T  P PT  PP         PPT  PPT TP    P P    P ++
Sbjct: 193 APPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTPPPPTCNPPTTT 252

Query: 269 PATSPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGA-------DTPPSPS 126
           P T+PP PT   P +TP     P T  +PP  TP +  P P+ +        TPP P+
Sbjct: 253 PRTTPPPPTCNPPKTTPQATQPPPTC-NPPTMTPRTTPPPPTCSPPTTTTRTTPPPPT 309

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 38/94 (40%), Positives = 44/94 (46%), Gaps = 5/94 (5%)
 Frame = -3

Query: 419 PTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           PT  P  T PP     PT  P     PPT  PP  TP A  P P    P  +P T+PP P
Sbjct: 233 PTTTPRTTPPPPTCNPPTTTPRTTPPPPTCNPPKTTPQATQPPPTCNPPTMTPRTTPPPP 292

Query: 245 T---PASTPSTAPTPSTAGSPPAPTPDSLGPGPS 153
           T   P +T  T P P T  +PP  TP +  P P+
Sbjct: 293 TCSPPTTTTRTTPPPPTC-NPPTTTPRTTPPPPT 325

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 40/114 (35%), Positives = 51/114 (44%), Gaps = 10/114 (8%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           +C     T   T+PP     PT  P     PPT +PPT T     P P    P ++P T+
Sbjct: 261 TCNPPKTTPQATQPPPTCNPPTMTPRTTPPPPTCSPPTTTTRTTPPPPTCNPPTTTPRTT 320

Query: 257 PPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGADTPPSPS 126
           PP PT   P +TP T   P T  +PP  TP +  P P       +   TPP P+
Sbjct: 321 PPPPTCNPPTTTPRTTQPPPTC-NPPTRTPRTTPPPPTCNPPTTTPRTTPPPPT 373

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 40/114 (35%), Positives = 50/114 (43%), Gaps = 10/114 (8%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           +C     T   T+PP      T  P     PPT  PPT T     P P    P ++P T+
Sbjct: 389 TCNPPKTTPRATQPPPTCNPHTTTPRTTPPPPTCNPPTTTTRTTPPPPTCNPPTTTPRTT 448

Query: 257 PPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGADTPPSPS 126
           PP PT   P +TP T P P T  +PP  TP +  P P       +   TPP P+
Sbjct: 449 PPPPTCNPPTTTPRTTPPPPTC-NPPTTTPRTTQPPPTCNPPTTTPRTTPPPPT 501

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 39/106 (36%), Positives = 45/106 (42%), Gaps = 11/106 (10%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT-- 243
           T     PPT  P PT  P     PPT  PPT TP    P P    P  +P T+PP PT  
Sbjct: 301 TRTTPPPPTCNP-PTTTPRTTPPPPTCNPPTTTPRTTQPPPTCNPPTRTPRTTPPPPTCN 359

Query: 242 -PASTPSTAPTPSTAG--------SPPAPTPDSLGPGPSGADTPPS 132
            P +TP T P P T          +PP PT +     P     PP+
Sbjct: 360 PPTTTPRTTPPPPTCNPHTMTPRTTPPPPTCNPPKTTPRATQPPPT 405

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 36/87 (41%), Positives = 41/87 (47%), Gaps = 5/87 (5%)
 Frame = -3

Query: 419 PTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           PT  P  T PP     PT  P     PPT  PPT TP    P P    P ++P T+PP P
Sbjct: 441 PTTTPRTTPPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTQPPPTCNPPTTTPRTTPPPP 500

Query: 245 T---PASTPSTAPTPSTAGSPPAPTPD 174
           T   P  TP T P P T  S  + TP+
Sbjct: 501 TCNPPTKTPRTTPPPPTYASNYSTTPN 527

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 37/100 (37%), Positives = 44/100 (44%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419 PTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           PT  P  T P T  P PT  PP      T  PPT  PP   P    P P  +P T  P  
Sbjct: 228 PTCNPPTTTPRTTPPPPTCNPPTTTPRTTPPPPTCNPPKTTPQATQPPPTCNPPTMTPRT 287

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           TP     + PT +T  +PP PT +   P  +   TPP P+
Sbjct: 288 TPPPPTCSPPTTTTRTTPPPPTCNP--PTTTPRTTPPPPT 325

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 43/125 (34%), Positives = 51/125 (40%), Gaps = 20/125 (16%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATP----------APTAQPPAAATPPTATPPTATPPAAVPAPA 291
           T+     P      PPT TP           PT  P     PPT  PPT TP    P P 
Sbjct: 298 TTTTRTTPPPPTCNPPTTTPRTTPPPPTCNPPTTTPRTTQPPPTCNPPTRTPRTTPPPPT 357

Query: 290 TPAPASSPATSPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGADT 141
              P ++P T+PP PT      TP T P P T  +PP  TP +  P P       +   T
Sbjct: 358 CNPPTTTPRTTPPPPTCNPHTMTPRTTPPPPTC-NPPKTTPRATQPPPTCNPHTTTPRTT 416

Query: 140 PPSPS 126
           PP P+
Sbjct: 417 PPPPT 421

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 44/121 (36%), Positives = 51/121 (42%), Gaps = 21/121 (17%)
 Frame = -3

Query: 425 QAPTAAPT-KPPTATPAPTAQPPAAATPPTAT-----PPTATPPAAVPAPATPAPASSPA 264
           QA    PT  PPT TP  T  PP  + P T T     PPT  PP   P    P P  +P 
Sbjct: 270 QATQPPPTCNPPTMTPRTTPPPPTCSPPTTTTRTTPPPPTCNPPTTTPRTTPPPPTCNPP 329

Query: 263 TSPPAPT--------PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGADTPPSP 129
           T+ P  T        P  TP T P P T  +PP  TP +  P P       +   TPP P
Sbjct: 330 TTTPRTTQPPPTCNPPTRTPRTTPPPPTC-NPPTTTPRTTPPPPTCNPHTMTPRTTPPPP 388

Query: 128 S 126
           +
Sbjct: 389 T 389

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 36/98 (36%), Positives = 44/98 (44%), Gaps = 3/98 (3%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           +C     T   T PP     P   P A   PPT  P T TP    P P    P ++  T+
Sbjct: 373 TCNPHTMTPRTTPPPPTCNPPKTTPRATQPPPTCNPHTTTPRTTPPPPTCNPPTTTTRTT 432

Query: 257 PPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGPS 153
           PP PT   P +TP T P P T  +PP  TP +  P P+
Sbjct: 433 PPPPTCNPPTTTPRTTPPPPTC-NPPTTTPRTTPPPPT 469

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 41/118 (34%), Positives = 49/118 (41%), Gaps = 20/118 (16%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAA----------ATPPTATPPTATPPAAVPAPATPAPASS 270
           P      PPT TP  T  PP              PPT  PP  TP A  P P      ++
Sbjct: 353 PPPPTCNPPTTTPRTTPPPPTCNPHTMTPRTTPPPPTCNPPKTTPRATQPPPTCNPHTTT 412

Query: 269 PATSPPAPT---PASTPSTAPTPSTAGSPPAPTPDSLGPGP-------SGADTPPSPS 126
           P T+PP PT   P +T  T P P T  +PP  TP +  P P       +   TPP P+
Sbjct: 413 PRTTPPPPTCNPPTTTTRTTPPPPTC-NPPTTTPRTTPPPPTCNPPTTTPRTTPPPPT 469

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 39/111 (35%), Positives = 47/111 (42%), Gaps = 13/111 (11%)
 Frame = -3

Query: 419 PTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           PT  P  T+PP     PT  P     PPT  PPT TP    P P       +P T+PP P
Sbjct: 329 PTTTPRTTQPPPTCNPPTRTPRTTPPPPTCNPPTTTPRTTPPPPTCNPHTMTPRTTPPPP 388

Query: 245 T---PASTPSTAPTPSTAG--------SPPAPTPDSLGPGPSGADTPPSPS 126
           T   P +TP     P T          +PP PT +   P  +   TPP P+
Sbjct: 389 TCNPPKTTPRATQPPPTCNPHTTTPRTTPPPPTCNP--PTTTTRTTPPPPT 437

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 39/123 (31%), Positives = 52/123 (42%), Gaps = 7/123 (5%)
 Frame = -3

Query: 419 PTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           PT  P  T PP     PT  P     PPT  PPT TP    P P    P  +P T+PP P
Sbjct: 457 PTTTPRTTPPPPTCNPPTTTPRTTQPPPTCNPPTTTPRTTPPPPTCNPPTKTPRTTPPPP 516

Query: 245 TPASTPSTAPTPSTA-----GSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATAL 81
           T AS  ST P   ++     G   A    S     +   T P+  ++ +++K     T L
Sbjct: 517 TYASNYSTTPNLQSSHNHATGYSTATNLQSSYNDSANYSTTPNLQSSHNHAKEYTTTTNL 576

Query: 80  SAA 72
            ++
Sbjct: 577 QSS 579

[160][TOP]
>UniRef100_A5YT41 Probable cell surface glycoprotein n=1 Tax=uncultured haloarchaeon
           RepID=A5YT41_9EURY
          Length = 1315

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 56/117 (47%), Positives = 64/117 (54%), Gaps = 3/117 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATPPAAVPAPATPAPASSPATSPPAP 246
           PT +PT  PT TP PT  P +  TP PT +P PT TPPA   A  TP P SSP    PAP
Sbjct: 290 PTPSPTPTPTQTPTPTLTPTSTPTPSPTPSPTPTPTPPAT--ATPTPTPTSSPT---PAP 344

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSPSAAFSYSKPIIAATALS 78
           T    P++APTP TA   P PTP    P P+   TP PSP+     + P   ATA S
Sbjct: 345 TNTPPPTSAPTP-TATPTPTPTPT---PTPTATPTPTPSPTPT---TTPTPTATATS 394

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 49/123 (39%), Positives = 60/123 (48%), Gaps = 9/123 (7%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSP 267
           AT+      T   T  PT TP PT  P  + TP     PT TP P   P P TP+P  +P
Sbjct: 240 ATATATITSTPVSTSTPTPTPTPTPSPTPSPTPTPTQTPTPTPLPTPSPTP-TPSPTPTP 298

Query: 266 ATSP-PAPTPASTPSTAPTPSTAGSP-------PAPTPDSLGPGPSGADTPPSPSAAFSY 111
             +P P  TP STP+ +PTPS   +P       P PTP S  P P+  +TPP  SA    
Sbjct: 299 TQTPTPTLTPTSTPTPSPTPSPTPTPTPPATATPTPTPTS-SPTPAPTNTPPPTSAPTPT 357

Query: 110 SKP 102
           + P
Sbjct: 358 ATP 360

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 43/99 (43%), Positives = 52/99 (52%), Gaps = 13/99 (13%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP-------PTATPPTATPPAAVPAP-ATPAPASSPA 264
           PT+ PT  PT +P PT  PPA ATP       PT  P    PP + P P ATP P  +P 
Sbjct: 308 PTSTPTPSPTPSPTPTPTPPATATPTPTPTSSPTPAPTNTPPPTSAPTPTATPTPTPTPT 367

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPA-----PTPDSLGP 162
              P PT   TP+ +PTP+T  +P A     PTP S+ P
Sbjct: 368 ---PTPTATPTPTPSPTPTTTPTPTATATSTPTPPSVEP 403

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 46/108 (42%), Positives = 59/108 (54%), Gaps = 9/108 (8%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATP---PTATPP-TATPPAAVPAPATPAPASS-PATS 258
           +PT  PT+ PT T  PT+ P  + TP   PT TPP TATP     +  TPAP ++ P TS
Sbjct: 293 SPTPTPTQTPTPTLTPTSTPTPSPTPSPTPTPTPPATATPTPTPTSSPTPAPTNTPPPTS 352

Query: 257 PPAPTPASTPSTAPTPSTAGSP---PAPTPDSL-GPGPSGADTPPSPS 126
            P PT   TP+  PTP+   +P   P+PTP +   P  +   TP  PS
Sbjct: 353 APTPTATPTPTPTPTPTPTATPTPTPSPTPTTTPTPTATATSTPTPPS 400

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 51/127 (40%), Positives = 64/127 (50%), Gaps = 15/127 (11%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQ--PPAAAT------PPTATPPTATP---PAAVPAPATPAPA 276
           +PTA PT  PTAT  PTA   P A AT      P + + PT TP   P+  P+P TP P 
Sbjct: 217 SPTATPTATPTATATPTATSTPTATATATITSTPVSTSTPTPTPTPTPSPTPSP-TPTPT 275

Query: 275 SSPATSP-PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPSPSAAFSYS 108
            +P  +P P P+P  TPS  PTP+   +P   P  TP +  P PS   TP  P+ A    
Sbjct: 276 QTPTPTPLPTPSPTPTPSPTPTPTQTPTPTLTPTSTP-TPSPTPSPTPTPTPPATATPTP 334

Query: 107 KPIIAAT 87
            P  + T
Sbjct: 335 TPTSSPT 341

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 39/94 (41%), Positives = 49/94 (52%), Gaps = 5/94 (5%)
 Frame = -3

Query: 392 TATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAPTPASTPSTAP 216
           +A  +PTA P A  T       T+TP A   A  T  P S+   +P P PTP+ TPS  P
Sbjct: 213 SAQNSPTATPTATPTATATPTATSTPTATATATITSTPVSTSTPTPTPTPTPSPTPSPTP 272

Query: 215 TPSTAGSP-PAPTPDSLGPGPSGADTP---PSPS 126
           TP+   +P P PTP S  P PS   TP   P+P+
Sbjct: 273 TPTQTPTPTPLPTP-SPTPTPSPTPTPTQTPTPT 305

[161][TOP]
>UniRef100_Q9S740 Lysine-rich arabinogalactan protein 19 n=1 Tax=Arabidopsis thaliana
           RepID=AGP19_ARATH
          Length = 222

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 58/147 (39%), Positives = 72/147 (48%), Gaps = 24/147 (16%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCL--AQAPTAAP-----TKPPTATPAP---TAQPPAAATPP 342
           M S++ +   L+   L +S    AQ P A+P     T PP  T AP    A PP   TPP
Sbjct: 1   MESNSIIWSLLLASALISSFSVNAQGPAASPVTSTTTAPPPTTAAPPTTAAPPPTTTTPP 60

Query: 341 TA---------TPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPT--PSTAGS 195
            +         TPP A  P + PAP   AP  SPAT PP P P S P++APT  P     
Sbjct: 61  VSAAQPPASPVTPPPAVTPTSPPAPKV-APVISPATPPPQP-PQSPPASAPTVSPPPVSP 118

Query: 194 PPAPT---PDSLGPGPSGADTPPSPSA 123
           PPAPT   P    P P+ A  PP+P++
Sbjct: 119 PPAPTSPPPTPASPPPAPASPPPAPAS 145

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 40/110 (36%), Positives = 51/110 (46%), Gaps = 14/110 (12%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATP------------APTAQPPAAATPPTATPPTATPPAAVPAPATP 285
           AQ P +  T PP  TP            +P   PP     P A+ PT +PP   P PA  
Sbjct: 64  AQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPT 123

Query: 284 APASSPATSPPAPTPASTPSTAPTPSTAGSPP--APTPDSLGPGPSGADT 141
           +P  +PA+ PPAP        +P P+    PP  AP+P SL P P+ A T
Sbjct: 124 SPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAPT 173

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 48/135 (35%), Positives = 61/135 (45%), Gaps = 12/135 (8%)
 Frame = -3

Query: 422 APTAAPTKPPTATPA--PTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           +P   P +PP + PA  PT  PP  + PP  T P  TP +  PAPA+P PA  PA+  P 
Sbjct: 92  SPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPA--PAS--PP 147

Query: 248 PTPASTPST-APTPSTAGSPPAPTPDS---------LGPGPSGADTPPSPSAAFSYSKPI 99
           P P S P   AP+P +    PAP P               P+ A  PPSP +    + P 
Sbjct: 148 PAPVSPPPVQAPSPISLPPAPAPAPTKHKRKHKHKRHHHAPAPAPIPPSPPSPPVLTDPQ 207

Query: 98  IAATALSAALFAIAF 54
             A A S     I +
Sbjct: 208 DTAPAPSPNTVTIQY 222

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 43/113 (38%), Positives = 53/113 (46%), Gaps = 16/113 (14%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPA-PTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP 267
           A++     P  +P   PT+ P  P + PPA A+PP A  P + PPA V  P  P  A SP
Sbjct: 106 ASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPA--PASPPPAPVSPP--PVQAPSP 161

Query: 266 ATSPPAPTPAST--------------PSTAPTPSTAGSPPAPT-PDSLGPGPS 153
            + PPAP PA T              P+ AP P +  SPP  T P    P PS
Sbjct: 162 ISLPPAPAPAPTKHKRKHKHKRHHHAPAPAPIPPSPPSPPVLTDPQDTAPAPS 214

[162][TOP]
>UniRef100_UPI0001A7B0C1 protein binding / structural constituent of cell wall n=1
           Tax=Arabidopsis thaliana RepID=UPI0001A7B0C1
          Length = 857

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 49/120 (40%), Positives = 66/120 (55%), Gaps = 13/120 (10%)
 Frame = -3

Query: 416 TAAPTKPPTA--TPAPTAQPPAAATPPT------ATPPTATPPAAVPA-PATPAPASSPA 264
           T +P  PPT+  TP P   PP++ T PT      ++P T TP  + P+ P TP+P  SP 
Sbjct: 462 TPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPP 521

Query: 263 TSPPAPTPAST-PSTAPTPSTAGSPPA---PTPDSLGPGPSGADTPPSPSAAFSYSKPII 96
           +   +P+P  T PS   TP++ GSPP+   PTP S  P P    TPP+P +    S PII
Sbjct: 522 SPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPII 581

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 45/116 (38%), Positives = 62/116 (53%), Gaps = 8/116 (6%)
 Frame = -3

Query: 422 APTAAPTKP-----PTATPAPTAQPPAAA---TPPTATPPTATPPAAVPAPATPAPASSP 267
           +P+ +P+ P     P  TP+P   PP+ +   +PP+ TP   +PP +   P TP P  SP
Sbjct: 425 SPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTS---PTTPTPGGSP 481

Query: 266 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
            +SP  PTP  +P ++PT  T G  P  +P +  PG S    PPSPS   S S PI
Sbjct: 482 PSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGS----PPSPS--ISPSPPI 531

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 45/111 (40%), Positives = 62/111 (55%), Gaps = 4/111 (3%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA-PATPAPASSPATSPPAP 246
           +P  +P  P +  P+P +  P+  +PPT+ P T TP  + P+ P TP P  SP +SP  P
Sbjct: 444 SPGGSPPSP-SIVPSPPSTTPSPGSPPTS-PTTPTPGGSPPSSPTTPTPGGSPPSSPTTP 501

Query: 245 TPASTPSTAP-TPSTAGSPPAPTPDSLGP--GPSGADTPPSPSAAFSYSKP 102
           TP  +P ++P TPS  GSPP+P+     P   PS   TP SP +  S S P
Sbjct: 502 TPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSP 552

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 52/130 (40%), Positives = 68/130 (52%), Gaps = 16/130 (12%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPT--ATPPTAT----PPAAVPA-PATPAPASSPAT 261
           P  +P   PT TP P   PP++ T P+   +PP+ +    PP  VP+ P+TP    SP  
Sbjct: 490 PGGSPPSSPT-TPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSP-P 547

Query: 260 SPPAPTPAS------TPSTAPTPSTAG--SPP-APTPDSLGPGPSGADTPPSPSAAFSYS 108
           SP +PTP+S      TPST PTP + G  SPP  P+P   GP P  + +PP P      S
Sbjct: 548 SPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVI--PS 605

Query: 107 KPIIAATALS 78
            PI+  T  S
Sbjct: 606 PPIVGPTPSS 615

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 44/122 (36%), Positives = 62/122 (50%), Gaps = 13/122 (10%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAA----------TPPTATPPTATPPAA--VPAPATPAPA 276
           P   P+ PPT TP+P   PP+ +          +PPT   P  +PP+   VP+P +  P+
Sbjct: 407 PVVVPS-PPT-TPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPS 464

Query: 275 -SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
             SP TSP  PTP  +P ++PT  T G  P  +P +  PG S   +P +PS   S   P 
Sbjct: 465 PGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPS 524

Query: 98  IA 93
           I+
Sbjct: 525 IS 526

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 43/119 (36%), Positives = 57/119 (47%), Gaps = 16/119 (13%)
 Frame = -3

Query: 410 APTKPPTATPA-PTAQPPAAATPPTATPPTATPPAAVPAP--ATPAPASSPA-------T 261
           +P  P + TP+ P   PP  +TPPT   P    P  +P+P    P+P SSP+        
Sbjct: 545 SPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIP 604

Query: 260 SPP--APTPASTPSTAPTPSTAGSPPA----PTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           SPP   PTP+S P + PTP  +  PP+    P P   G  P     PP P+ + S S P
Sbjct: 605 SPPIVGPTPSSPPPSTPTPVYSPPPPSTGYPPPPPFTGYSPPSPPPPPPPTFSPSPSIP 663

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 39/112 (34%), Positives = 60/112 (53%), Gaps = 5/112 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAP 246
           +P+ +P+ PP   P+P + P +  +PP+ + PT + P  + P P+TP    SP  + P  
Sbjct: 522 SPSISPS-PPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPI 580

Query: 245 TPASTPSTAPTPSTAGSPP----APTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P S P T P+P ++ SPP     P+P  +GP PS   +PP  +    YS P
Sbjct: 581 IP-SPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPS---SPPPSTPTPVYSPP 628

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 43/121 (35%), Positives = 54/121 (44%), Gaps = 19/121 (15%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAAT----PPTAT------PPTATPPAAVPAPATPAPAS---SP 267
           P+ PP +TP P   PP  +T    PP  T      PP   PP   P+P+ P P     SP
Sbjct: 613 PSSPPPSTPTPVYSPPPPSTGYPPPPPFTGYSPPSPPPPPPPTFSPSPSIPPPPPQTYSP 672

Query: 266 ATSPPAPTPAS------TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSK 105
              PP P P +      +PS  P     G+PP P+P    P P    +PP P A + YS 
Sbjct: 673 FPPPPPPPPQTYYPPQPSPSQPPQSPIYGTPP-PSPIPYLPSPPQFASPP-PPAPYYYSS 730

Query: 104 P 102
           P
Sbjct: 731 P 731

 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 37/113 (32%), Positives = 49/113 (43%), Gaps = 7/113 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAAT----PPTATPPTATPPAAVPAPATPAPASSPATSPP 252
           P+  P  PPT +P+P+  PP   T    PP   PP  T     P+P+ P  +    T PP
Sbjct: 646 PSPPPPPPPTFSPSPSIPPPPPQTYSPFPPPPPPPPQTYYPPQPSPSQPPQSPIYGTPPP 705

Query: 251 APTPASTPSTAPTPSTAGSPPAPTP---DSLGPGPSGADTPPSPSAAFSYSKP 102
           +P P       P+P    SPP P P    S  P P    + P P+  + Y  P
Sbjct: 706 SPIPY-----LPSPPQFASPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISP 753

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 35/104 (33%), Positives = 52/104 (50%), Gaps = 19/104 (18%)
 Frame = -3

Query: 374 TAQPPAAATPPTATPP----------TATPPAAVPA-PATPAPASSPAT-----SPPA-- 249
           + +PP     P  TP           + +PP  VP+ P TP+P  SP +     SPP+  
Sbjct: 403 STRPPVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTT 462

Query: 248 PTPASTPSTAPTPSTAGSPP-APTPDSLGPGPSGADTPPSPSAA 120
           P+P S P++  TP+  GSPP +PT  + G  P  + T P+P  +
Sbjct: 463 PSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGS 506

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 38/112 (33%), Positives = 54/112 (48%), Gaps = 14/112 (12%)
 Frame = -3

Query: 422 APTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT--SPP 252
           +P ++P+ P P   P+P    P  ++PP +TP   TP  + P P+T  P   P T  SPP
Sbjct: 590 SPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTP---TPVYSPPPPSTGYPPPPPFTGYSPP 646

Query: 251 APTPASTPSTAPTPS---------TAGSPPAPTPDS--LGPGPSGADTPPSP 129
           +P P   P+ +P+PS         +   PP P P      P PS +  P SP
Sbjct: 647 SPPPPPPPTFSPSPSIPPPPPQTYSPFPPPPPPPPQTYYPPQPSPSQPPQSP 698

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 35/109 (32%), Positives = 44/109 (40%), Gaps = 12/109 (11%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT-----PPAAVPAPATPAPASSPATSP 255
           P   P+ PP   P P++ PP+  TP  + PP +T     PP    +P +P P   P  SP
Sbjct: 600 PPVIPS-PPIVGPTPSSPPPSTPTPVYSPPPPSTGYPPPPPFTGYSPPSPPPPPPPTFSP 658

Query: 254 PAPTPASTPST-------APTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
               P   P T        P P     PP P+P      P     PPSP
Sbjct: 659 SPSIPPPPPQTYSPFPPPPPPPPQTYYPPQPSPSQPPQSPIYGTPPPSP 707

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 38/117 (32%), Positives = 51/117 (43%), Gaps = 10/117 (8%)
 Frame = -3

Query: 422 APTAAPTKP-----PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-TPAPASSPAT 261
           +P   P+ P     P ++P+P   PP   +PP   P  ++PP + P P  +P P S+   
Sbjct: 577 SPPIIPSPPFTGPSPPSSPSPPL-PPVIPSPPIVGPTPSSPPPSTPTPVYSPPPPSTGYP 635

Query: 260 SPPAPTPASTPSTAPTPSTAGSP----PAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            PP  T  S PS  P P    SP    P P P +  P P     PP P    +Y  P
Sbjct: 636 PPPPFTGYSPPSPPPPPPPTFSPSPSIPPPPPQTYSPFP-----PPPPPPPQTYYPP 687

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 36/106 (33%), Positives = 47/106 (44%), Gaps = 8/106 (7%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAAT--PPTATP--PTATP----PAAVPAPATPAPASSP 267
           +P+  P  P T +P P   PP   T  PP  +P  P  +P    P   P P  P+P    
Sbjct: 659 SPSIPPPPPQTYSPFPPPPPPPPQTYYPPQPSPSQPPQSPIYGTPPPSPIPYLPSPPQFA 718

Query: 266 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           +  PPAP   S+P   P P  +  PP PT   + P P     PP+P
Sbjct: 719 SPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPP-----PPTP 759

[163][TOP]
>UniRef100_UPI0001868875 hypothetical protein BRAFLDRAFT_103538 n=1 Tax=Branchiostoma
           floridae RepID=UPI0001868875
          Length = 211

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 48/116 (41%), Positives = 51/116 (43%), Gaps = 14/116 (12%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATP-PTATPPAAVPAPATPAPASSPATSPPAPT 243
           P  AP  PP A P P   PPAA  PP   P PT  PP+  P P  P PA+ P   PP P 
Sbjct: 66  PPMAPPPPPMAPPPPP--PPAAPAPPVPAPDPTPAPPSITPVPPPPPPAAPP---PPPPP 120

Query: 242 PASTPSTAPTPSTAGSP-------------PAPTPDSLGPGPSGADTPPSPSAAFS 114
           P   P   P P+   SP             PAP PD   P P   D PPSP A  S
Sbjct: 121 PLMPPPLPPAPNQDISPIDVVSRKSKPSPVPAPPPDPPAPAPPDPDPPPSPPAPIS 176

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 42/105 (40%), Positives = 48/105 (45%), Gaps = 3/105 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P  AP  PP A P P A PP  A PP   PP   PP    AP  P P ++PA   PAP P
Sbjct: 36  PPVAPPPPPIAPPPPIAPPPPIAPPPPMDPPPMAPPPPPMAPPPPPPPAAPAPPVPAPDP 95

Query: 239 ASTP---STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
              P   +  P P    +PP P P  L P P     PP+P+   S
Sbjct: 96  TPAPPSITPVPPPPPPAAPPPPPPPPLMPPP----LPPAPNQDIS 136

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 44/113 (38%), Positives = 47/113 (41%), Gaps = 9/113 (7%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA---------AVPAPATPAP 279
           +A APTA P  PP A P P A PP    PP   PP   PP          A P P  P P
Sbjct: 4   VAPAPTAPP--PPIAPPPPIAPPPMDPPPPMDPPPPVAPPPPPIAPPPPIAPPPPIAPPP 61

Query: 278 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
              P    P P P + P   P P  A +PP P PD     PS    PP P  A
Sbjct: 62  PMDPPPMAPPPPPMAPPP--PPPPAAPAPPVPAPDPTPAPPSITPVPPPPPPA 112

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 37/101 (36%), Positives = 41/101 (40%), Gaps = 3/101 (2%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPP---TATPPTATPPAAVPAPATPAPASSPATSPP 252
           AP      PP   P P A PP    PP      PP A PP   P P  P P   P   PP
Sbjct: 22  APPPMDPPPPMDPPPPVAPPPPPIAPPPPIAPPPPIAPPPPMDPPPMAPPP--PPMAPPP 79

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P PA+     P P    +PP+ TP    P P+    PP P
Sbjct: 80  PPPPAAPAPPVPAPDPTPAPPSITPVPPPPPPAAPPPPPPP 120

[164][TOP]
>UniRef100_Q10VV9 Allergen V5/Tpx-1 related n=1 Tax=Trichodesmium erythraeum IMS101
           RepID=Q10VV9_TRIEI
          Length = 833

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 53/118 (44%), Positives = 61/118 (51%), Gaps = 14/118 (11%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTA--TPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPAT 261
           L  APT  PT  PT   TPAPT +P  A TP PT  P     PA  P P TPAP   P  
Sbjct: 275 LTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEP-TPAPTPEPTP 333

Query: 260 SP-----PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTP---PSPSAA 120
           +P     PAPTP  TP+  P P+ A +P   PAPTP+   P P+   TP   P P+ A
Sbjct: 334 APTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPT-PAPTPEPTPAPTPEPTPA 390

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 50/111 (45%), Positives = 59/111 (53%), Gaps = 11/111 (9%)
 Frame = -3

Query: 422 APTAAPTKPPTA--TPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSP- 255
           APT  PT  PT   TPAPT +P  A TP PT  P     PA  P P TPAP   P  +P 
Sbjct: 334 APTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEP-TPAPTPEPTPAPT 392

Query: 254 ----PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTPPSPSA 123
               PAPTP  TP+  P P+ A +P   PAPTP+   P P+   TP  P++
Sbjct: 393 PEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPT-PAPTPEPTPNVPTS 442

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 52/115 (45%), Positives = 60/115 (52%), Gaps = 14/115 (12%)
 Frame = -3

Query: 422 APTAAPTKPPTA--TPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSP- 255
           APT  PT  PT   TPAPT +P  A TP PT  P     PA  P P TPAP   P  +P 
Sbjct: 310 APTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEP-TPAPTPEPTPAPT 368

Query: 254 ----PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTP---PSPSAA 120
               PAPTP  TP+  P P+ A +P   PAPTP+   P P+   TP   P P+ A
Sbjct: 369 PEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPT-PAPTPEPTPAPTPEPTPA 422

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 52/115 (45%), Positives = 60/115 (52%), Gaps = 14/115 (12%)
 Frame = -3

Query: 422 APTAAPTKPPTA--TPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSP- 255
           APT  PT  PT   TPAPT +P  A TP PT  P     PA  P P TPAP   P  +P 
Sbjct: 318 APTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEP-TPAPTPEPTPAPT 376

Query: 254 ----PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTP---PSPSAA 120
               PAPTP  TP+  P P+ A +P   PAPTP+   P P+   TP   P P+ A
Sbjct: 377 PEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPT-PAPTPEPTPAPTPEPTPA 430

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 53/118 (44%), Positives = 63/118 (53%), Gaps = 15/118 (12%)
 Frame = -3

Query: 422 APTAAPTKPPTA--TPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSP- 255
           APT  PT  PT   TPAPT +P  A TP PT  P     PA  P P TPAP   P  +P 
Sbjct: 326 APTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEP-TPAPTPEPTPAPT 384

Query: 254 ----PAPTPASTPSTAPTPSTAGSP---PAPTPD---SLGPGPSGADTP-PSPSAAFS 114
               PAPTP  TP+  P P+ A +P   PAPTP+   +  P P+ A TP P+P+   S
Sbjct: 385 PEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPNVPTS 442

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 51/108 (47%), Positives = 56/108 (51%), Gaps = 7/108 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTA--TPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSP- 255
           APT  PT  PT   TPAPT +P  A TP     PT  P PA  P P TPAP   P  +P 
Sbjct: 294 APTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEP-TPAPTPEPTPAPT 352

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP---PSPSAA 120
           P PTPA TP   P P T    PAPTP+   P P+   TP   P P+ A
Sbjct: 353 PEPTPAPTPEPTPAP-TPEPTPAPTPEPT-PAPTPEPTPAPTPEPTPA 398

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 51/108 (47%), Positives = 56/108 (51%), Gaps = 7/108 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTA--TPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSP- 255
           APT  PT  PT   TPAPT +P  A TP     PT  P PA  P P TPAP   P  +P 
Sbjct: 302 APTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEP-TPAPTPEPTPAPT 360

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP---PSPSAA 120
           P PTPA TP   P P T    PAPTP+   P P+   TP   P P+ A
Sbjct: 361 PEPTPAPTPEPTPAP-TPEPTPAPTPEPT-PAPTPEPTPAPTPEPTPA 406

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 48/114 (42%), Positives = 57/114 (50%), Gaps = 12/114 (10%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSP-- 255
           + P   P   P  TPAPT +P  A TP PT  P     PA  P P TPAP   P  +P  
Sbjct: 271 ELPELTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEP-TPAPTPEPTPAPTP 329

Query: 254 ---PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTP---PSPSAA 120
              PAPTP  TP+  P P+ A +P   PAPTP+   P P+   TP   P P+ A
Sbjct: 330 EPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPT-PAPTPEPTPAPTPEPTPA 382

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 46/97 (47%), Positives = 50/97 (51%), Gaps = 4/97 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTA--TPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSP- 255
           APT  PT  PT   TPAPT +P  A TP PT  P     PA  P P TPAP   P  +P 
Sbjct: 350 APTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEP-TPAPTPEPTPAPT 408

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
           P PTPA TP   P P T    PAPTP+     P+  D
Sbjct: 409 PEPTPAPTPEPTPAP-TPEPTPAPTPEPTPNVPTSGD 444

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 46/105 (43%), Positives = 49/105 (46%), Gaps = 11/105 (10%)
 Frame = -3

Query: 422 APTAAPTKPPTA--TPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPP 252
           APT  PT  PT   TPAPT +P  A TP PT  P     PA  P P TPAP   P    P
Sbjct: 374 APTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEPTPAPTPEP-TPAPTPEPT---P 429

Query: 251 APTPASTPSTAPT--------PSTAGSPPAPTPDSLGPGPSGADT 141
           APTP  TP+  PT         STA +  A   D    G  G DT
Sbjct: 430 APTPEPTPN-VPTSGDDNLTGDSTANNIKALAGDDTVSGGDGQDT 473

[165][TOP]
>UniRef100_Q07UA8 OmpA/MotB domain protein n=1 Tax=Rhodopseudomonas palustris BisA53
           RepID=Q07UA8_RHOP5
          Length = 628

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 49/131 (37%), Positives = 61/131 (46%), Gaps = 7/131 (5%)
 Frame = -3

Query: 443 ATSCLAQAPTAAP--TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
           A    + +P+ AP  T PP ATP P   PP A  PP   P T TP AA    + PAPA S
Sbjct: 146 AAPSASPSPSTAPSTTAPPAATPGPRTPPPGAGAPPRPAPSTTTPGAAKDGASAPAPAVS 205

Query: 269 PATSPPAPTPASTPSTAPTPS---TAGSPPAP--TPDSLGPGPSGADTPPSPSAAFSYSK 105
           P+  P A TP   P+   +P+    +G+PPAP  TP      P     P  P AA    +
Sbjct: 206 PSAPPKAVTPPPAPAPVTSPADTGRSGTPPAPAVTPSVT---PPATPAPGQPPAATDSGR 262

Query: 104 PIIAATALSAA 72
           P+   T    A
Sbjct: 263 PVGPGTRAPGA 273

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 60/163 (36%), Positives = 76/163 (46%), Gaps = 13/163 (7%)
 Frame = -3

Query: 551 RLSFTHTTFLSKF*ISLHPKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATP--- 381
           RL+   TT L+   I+  P  A S       ++   A    +  P A P +PP   P   
Sbjct: 5   RLALLATTALTVGQIAALPSYAQSVPS----VMAQAAPPEESADPKAPPKQPPKGPPPVA 60

Query: 380 APTAQPPAAATPPTA---TPPTATPPAAVP-APATPAPASS-----PATSPPAPTPASTP 228
           AP A  P AA PP A    PP   PPAA P APA P P  +     PA +P AP PA+  
Sbjct: 61  APKAPAPPAAPPPAAPRAAPPPPPPPAAAPRAPAPPPPPPAVERPRPAPAPVAPPPAAPK 120

Query: 227 STAPTPSTAGSPPAPTPDSLGPG-PSGADTPPSPSAAFSYSKP 102
           +  P P  A +P AP P ++ P  P+     PSPS A S + P
Sbjct: 121 AAPPPPPPAAAPKAPPPPAVAPSRPAAPSASPSPSTAPSTTAP 163

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 58/134 (43%), Positives = 67/134 (50%), Gaps = 12/134 (8%)
 Frame = -3

Query: 422 APTAAPTKPPTAT-----PAPTAQPPAAATPPTATPPTATPPAAVPA-PATPAPASSPAT 261
           AP AAP  PP        PAP   PPA   P  A  P A PPAA  A P  P PA++P  
Sbjct: 75  APRAAPPPPPPPAAAPRAPAPPPPPPAVERPRPAPAPVAPPPAAPKAAPPPPPPAAAPKA 134

Query: 260 SPP---APTPASTPSTAPTPSTAGS---PPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
            PP   AP+  + PS +P+PSTA S   PPA TP    P P GA  PP P  A S + P 
Sbjct: 135 PPPPAVAPSRPAAPSASPSPSTAPSTTAPPAATPGPRTP-PPGAGAPPRP--APSTTTPG 191

Query: 98  IAATALSAALFAIA 57
            A    SA   A++
Sbjct: 192 AAKDGASAPAPAVS 205

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 53/129 (41%), Positives = 64/129 (49%), Gaps = 15/129 (11%)
 Frame = -3

Query: 428 AQAPTA-APTKPPTAT------PAPTAQPPAA------ATPPTATPPTATPPAAVPA-PA 291
           A AP A AP  PP A       PAP A PPAA        PP A P    PPA  P+ PA
Sbjct: 87  AAAPRAPAPPPPPPAVERPRPAPAPVAPPPAAPKAAPPPPPPAAAPKAPPPPAVAPSRPA 146

Query: 290 TPAPASSPATSPPAPT-PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
            P+ + SP+T+P     PA+TP     P  AG+PP P P +  PG +  D   +P+ A S
Sbjct: 147 APSASPSPSTAPSTTAPPAATPGPRTPPPGAGAPPRPAPSTTTPG-AAKDGASAPAPAVS 205

Query: 113 YSKPIIAAT 87
            S P  A T
Sbjct: 206 PSAPPKAVT 214

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 49/135 (36%), Positives = 60/135 (44%), Gaps = 24/135 (17%)
 Frame = -3

Query: 422 APTAAPTKPPTAT-----PAPTAQP-----PAAATPPTATPPTATPPAAVPAPATPAPAS 273
           AP AAP  PP A      P P   P     P+A+  P+  P T  PPAA P P TP P +
Sbjct: 118 APKAAPPPPPPAAAPKAPPPPAVAPSRPAAPSASPSPSTAPSTTAPPAATPGPRTPPPGA 177

Query: 272 ------SPATSPP--------APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
                 +P+T+ P        AP PA +PS  P   T    PAP       G SG  TPP
Sbjct: 178 GAPPRPAPSTTTPGAAKDGASAPAPAVSPSAPPKAVTPPPAPAPVTSPADTGRSG--TPP 235

Query: 134 SPSAAFSYSKPIIAA 90
           +P+   S + P   A
Sbjct: 236 APAVTPSVTPPATPA 250

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 45/105 (42%), Positives = 52/105 (49%), Gaps = 7/105 (6%)
 Frame = -3

Query: 413 AAPTKPPTATP--APTAQPPAAATPPTATPPTATPPAAV----PAPATPA-PASSPATSP 255
           A P  PP A P  AP   PP AA P    PP   PP AV    PAPA  A P ++P  +P
Sbjct: 66  APPAAPPPAAPRAAPPPPPPPAAAPRAPAPPP--PPPAVERPRPAPAPVAPPPAAPKAAP 123

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
           P P PA+ P   P P+ A  P  P   S  P PS A +  +P AA
Sbjct: 124 PPPPPAAAPKAPPPPAVA--PSRPAAPSASPSPSTAPSTTAPPAA 166

 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 48/129 (37%), Positives = 56/129 (43%), Gaps = 5/129 (3%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-----AVPAPATPAPASSPA 264
           A AP  +P+ PP A   P A  PA  T P  T  + TPPA     +V  PATPAP     
Sbjct: 199 APAPAVSPSAPPKAVTPPPA--PAPVTSPADTGRSGTPPAPAVTPSVTPPATPAPG---- 252

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATA 84
             PPA T +  P   P     G+P  P    L  G   A TPP    A     PI  A A
Sbjct: 253 -QPPAATDSGRP-VGPGTRAPGAPSDPAAAGLPAGAPVARTPPPTVTA-----PIPQAPA 305

Query: 83  LSAALFAIA 57
            + AL  +A
Sbjct: 306 PAQALTPLA 314

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 53/149 (35%), Positives = 61/149 (40%), Gaps = 19/149 (12%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTAAPTKPPTATPAPTAQ--PPAAATPPTATP---PTATPPAAVPA 297
           L L LLAT+ L     AA      + P+  AQ  PP  +  P A P   P   PP A  A
Sbjct: 4   LRLALLATTALTVGQIAALPSYAQSVPSVMAQAAPPEESADPKAPPKQPPKGPPPVA--A 61

Query: 296 PATPAPASSPATSPPA---------PTPASTP--STAPTPSTAGSPPAPTPDSLGP---G 159
           P  PAP   PA  PPA         P PA+ P     P P  A   P P P  + P    
Sbjct: 62  PKAPAP---PAAPPPAAPRAAPPPPPPPAAAPRAPAPPPPPPAVERPRPAPAPVAPPPAA 118

Query: 158 PSGADTPPSPSAAFSYSKPIIAATALSAA 72
           P  A  PP P+AA     P   A +  AA
Sbjct: 119 PKAAPPPPPPAAAPKAPPPPAVAPSRPAA 147

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 34/88 (38%), Positives = 40/88 (45%), Gaps = 1/88 (1%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA-PASSPATSPPAP 246
           AP   P+  P ATPAP  QPPAA        P    P A   PA    PA +P    P P
Sbjct: 236 APAVTPSVTPPATPAP-GQPPAATDSGRPVGPGTRAPGAPSDPAAAGLPAGAPVARTPPP 294

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGP 162
           T  +    AP P+ A +P AP   + GP
Sbjct: 295 TVTAPIPQAPAPAQALTPLAPGATAPGP 322

[166][TOP]
>UniRef100_A8ZKH4 Putative uncharacterized protein n=1 Tax=Acaryochloris marina
           MBIC11017 RepID=A8ZKH4_ACAM1
          Length = 509

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 54/123 (43%), Positives = 67/123 (54%), Gaps = 11/123 (8%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           PT AP   P++TPAP A  PA A  P   P  A  PA  PAPA PAPA +PA + PAP P
Sbjct: 376 PTPAPAPVPSSTPAP-APAPAPAPAPAPAPAPAPAPAPAPAPA-PAPAPAPAPA-PAPIP 432

Query: 239 ASTPSTAPTPSTAGSP-PAPTPDSL---GPGPSGADTP-------PSPSAAFSYSKPIIA 93
           +S P+ AP P+ A +P PAP P  +    P P+ A  P       P+P+ A +Y  P   
Sbjct: 433 SSAPAPAPAPAPAPAPAPAPAPAPVYVPPPAPAPAPAPVYVPPPAPAPAPAPAYVPPPAP 492

Query: 92  ATA 84
           A A
Sbjct: 493 APA 495

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 56/125 (44%), Positives = 67/125 (53%), Gaps = 8/125 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQP---PAAATPPTATPPTATPPAAVPAPATPAPASSPATSP- 255
           AP A+P+ P   TPAP   P   PA A  P   P  A  PA  PAPA PAPA +PA +P 
Sbjct: 368 APVASPSTP---TPAPAPVPSSTPAPAPAPAPAPAPAPAPAPAPAPA-PAPAPAPAPAPA 423

Query: 254 PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP---PSPSAAFSYSKPIIAAT 87
           PAP PA  PS+AP P+ A +P PAP P    P P+    P   P+P+ A  Y  P   A 
Sbjct: 424 PAPAPAPIPSSAPAPAPAPAPAPAPAP---APAPAPVYVPPPAPAPAPAPVYVPPPAPAP 480

Query: 86  ALSAA 72
           A + A
Sbjct: 481 APAPA 485

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 55/126 (43%), Positives = 66/126 (52%), Gaps = 11/126 (8%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPA-AATPPTATPPTATPPAAVPAPA-----TPAPASSP 267
           A A   AP   P +TPAP  Q  A  A+P T TP  A  P++ PAPA      PAPA +P
Sbjct: 345 APASQPAPAPLPASTPAPVRQVDAPVASPSTPTPAPAPVPSSTPAPAPAPAPAPAPAPAP 404

Query: 266 ATSP-PAPTPASTPSTAPTPSTAGSPPAPTPDSL-GPGPSGADTP---PSPSAAFSYSKP 102
           A +P PAP PA  P+ AP P+ A   PAP P S   P P+ A  P   P+P+ A  Y  P
Sbjct: 405 APAPAPAPAPAPAPAPAPAPAPA---PAPIPSSAPAPAPAPAPAPAPAPAPAPAPVYVPP 461

Query: 101 IIAATA 84
              A A
Sbjct: 462 PAPAPA 467

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 49/108 (45%), Positives = 54/108 (50%), Gaps = 6/108 (5%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPA-TPAPASSPA--- 264
           A AP  AP   P   PAP   P PA A  P   P +A  PA  PAPA  PAPA +PA   
Sbjct: 399 APAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPIPSSAPAPAPAPAPAPAPAPAPAPAPVY 458

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSL-GPGPSGADTPPSPSA 123
             PPAP PA  P   P P+ A   PAP P  +  P P+ A  PP P A
Sbjct: 459 VPPPAPAPAPAPVYVPPPAPA---PAPAPAYVPPPAPAPAPAPPPPMA 503

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 45/105 (42%), Positives = 56/105 (53%), Gaps = 3/105 (2%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPTATP-PTATPPAAVPAPATPAPASSPATSPPA 249
           Q P  AP   P + PAP   P +   P      P A+P    PAPA P P+S+PA +P A
Sbjct: 336 QKPAPAPAPAPASQPAPAPLPASTPAPVRQVDAPVASPSTPTPAPA-PVPSSTPAPAP-A 393

Query: 248 PTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
           P PA  P+ AP P+ A +P PAP P    P P+ A  P P PS+A
Sbjct: 394 PAPAPAPAPAPAPAPAPAPAPAPAP---APAPAPAPAPAPIPSSA 435

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 42/101 (41%), Positives = 50/101 (49%), Gaps = 9/101 (8%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATPPAAVPAPA-----TPAPASSP 267
           A AP  AP   P   PAP   P P++A  P   P  A  PA  PAPA      PAPA +P
Sbjct: 409 APAPAPAPAPAPAPAPAPAPAPIPSSAPAPAPAPAPAPAPAPAPAPAPVYVPPPAPAPAP 468

Query: 266 A---TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 153
           A     PPAP PA  P+  P P+ A +P  P P  + P P+
Sbjct: 469 APVYVPPPAPAPAPAPAYVPPPAPAPAPAPPPP--MAPPPT 507

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 42/105 (40%), Positives = 54/105 (51%), Gaps = 2/105 (1%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           A+A  A     P   PAP +QP  A  P +   P     A V +P+TP PA       PA
Sbjct: 329 ARARRARQKPAPAPAPAPASQPAPAPLPASTPAPVRQVDAPVASPSTPTPA-------PA 381

Query: 248 PTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
           P P+STP+ AP P+ A +P PAP P    P P+ A  P P+P+ A
Sbjct: 382 PVPSSTPAPAPAPAPAPAPAPAPAP---APAPAPAPAPAPAPAPA 423

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 41/105 (39%), Positives = 52/105 (49%), Gaps = 2/105 (1%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           AQ   AA  +     PAP   P  A+ P  A  P +TP    P     AP +SP+T  P 
Sbjct: 323 AQERAAARARRARQKPAPAPAPAPASQPAPAPLPASTP---APVRQVDAPVASPST--PT 377

Query: 248 PTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
           P PA  PS+ P P+ A +P PAP P    P P+ A  P P+P+ A
Sbjct: 378 PAPAPVPSSTPAPAPAPAPAPAPAP---APAPAPAPAPAPAPAPA 419

[167][TOP]
>UniRef100_C5ALD7 Rhs element Vgr protein n=1 Tax=Burkholderia glumae BGR1
            RepID=C5ALD7_BURGB
          Length = 842

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 50/100 (50%), Positives = 53/100 (53%), Gaps = 4/100 (4%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATS 258
            A  PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +
Sbjct: 746  APEPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPT 804

Query: 257  P-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 141
            P P PTP  TP+  PTP T   PP P P    P PSG DT
Sbjct: 805  PTPTPTPTPTPTPTPTP-TPTPPPTPLPTET-PQPSGHDT 842

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 48/111 (43%), Positives = 54/111 (48%), Gaps = 5/111 (4%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  P  TPAP   P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 727  PTPEPTPAPEPTPAPEPTPAPEPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 785

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
             PTP  TP+  PTP+   +P P PTP    P P+   TP  P        P
Sbjct: 786  TPTPTPTPTPTPTPTPTPTPTPTPTPTPT-PTPTPTPTPTPPPTPLPTETP 835

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 45/105 (42%), Positives = 54/105 (51%), Gaps = 4/105 (3%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSP- 255
            A  PT AP   PT  P P  +P  A  P  A  PT TP P   P P TP P  +P  +P 
Sbjct: 716  APEPTPAPEPTPTPEPTPAPEPTPAPEPTPAPEPTPTPTPTPTPTP-TPTPTPTPTPTPT 774

Query: 254  PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 775  PTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 816

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 49/128 (38%), Positives = 59/128 (46%), Gaps = 4/128 (3%)
 Frame = -3

Query: 497  PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT 318
            P +    A    L+L  L    L   P   P   P   P P  +P  A  P  A  PT T
Sbjct: 669  PDVGIGLAAPTPLVLAALPLPLLLPLPLPLPLPGPAPEPTPAPEPTPAPEPTPAPEPTPT 728

Query: 317  P-PAAVPAPATPAPASSPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGA 147
            P P   P P TPAP  +PA  P P PTP  TP+  PTP+   +P P PTP    P P+  
Sbjct: 729  PEPTPAPEP-TPAPEPTPAPEPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPT 784

Query: 146  DTP-PSPS 126
             TP P+P+
Sbjct: 785  PTPTPTPT 792

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 44/105 (41%), Positives = 53/105 (50%), Gaps = 4/105 (3%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSP- 255
            A  PT AP   P   P PT +P  A  P  A  PT  P P   P P TP P  +P  +P 
Sbjct: 710  APEPTPAPEPTPAPEPTPTPEPTPAPEPTPAPEPTPAPEPTPTPTP-TPTPTPTPTPTPT 768

Query: 254  PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 769  PTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 810

[168][TOP]
>UniRef100_Q9SN46 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9SN46_ARATH
          Length = 839

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 49/120 (40%), Positives = 66/120 (55%), Gaps = 13/120 (10%)
 Frame = -3

Query: 416 TAAPTKPPTA--TPAPTAQPPAAATPPT------ATPPTATPPAAVPA-PATPAPASSPA 264
           T +P  PPT+  TP P   PP++ T PT      ++P T TP  + P+ P TP+P  SP 
Sbjct: 462 TPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPP 521

Query: 263 TSPPAPTPAST-PSTAPTPSTAGSPPA---PTPDSLGPGPSGADTPPSPSAAFSYSKPII 96
           +   +P+P  T PS   TP++ GSPP+   PTP S  P P    TPP+P +    S PII
Sbjct: 522 SPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPII 581

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 45/116 (38%), Positives = 62/116 (53%), Gaps = 8/116 (6%)
 Frame = -3

Query: 422 APTAAPTKP-----PTATPAPTAQPPAAA---TPPTATPPTATPPAAVPAPATPAPASSP 267
           +P+ +P+ P     P  TP+P   PP+ +   +PP+ TP   +PP +   P TP P  SP
Sbjct: 425 SPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTS---PTTPTPGGSP 481

Query: 266 ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
            +SP  PTP  +P ++PT  T G  P  +P +  PG S    PPSPS   S S PI
Sbjct: 482 PSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGS----PPSPS--ISPSPPI 531

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 45/111 (40%), Positives = 62/111 (55%), Gaps = 4/111 (3%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA-PATPAPASSPATSPPAP 246
           +P  +P  P +  P+P +  P+  +PPT+ P T TP  + P+ P TP P  SP +SP  P
Sbjct: 444 SPGGSPPSP-SIVPSPPSTTPSPGSPPTS-PTTPTPGGSPPSSPTTPTPGGSPPSSPTTP 501

Query: 245 TPASTPSTAP-TPSTAGSPPAPTPDSLGP--GPSGADTPPSPSAAFSYSKP 102
           TP  +P ++P TPS  GSPP+P+     P   PS   TP SP +  S S P
Sbjct: 502 TPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSP 552

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 52/130 (40%), Positives = 68/130 (52%), Gaps = 16/130 (12%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPT--ATPPTAT----PPAAVPA-PATPAPASSPAT 261
           P  +P   PT TP P   PP++ T P+   +PP+ +    PP  VP+ P+TP    SP  
Sbjct: 490 PGGSPPSSPT-TPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSP-P 547

Query: 260 SPPAPTPAS------TPSTAPTPSTAG--SPP-APTPDSLGPGPSGADTPPSPSAAFSYS 108
           SP +PTP+S      TPST PTP + G  SPP  P+P   GP P  + +PP P      S
Sbjct: 548 SPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVI--PS 605

Query: 107 KPIIAATALS 78
            PI+  T  S
Sbjct: 606 PPIVGPTPSS 615

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 44/122 (36%), Positives = 62/122 (50%), Gaps = 13/122 (10%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAA----------TPPTATPPTATPPAA--VPAPATPAPA 276
           P   P+ PPT TP+P   PP+ +          +PPT   P  +PP+   VP+P +  P+
Sbjct: 407 PVVVPS-PPT-TPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPS 464

Query: 275 -SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
             SP TSP  PTP  +P ++PT  T G  P  +P +  PG S   +P +PS   S   P 
Sbjct: 465 PGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPS 524

Query: 98  IA 93
           I+
Sbjct: 525 IS 526

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 37/102 (36%), Positives = 56/102 (54%), Gaps = 5/102 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAP 246
           +P+ +P+ PP   P+P + P +  +PP+ + PT + P  + P P+TP    SP  + P  
Sbjct: 522 SPSISPS-PPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPI 580

Query: 245 TPASTPSTAPTPSTAGSPP----APTPDSLGPGPSGADTPPS 132
            P S P T P+P ++ SPP     P+P  +GP PS    PPS
Sbjct: 581 IP-SPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPS--SPPPS 619

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 35/104 (33%), Positives = 52/104 (50%), Gaps = 19/104 (18%)
 Frame = -3

Query: 374 TAQPPAAATPPTATPP----------TATPPAAVPA-PATPAPASSPAT-----SPPA-- 249
           + +PP     P  TP           + +PP  VP+ P TP+P  SP +     SPP+  
Sbjct: 403 STRPPVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTT 462

Query: 248 PTPASTPSTAPTPSTAGSPP-APTPDSLGPGPSGADTPPSPSAA 120
           P+P S P++  TP+  GSPP +PT  + G  P  + T P+P  +
Sbjct: 463 PSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGS 506

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 33/85 (38%), Positives = 43/85 (50%), Gaps = 12/85 (14%)
 Frame = -3

Query: 410 APTKPPTATPA-PTAQPPAAATPPTATPPTATPPAAVPAP--ATPAPASSPAT------- 261
           +P  P + TP+ P   PP  +TPPT   P    P  +P+P    P+P SSP+        
Sbjct: 545 SPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIP 604

Query: 260 SPP--APTPASTPSTAPTPSTAGSP 192
           SPP   PTP+S P + PTP T   P
Sbjct: 605 SPPIVGPTPSSPPPSTPTPGTLLHP 629

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 34/93 (36%), Positives = 44/93 (47%), Gaps = 8/93 (8%)
 Frame = -3

Query: 422 APTAAPTKP--PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAP---ASSPATS 258
           +P + PT P  P +  +PT   P  + P  +TPPT   P     P  P+P     SP +S
Sbjct: 535 SPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSS 594

Query: 257 PPAPTP---ASTPSTAPTPSTAGSPPAPTPDSL 168
           P  P P    S P   PTPS+   P  PTP +L
Sbjct: 595 PSPPLPPVIPSPPIVGPTPSSP-PPSTPTPGTL 626

[169][TOP]
>UniRef100_Q41719 Hydroxyproline-rich glycoprotein n=1 Tax=Zea diploperennis
           RepID=Q41719_ZEADI
          Length = 350

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 48/119 (40%), Positives = 52/119 (43%), Gaps = 13/119 (10%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA--- 249
           PT  PT PPT TPAPT   P     PT TPPT TP    P P    P  +P+  PPA   
Sbjct: 102 PTPKPT-PPTYTPAPTPHKPTPTPKPTPTPPTYTPSPKPPTPKPTPPTYAPSPKPPATKP 160

Query: 248 PTPASTPST----------APTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           PTP  TP T           PTP T    P PTP +  P P      P+P       KP
Sbjct: 161 PTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPTPPTYTPSPKPPTPKPTPPTYTPSPKP 219

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 49/114 (42%), Positives = 57/114 (50%), Gaps = 8/114 (7%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATP-PTATPPAAVPAPATPAPASSPATSPPAPT 243
           PT  PT PPT TP+P   P    TPPT TP P  TPP   P+P  P P  +P T  P+P 
Sbjct: 161 PTPKPT-PPTYTPSP-KPPTPKPTPPTYTPSPKPTPPTYTPSPKPPTPKPTPPTYTPSPK 218

Query: 242 PAST--PSTAPTPST-AGSP----PAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           P +T  P+  PTP T   SP    P PTP +  P P    T P+P       KP
Sbjct: 219 PPATKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPTPPTYTPSPKP 272

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 42/110 (38%), Positives = 50/110 (45%), Gaps = 4/110 (3%)
 Frame = -3

Query: 419 PTAAPT-KPPTATPAPTAQPPAAATPPTATP-PTATPPAAVPAPATPAPASSPATSPPAP 246
           PT  P+ KPPT  P P    P+   P T  P P  TPP   P+P  P P  +P T  P+P
Sbjct: 195 PTYTPSPKPPTPKPTPPTYTPSPKPPATKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSP 254

Query: 245 TPASTPSTAP--TPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P +T  T P  TPS     P PTP +  P P      P+P       KP
Sbjct: 255 KPPATKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKP 304

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/109 (43%), Positives = 56/109 (51%), Gaps = 12/109 (11%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAA-ATPPTATP------PTATPPAAVPAPATPAPASSPAT 261
           PT  PT PPT TP+P  +PPA   TPPT TP      P  TPP   P+P  P P  +P T
Sbjct: 241 PTPKPT-PPTYTPSP--KPPATKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPTPKPTPPT 297

Query: 260 SPPAPTPAST--PSTAPTPST---AGSPPAPTPDSLGPGPSGADTPPSP 129
             P+P P +T  P+  PTP T      PPA  P +  P P  + TP  P
Sbjct: 298 YTPSPKPPATKPPTPKPTPPTYTPTPKPPATKPPTYTPTPPVSHTPSPP 346

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 45/113 (39%), Positives = 54/113 (47%), Gaps = 7/113 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPA---AATPPTA--TPPTATPPAAVPAPATPAPASSPATSP 255
           PT  PT PPT TP+P   PP    +  PPT   TPPT TP    PA   P P  +P T  
Sbjct: 177 PTPKPT-PPTYTPSPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPPTPKPTPPTYT 235

Query: 254 PAPTPASTPSTAPTPSTAGSPPA--PTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           P+P P +   T PT + +  PPA  PTP +  P P      P+P       KP
Sbjct: 236 PSPKPPTPKPTPPTYTPSPKPPATKPTPPTYTPSPKPPTPKPTPPTYTPSPKP 288

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 57/150 (38%), Positives = 62/150 (41%), Gaps = 29/150 (19%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQA-PTAAPTKPPTATPAPTAQPPA-------------- 357
           +A S AV+I    G   T     A PT  P KPPT  P P   P                
Sbjct: 14  VAVSLAVEIQADAGYGYTPTPTPATPTPKPEKPPTKGPKPEKPPKEHKPPKEHGPKPEKP 73

Query: 356 ----AATPPTATP-PTATPPAAVPAPATPAPASSPATSPPAPT---PASTPSTAPTPST- 204
                 TPPT TP P  TPP   P P  P P  +P T  PAPT   P  TP   PTP T 
Sbjct: 74  PKEHKPTPPTYTPSPKPTPPTYTPTPTPPTPKPTPPTYTPAPTPHKPTPTPKPTPTPPTY 133

Query: 203 AGSP----PAPTPDSLGPGPS-GADTPPSP 129
             SP    P PTP +  P P   A  PP+P
Sbjct: 134 TPSPKPPTPKPTPPTYAPSPKPPATKPPTP 163

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 48/113 (42%), Positives = 55/113 (48%), Gaps = 17/113 (15%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATP------------PTATPPAAVPAPATPAPA 276
           P+  PT PPT TP PT  P    TPPT TP            PT TPP   P+P  P P 
Sbjct: 86  PSPKPT-PPTYTPTPT-PPTPKPTPPTYTPAPTPHKPTPTPKPTPTPPTYTPSPKPPTPK 143

Query: 275 SSPATSPPAPTPAST--PSTAPTPST-AGSPPAPTPDSLGP--GPSGADTPPS 132
            +P T  P+P P +T  P+  PTP T   SP  PTP    P   PS   TPP+
Sbjct: 144 PTPPTYAPSPKPPATKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPTPPT 196

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 44/115 (38%), Positives = 52/115 (45%), Gaps = 9/115 (7%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATP------PTATPPAAVPAPATPAPASSPATS 258
           PT AP+  P AT  PT +P    TPPT TP      P  TPP   P+P    P  +P+  
Sbjct: 147 PTYAPSPKPPATKPPTPKP----TPPTYTPSPKPPTPKPTPPTYTPSPKPTPPTYTPSPK 202

Query: 257 PPAPTPAS---TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           PP P P     TPS  P P+T    P PTP +  P P      P+P       KP
Sbjct: 203 PPTPKPTPPTYTPSPKP-PATKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKP 256

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 44/112 (39%), Positives = 50/112 (44%), Gaps = 13/112 (11%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA------TPAPASSPAT---SPPAP 246
           PPT TP+P   PP     PT   P  TPP   PAP       TP P  +P T   SP  P
Sbjct: 81  PPTYTPSPKPTPPTYTPTPTPPTPKPTPPTYTPAPTPHKPTPTPKPTPTPPTYTPSPKPP 140

Query: 245 TPASTPST-APT---PSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           TP  TP T AP+   P+T    P PTP +  P P      P+P       KP
Sbjct: 141 TPKPTPPTYAPSPKPPATKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKP 192

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 45/107 (42%), Positives = 50/107 (46%), Gaps = 10/107 (9%)
 Frame = -3

Query: 419 PTAAPTK-PPTATPAPTAQPPAAATP---PTATPPTATPPAAVPAPATPAPASSPATSPP 252
           PT  PT  PPT TP+P    P    P   P+  PP   PP   P P T  P+  P T  P
Sbjct: 122 PTPKPTPTPPTYTPSPKPPTPKPTPPTYAPSPKPPATKPPTPKPTPPTYTPSPKPPTPKP 181

Query: 251 APTPASTPSTAPTPST-AGSP----PAPTPDSLGPGPS-GADTPPSP 129
            P P  TPS  PTP T   SP    P PTP +  P P   A  PP+P
Sbjct: 182 TP-PTYTPSPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPPTP 227

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 39/112 (34%), Positives = 48/112 (42%), Gaps = 12/112 (10%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATP-PTATPPT-----------ATPPAAVPAPATPAP 279
           +P    TKPPT  P P    P+   P P  TPPT            TPP   P+P  P P
Sbjct: 216 SPKPPATKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPTPPTYTPSPKPPTP 275

Query: 278 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
             +P T  P+P P +   T PT + +  PPA  P +  P P      P P A
Sbjct: 276 KPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPPTPKPTPPTYTPTPKPPA 327

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 35/85 (41%), Positives = 42/85 (49%), Gaps = 4/85 (4%)
 Frame = -3

Query: 419 PTAAPT-KPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           PT  P+ KPPT  P P    P+   P P  TPPT TP    PA   P P  +P T  P P
Sbjct: 264 PTYTPSPKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPPTPKPTPPTYTPTP 323

Query: 245 TPAST--PSTAPTPSTAGSPPAPTP 177
            P +T  P+  PTP  + +P  P P
Sbjct: 324 KPPATKPPTYTPTPPVSHTPSPPPP 348

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 40/122 (32%), Positives = 49/122 (40%), Gaps = 1/122 (0%)
 Frame = -3

Query: 488 ASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA 309
           + +AA+ + L+   LA    A A       P  ATP P  + P    P    PP    P 
Sbjct: 4   SGTAALLLALVAVSLAVEIQADAGYGYTPTPTPATPTPKPEKPPTKGPKPEKPPKEHKP- 62

Query: 308 AVPAPATPAPASSPATSPPAPTPASTPSTAPTPST-AGSPPAPTPDSLGPGPSGADTPPS 132
             P    P P   P    P P P  TPS  PTP T   +P  PTP    P  + A TP  
Sbjct: 63  --PKEHGPKPEKPPKEHKPTP-PTYTPSPKPTPPTYTPTPTPPTPKPTPPTYTPAPTPHK 119

Query: 131 PS 126
           P+
Sbjct: 120 PT 121

[170][TOP]
>UniRef100_Q01AC1 Meltrins, fertilins and related Zn-dependent metalloproteinases of
           the ADAMs family (ISS) n=1 Tax=Ostreococcus tauri
           RepID=Q01AC1_OSTTA
          Length = 872

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 42/109 (38%), Positives = 60/109 (55%), Gaps = 4/109 (3%)
 Frame = -3

Query: 443 ATSCLAQAPTAA-PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP 267
           A + L+  P++  PT PP ++P P+  PP +  PP + PP + PP+  P+P  P+P S P
Sbjct: 480 ACTLLSSVPSSELPTAPPVSSPPPSPSPPPS--PPPSPPPPSPPPSPPPSPPPPSPPSPP 537

Query: 266 ATSPPAPTPASTPSTAPTPSTAG---SPPAPTPDSLGPGPSGADTPPSP 129
             S P+P P+  P  +P P +A    SPP P+P    P P     PPSP
Sbjct: 538 PPS-PSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSP 585

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 38/97 (39%), Positives = 51/97 (52%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P+ PP + P+P   PP+ + PP+  PP + PP +   P +P P S P  SPP P+P
Sbjct: 522 PSPPPSPPPPSPPSPP--PPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSP 579

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              PS  P+P    SPP P+P    P P     P SP
Sbjct: 580 PPPPSPPPSPPPPPSPPPPSP----PPPPVVVVPSSP 612

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 42/121 (34%), Positives = 59/121 (48%), Gaps = 14/121 (11%)
 Frame = -3

Query: 449 LLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTA-----------TPPTATPPAAV 303
           LL++   ++ PTA P   P  +P+P   PP +  PP+            +PP+  PP+  
Sbjct: 483 LLSSVPSSELPTAPPVSSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPS 542

Query: 302 PAPATPAPASSP---ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
           P P+ P P S P   A  PP+P P S P  +P P +   PP+P P    P P  +  PPS
Sbjct: 543 PPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPP---SPPPPPSPPPPS 599

Query: 131 P 129
           P
Sbjct: 600 P 600

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 32/81 (39%), Positives = 44/81 (54%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P  +P+ PP+  P P+  P +AA PP+  PP+  PP+  P P +P P  SP  SPP P P
Sbjct: 537 PPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPS--PPPPSPPPPPSPPPSPP-PPP 593

Query: 239 ASTPSTAPTPSTAGSPPAPTP 177
           +  P + P P     P +P P
Sbjct: 594 SPPPPSPPPPPVVVVPSSPPP 614

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 40/108 (37%), Positives = 55/108 (50%)
 Frame = -3

Query: 452 GLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS 273
           G     C   A T   + P  ++  PTA PP ++ PP+ +PP + PP+  P P +P P+ 
Sbjct: 470 GTFPKVCYNGACTLLSSVP--SSELPTA-PPVSSPPPSPSPPPSPPPS--PPPPSPPPSP 524

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P+  PP+P     PS +P PS    PP+P P S    PS    PPSP
Sbjct: 525 PPSPPPPSPPSPPPPSPSPPPSPP-PPPSPPPGSAARPPS--PPPPSP 569

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 35/81 (43%), Positives = 46/81 (56%)
 Frame = -3

Query: 344 PTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLG 165
           P++  PTA PP + P P+ P+P  SP  SPP P+P  +P  +P P +  SPP P+P S  
Sbjct: 488 PSSELPTA-PPVSSPPPS-PSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSP-SPP 544

Query: 164 PGPSGADTPPSPSAAFSYSKP 102
           P P    +PP  SAA   S P
Sbjct: 545 PSPPPPPSPPPGSAARPPSPP 565

 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 31/89 (34%), Positives = 41/89 (46%), Gaps = 3/89 (3%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAA---ATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
           +P  +P  PP+  P   A+PP+    + PP + PP + PP   P P+ P P S P  SPP
Sbjct: 542 SPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPP 601

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLG 165
            P     PS+ P        P P   S G
Sbjct: 602 PPPVVVVPSSPPPVLVNDMYPPPPVMSAG 630

[171][TOP]
>UniRef100_Q657S4 Os01g0110200 protein n=2 Tax=Oryza sativa RepID=Q657S4_ORYSJ
          Length = 240

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 63/135 (46%), Positives = 72/135 (53%), Gaps = 5/135 (3%)
 Frame = -3

Query: 458 ILGLLATSCLAQAPTAAPTKPPTATPAPTA---QPPAAATP-PTATPPTATPPAAVPAPA 291
           +L L      AQ+P AAP +P T TP PTA    PPA ATP PTATP   TPP A PA A
Sbjct: 16  LLALHLALAAAQSPAAAPAQP-TPTPVPTAPAKSPPAPATPAPTATP---TPPVA-PAKA 70

Query: 290 TP-APASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFS 114
            P APA +P T PP PTP   P    TP    +PP  TP  + P P+   TPP P+   S
Sbjct: 71  PPVAPAVAPVTPPP-PTPKKAPPPPVTPPPV-TPPPVTPPPVSPPPA---TPP-PALPPS 124

Query: 113 YSKPIIAATALSAAL 69
              P+ A     AAL
Sbjct: 125 TPPPVAAPAEAPAAL 139

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 46/114 (40%), Positives = 53/114 (46%), Gaps = 8/114 (7%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQP------PAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
           APTA PT P     AP   P      P   TP  A PP  TPP   P P TP P S P  
Sbjct: 56  APTATPTPPVAPAKAPPVAPAVAPVTPPPPTPKKAPPPPVTPPPVTPPPVTPPPVSPPPA 115

Query: 260 SPPAPTPASTPS--TAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSK 105
           +PP   P STP    AP  + A  PPA TP  +   P  A+ PP+ +   S +K
Sbjct: 116 TPPPALPPSTPPPVAAPAEAPAALPPATTPPPVAEAP--AELPPAEAPTKSKNK 167

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 48/120 (40%), Positives = 58/120 (48%), Gaps = 22/120 (18%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA-------PATPAP--ASSPA 264
           T  P  PP  TP P + PPA  TPP A PP+  PP A PA       PAT  P  A +PA
Sbjct: 96  TPPPVTPPPVTPPPVSPPPA--TPPPALPPSTPPPVAAPAEAPAALPPATTPPPVAEAPA 153

Query: 263 TSPPAPTPAST------------PSTAPTPSTAGSPPAPTPDSLGPGPSGAD-TPPSPSA 123
             PPA  P  +             ++AP P    SPPAP   +L P  + AD + P+PSA
Sbjct: 154 ELPPAEAPTKSKNKHRKKNKRGKKASAPAPEPL-SPPAPA--ALSPADNQADVSGPAPSA 210

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 43/129 (33%), Positives = 53/129 (41%), Gaps = 4/129 (3%)
 Frame = -3

Query: 428 AQAPTAAP--TKPPTATPA--PTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
           A  P A P  T PP A PA  P A PPA   PP A  P   PPA  P  +          
Sbjct: 115 ATPPPALPPSTPPPVAAPAEAPAALPPATTPPPVAEAPAELPPAEAPTKSKNKHRKKNKR 174

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATAL 81
              A  PA  P + P P+ A SP     D  GP PS  D   S      +    +  T +
Sbjct: 175 GKKASAPAPEPLSPPAPA-ALSPADNQADVSGPAPSAFDLNGSNRQYGQWG--FVLQTVM 231

Query: 80  SAALFAIAF 54
           +A L ++A+
Sbjct: 232 AALLLSLAW 240

[172][TOP]
>UniRef100_B3R319 Putative uncharacterized protein n=1 Tax=Cupriavidus taiwanensis
           RepID=B3R319_CUPTR
          Length = 278

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 47/105 (44%), Positives = 54/105 (51%), Gaps = 5/105 (4%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPP-TATPPTAT-PPAAVPAP--ATPAPA 276
           AT+  A AP A    P   TP  T+ PPAA  PP T  PP AT PPAA PAP  A PA A
Sbjct: 68  ATAAPAPAPGAMAPTPGVTTPPATSVPPAATVPPATTVPPAATMPPAAEPAPGIAAPATA 127

Query: 275 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPD-SLGPGPSGAD 144
           + P T+ P P P  TP   P P    +P  P P  ++ P P   D
Sbjct: 128 APPPTASPMPAPTGTPPAVPAPPPVAAPAQPRPPLTVPPAPPARD 172

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 50/140 (35%), Positives = 62/140 (44%), Gaps = 11/140 (7%)
 Frame = -3

Query: 470 QIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA 291
           ++ L LG  A + LA  P A+  + P     P    PAA  P TA P  A P A  P   
Sbjct: 28  RLVLALGAGAVALLALVPAASHAQAPVVDANPAPATPAA--PATAAPAPA-PGAMAP--- 81

Query: 290 TPAPASSPATS-PPAPT--PAST--------PSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
           TP   + PATS PPA T  PA+T        P+  P P  A    A  P +  P P+   
Sbjct: 82  TPGVTTPPATSVPPAATVPPATTVPPAATMPPAAEPAPGIAAPATAAPPPTASPMPAPTG 141

Query: 143 TPPSPSAAFSYSKPIIAATA 84
           TPP+  A      P +AA A
Sbjct: 142 TPPAVPA-----PPPVAAPA 156

[173][TOP]
>UniRef100_Q6SSE8 Minus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE8_CHLRE
          Length = 3889

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 39/104 (37%), Positives = 53/104 (50%), Gaps = 5/104 (4%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA---PATPAPASSPATSP 255
            + P+  P  PP A+P PT+  P +  PP+  PP+  PP+  P    P +PAP S P  SP
Sbjct: 837  EPPSPVPPSPPPASPEPTSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPLPSP 896

Query: 254  --PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              P+P P   P  +P P +   P  P P    P P+ +  PPSP
Sbjct: 897  EPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPSPPPPSP 940

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 40/100 (40%), Positives = 55/100 (55%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS--PATSPPAP 246
            P+ AP  P   +PAP +  P +  PP+  PP+  PP+  P P +PAP S   P+  PP+P
Sbjct: 1052 PSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPS--PEPPSPAPPSPRPPSPEPPSP 1109

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P S P  +P P +  +PP+P P SL P      +PP PS
Sbjct: 1110 VPPSPPPPSPEPPSP-APPSPPPPSLEPPSPAPPSPPPPS 1148

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 43/100 (43%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATS--PPAP 246
            P+ AP  P   +PAP +  P +  PP+  PP+  PP+  P P +PAP S P  S  PP+P
Sbjct: 1082 PSPAPPSPEPPSPAPPSPRPPSPEPPSPVPPSPPPPS--PEPPSPAPPSPPPPSLEPPSP 1139

Query: 245  TPASTPSTAP-TPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             P S P  +P  PS A SPP P+P+   P P  +  PPSP
Sbjct: 1140 APPSPPPPSPEPPSPAPSPPPPSPEPPSPVPP-SPPPPSP 1178

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 41/101 (40%), Positives = 52/101 (51%), Gaps = 3/101 (2%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
            AP+  P  P   +PAP + PP +  PP+  PP   PP+  P P +PAP S P  SP  P+
Sbjct: 932  APSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPLPPPPS--PEPPSPAPPSPPPPSPEPPS 989

Query: 242  PA---STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            PA     PS  P      SPP P+P+   P P  +  PPSP
Sbjct: 990  PAPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 1029

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 42/104 (40%), Positives = 58/104 (55%), Gaps = 7/104 (6%)
 Frame = -3

Query: 419  PTA-APTKPPTATPAPTAQPPAAATPPTATPPTATPPAA-VPAPATPAPA----SSPATS 258
            PT+ AP  PP  +P P +  P +  PP+  PP+  PP+  +P+P  P+PA      P+  
Sbjct: 853  PTSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPLPSPEPPSPAPPLPPPPSPE 912

Query: 257  PPAPTPASTPSTAP-TPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            PP+P P S P  +P  PS A SPP P+P+   P P  +  PPSP
Sbjct: 913  PPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPAPP-SPPPPSP 955

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 41/105 (39%), Positives = 55/105 (52%), Gaps = 6/105 (5%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT--PPAAVPAPATPAPASSPATS-- 258
            + P+ AP  PP  +P P +  P +  PP+  PP+    PP   P P +PAP S P  S  
Sbjct: 956  EPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPLPPPPSPEPPSPAPPSPPPPSPE 1015

Query: 257  PPAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
            PP+P P S P  +P P +    SPP P+P+   P P  +  PPSP
Sbjct: 1016 PPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPAPPSP 1059

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 38/103 (36%), Positives = 51/103 (49%), Gaps = 4/103 (3%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTA--TPPAAVPAPATPAPASSPATS-- 258
            + P+ AP  PP  +P P +  P +  PP+  PP+   +PP   P P +PAP S P  S  
Sbjct: 897  EPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPAPPSPPPPSPE 956

Query: 257  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            PP+P P   P  +P P +   P  P P    P P+    PPSP
Sbjct: 957  PPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPLPPPPSP 999

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 42/100 (42%), Positives = 55/100 (55%), Gaps = 1/100 (1%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
            AP   P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP S P  SP  P+
Sbjct: 991  APLPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPPSPEPPS 1048

Query: 242  PASTPSTAPTPS-TAGSPPAPTPDSLGPGPSGADTPPSPS 126
            PA      P+P   + +PP+P P S  P PS A  PPSP+
Sbjct: 1049 PAPPSPAPPSPEPPSPAPPSPAPPSPEP-PSPA--PPSPA 1085

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 38/100 (38%), Positives = 53/100 (53%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS--PATSPPAP 246
            P+  P  P   +PAP +  P +  PP+  PP+  PP+  P P +P P S   P+  PP+P
Sbjct: 784  PSPGPPSPEPPSPAPPSAAPPSPMPPSPAPPSPDPPS--PKPPSPVPPSPLPPSPEPPSP 841

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P S P  +P P T+ +PP+P P S  P      +PP PS
Sbjct: 842  VPPSPPPASPEP-TSPAPPSPPPPSPEPPSPAPPSPPPPS 880

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 40/110 (36%), Positives = 52/110 (47%), Gaps = 4/110 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+ AP  P   +PAP +  P +  PP+  PP+  PP+  P P +P P S P  SP  P+P
Sbjct: 1067 PSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPSPRPPS--PEPPSPVPPSPPPPSPEPPSP 1124

Query: 239  AST----PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            A      PS  P      SPP P+P+   P PS     P P +    S P
Sbjct: 1125 APPSPPPPSLEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPVPPSPP 1174

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/104 (39%), Positives = 54/104 (51%), Gaps = 7/104 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA---PATPAPASSPATSP-- 255
            P+ AP  P   +P P +  P +  PP+  PP+  PP+  PA   P +PAP S P  SP  
Sbjct: 809  PSPAPPSPDPPSPKPPSPVPPSPLPPSPEPPSPVPPSPPPASPEPTSPAPPSPPPPSPEP 868

Query: 254  PAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
            P+P P S P  +P P +    SPP P+P+   P P     PPSP
Sbjct: 869  PSPAPPSPPPPSPEPPSPAPPSPPLPSPEPPSPAPP-LPPPPSP 911

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 39/105 (37%), Positives = 55/105 (52%), Gaps = 6/105 (5%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPA---SSPATS 258
            + P+ AP  PP  +P P +  P    PP+  PP+  PP+  P +P  P+PA     P+  
Sbjct: 941  EPPSPAPPSPPPPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPLPPPPSPE 1000

Query: 257  PPAPTPASTPSTAPTPSTAG--SPPAPTPDSLGPGPSGADTPPSP 129
            PP+P P S P  +P P +    SPP P+P+   P P  +  PPSP
Sbjct: 1001 PPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-SPPPPSP 1044

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 39/102 (38%), Positives = 53/102 (51%), Gaps = 2/102 (1%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
            AP+  P  P   +P P + PP +  PP+  PP+  PP  +P P +P   S P+  PP+P 
Sbjct: 1155 APSPPPPSPEPPSPVPPSPPPPSPEPPSPAPPSPAPP--LPLPPSPHTQSPPSPVPPSPA 1212

Query: 242  PA--STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
            P+  S PS  P    A SPP+P P +    PS    PP P+A
Sbjct: 1213 PSAPSPPSPQPPSPLAPSPPSPAPQA----PSSPFPPPQPTA 1250

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 39/100 (39%), Positives = 52/100 (52%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
            P+  P  P   +P P + PPA+  P +  PP+  PP+  P P +PAP S P  SP  P+P
Sbjct: 829  PSPLPPSPEPPSPVPPSPPPASPEPTSPAPPSPPPPS--PEPPSPAPPSPPPPSPEPPSP 886

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P S P  +P P +  +PP P P S  P      +PP PS
Sbjct: 887  APPSPPLPSPEPPSP-APPLPPPPSPEPPSPAPPSPPPPS 925

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 42/110 (38%), Positives = 56/110 (50%), Gaps = 3/110 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP--PAP 246
            P+  P  P   +PAP + PP +  PP+  PP+  PP   P P +PAP   P  SP  P+P
Sbjct: 859  PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS--PPLPSPEPPSPAPPLPPPPSPEPPSP 916

Query: 245  TPASTPSTAPTP-STAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
             P S P  +P P S A SPP P+P+   P P+    PP      S + P+
Sbjct: 917  APPSPPPPSPEPPSPAPSPPPPSPEP--PSPAPPSPPPPSPEPPSPAPPL 964

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/106 (41%), Positives = 59/106 (55%), Gaps = 6/106 (5%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQ----PPAAATPPTATPPTATPPAAVPAPATPAPASSPATS 258
            + P+ AP  PP  +P P +     PP +  PP+  PP+  PP+  P P +PAP S P  S
Sbjct: 971  EPPSPAPPSPPPPSPEPPSPAPLPPPPSPEPPSPAPPSPPPPS--PEPPSPAPPSPPPPS 1028

Query: 257  P--PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P  P+P P S P  +P P +  +PP+P P S  P PS A  PPSP+
Sbjct: 1029 PEPPSPAPPSPPPPSPEPPSP-APPSPAPPSPEP-PSPA--PPSPA 1070

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/99 (38%), Positives = 54/99 (54%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
            P+  P  P   +PAP + PP +  PP+  PP+  PP+   P+PA P+PA  P+  PP+P 
Sbjct: 1022 PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPAPPSPEPPSPAPPSPA-PPSPEPPSPA 1080

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P S    +P P +  +PP+P P S  P      +PP PS
Sbjct: 1081 PPSPAPPSPEPPSP-APPSPRPPSPEPPSPVPPSPPPPS 1118

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 50/111 (45%), Positives = 62/111 (55%), Gaps = 5/111 (4%)
 Frame = -3

Query: 446  LATSCLAQAPTA--APTKPPTATPAPTAQPPA---AATPPTATPPTATPPAAVPAPATPA 282
            LA S  + AP A  +P  PP  T APTA PP    +  PP+ TPP+  PPA  P P +P 
Sbjct: 1227 LAPSPPSPAPQAPSSPFPPPQPT-APTAPPPPFPPSPAPPSPTPPSPEPPA--PQPPSPT 1283

Query: 281  PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P + P+  PP+PTP S    +P P +  SPP+P P    P PS A  PPSP
Sbjct: 1284 PHAPPSPEPPSPTPPSPLPPSPEPPSP-SPPSPAPSVPSP-PSPA--PPSP 1330

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 40/110 (36%), Positives = 56/110 (50%), Gaps = 10/110 (9%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPASSP---ATS 258
            + P+ AP  PP  +P P +  P    PP+  PP+  PP+  P +P  P+PA SP   +  
Sbjct: 882  EPPSPAPPSPPLPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPSPPPPSPE 941

Query: 257  PPAPTPASTPSTAPTPSTAGSP----PAPTPDSLGP--GPSGADTPPSPS 126
            PP+P P S P  +P P +   P    P+P P S  P   P  +  PPSP+
Sbjct: 942  PPSPAPPSPPPPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPA 991

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 37/103 (35%), Positives = 54/103 (52%), Gaps = 4/103 (3%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPASS---PATS 258
            + P+  P  PP  +P P +  P +  PP+  PP+  PP+  P +P  P+PA S   P+  
Sbjct: 1105 EPPSPVPPSPPPPSPEPPSPAPPSPPPPSLEPPSPAPPSPPPPSPEPPSPAPSPPPPSPE 1164

Query: 257  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            PP+P P S P  +P P +  +PP+P P    P      +PPSP
Sbjct: 1165 PPSPVPPSPPPPSPEPPSP-APPSPAPPLPLPPSPHTQSPPSP 1206

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 41/98 (41%), Positives = 56/98 (57%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPASSPATSPPAPT 243
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P +PA P+PA  P+  PP+P 
Sbjct: 1007 PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPAP-PSPEPPSPA 1065

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P S    +P P +  +PP+P P S  P PS A  PPSP
Sbjct: 1066 PPSPAPPSPEPPSP-APPSPAPPSPEP-PSPA--PPSP 1099

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 43/126 (34%), Positives = 55/126 (43%), Gaps = 14/126 (11%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV------------PAPATPAPA 276
            P+ AP  P   +PAP A  P + TPP+  PP    P               P P +P P 
Sbjct: 1323 PSPAPPSPMPPSPAPLAPQPPSPTPPSPAPPVPPSPEPPVPPGPDPPLPPSPTPPSPQPP 1382

Query: 275  SSPATSPPAPTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
              P+ +PP+P P S   PS AP+     SP  P+P    P P    +PPSP +  S   P
Sbjct: 1383 VPPSPTPPSPQPPSPAPPSPAPSAPLQPSPDPPSPQPPSPAPGPPPSPPSPPSTPSPPSP 1442

Query: 101  IIAATA 84
               A A
Sbjct: 1443 APLAPA 1448

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 41/105 (39%), Positives = 54/105 (51%), Gaps = 8/105 (7%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS-------PAT 261
            P   P   P   P+PT   P    PP+ TPP+  PP+  PAP +PAP++        P+ 
Sbjct: 1360 PPVPPGPDPPLPPSPTPPSPQPPVPPSPTPPSPQPPS--PAPPSPAPSAPLQPSPDPPSP 1417

Query: 260  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG-PSGADTPPSP 129
             PP+P P   PS  P+P +  SPP+P P +  P  P  A  PPSP
Sbjct: 1418 QPPSPAPGPPPS-PPSPPSTPSPPSPAPLAPAPPVPPMAPQPPSP 1461

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 40/98 (40%), Positives = 54/98 (55%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  P  + P P+ +PP+ A PP+  PP+  PP+  PAP  P P   P+  PP+P P
Sbjct: 924  PSPEPPSPAPSPPPPSPEPPSPA-PPSPPPPSPEPPS--PAPPLPPP---PSPEPPSPAP 977

Query: 239  ASTPSTAP-TPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             S P  +P  PS A  PP P+P+   P P  +  PPSP
Sbjct: 978  PSPPPPSPEPPSPAPLPPPPSPEPPSPAPP-SPPPPSP 1014

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 41/106 (38%), Positives = 56/106 (52%), Gaps = 6/106 (5%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA---AVPAPATPAPASSPATSP 255
            + P+ AP  P   +P P +  P +  PP+  PP+  PP+     P P +P P S P  SP
Sbjct: 1060 EPPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPSPRPPSPEPPSPVPPSPPPPSP 1119

Query: 254  PAPTPASTPSTAPTPS---TAGSPPAPTPDSLGPGPSGADTPPSPS 126
              P+PA  P + P PS    + +PP+P P S  P PS A +PP PS
Sbjct: 1120 EPPSPA--PPSPPPPSLEPPSPAPPSPPPPSPEP-PSPAPSPPPPS 1162

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 39/105 (37%), Positives = 53/105 (50%), Gaps = 5/105 (4%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPP---TATPPAAVPAPATPAPASSPATSP 255
            + P+  P  PP  +P P +  P +  PP   PP   T +PP+ VP    P+  S P+  P
Sbjct: 1164 EPPSPVPPSPPPPSPEPPSPAPPSPAPPLPLPPSPHTQSPPSPVPPSPAPSAPSPPSPQP 1223

Query: 254  PAPTPASTPSTAP-TPSTAGSPPAPTPDSLGPGP-SGADTPPSPS 126
            P+P   S PS AP  PS+   PP PT  +  P P   +  PPSP+
Sbjct: 1224 PSPLAPSPPSPAPQAPSSPFPPPQPTAPTAPPPPFPPSPAPPSPT 1268

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 47/124 (37%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT-SPPAPT 243
            P+  P  P   +PAP +  P+A   P+  PP+  PP+  P P  P+P S P+T SPP+P 
Sbjct: 1385 PSPTPPSPQPPSPAPPSPAPSAPLQPSPDPPSPQPPSPAPGP-PPSPPSPPSTPSPPSPA 1443

Query: 242  P-ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAALF 66
            P A  P   P      SPP P+P    P PS   TP SP  A     P  A    SAA  
Sbjct: 1444 PLAPAPPVPPMAPQPPSPPLPSP-PFPPQPSPTITPASPQPA-----PAAAVLDCSAAAT 1497

Query: 65   AIAF 54
              +F
Sbjct: 1498 RTSF 1501

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 41/98 (41%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPP-AAVPAPATPAPASSPATSPPAPT 243
            P   P+ PP  +P P  +PP    PP+  PP   PP    PAP +P P  SP+  PP+P 
Sbjct: 730  PPPKPSPPPRPSPPP--RPPPRPLPPSPPPPPPLPPNPPSPAPPSPPPPPSPSIPPPSPG 787

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P S    +P P +A +PP+P P S  P P   D PPSP
Sbjct: 788  PPSPEPPSPAPPSA-APPSPMPPS--PAPPSPD-PPSP 821

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 42/115 (36%), Positives = 57/115 (49%), Gaps = 18/115 (15%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT-SPPAPT 243
            P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +PAP+  P +  PP+P 
Sbjct: 1112 PSPPPPSPEPPSPAPPSPPPPSLEPPSPAPPSPPPPS--PEPPSPAPSPPPPSPEPPSPV 1169

Query: 242  PASTPSTAPTPSTAG-----------------SPPAPTPDSLGPGPSGADTPPSP 129
            P S P  +P P +                   SPP+P P S  P PS A +PPSP
Sbjct: 1170 PPSPPPPSPEPPSPAPPSPAPPLPLPPSPHTQSPPSPVPPS--PAPS-APSPPSP 1221

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 36/97 (37%), Positives = 49/97 (50%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  P   + AP +  P +  PP+  PP+  PP+ VP    P     P+  PP+P P
Sbjct: 789  PSPEPPSPAPPSAAPPSPMPPSPAPPSPDPPSPKPPSPVPPSPLPPSPEPPSPVPPSPPP 848

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            AS   T+P P    SPP P+P+   P P  +  PPSP
Sbjct: 849  ASPEPTSPAPP---SPPPPSPEPPSPAPP-SPPPPSP 881

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 39/100 (39%), Positives = 50/100 (50%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  P   +PAP + P  +  PP+  PP   PP+  P P +PAP S P  SP  P+P
Sbjct: 874  PSPPPPSPEPPSPAPPSPPLPSPEPPSPAPPLPPPPS--PEPPSPAPPSPPPPSPEPPSP 931

Query: 239  AST---PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            A +   PS  P      SPP P+P+   P P     PPSP
Sbjct: 932  APSPPPPSPEPPSPAPPSPPPPSPEPPSPAPP-LPPPPSP 970

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 40/115 (34%), Positives = 55/115 (47%), Gaps = 7/115 (6%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP---APATPAPASSPATSP 255
            + P+ AP  P   +P P +  P +  PP+  PP+  PP+  P    P +PAP S P  SP
Sbjct: 1090 EPPSPAPPSPRPPSPEPPSPVPPSPPPPSPEPPSPAPPSPPPPSLEPPSPAPPSPPPPSP 1149

Query: 254  PAPTPAST---PSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSPSAAFSYSKP 102
              P+PA +   PS  P      SPP P+P+   P P     P P P +  + S P
Sbjct: 1150 EPPSPAPSPPPPSPEPPSPVPPSPPPPSPEPPSPAPPSPAPPLPLPPSPHTQSPP 1204

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 35/100 (35%), Positives = 52/100 (52%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
            + P+ AP  PP  +P P +  P +  PP+  PP+  PP+  P    P   + P+ +PP+P
Sbjct: 1000 EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPAPPSP 1059

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P S    +P P +   PP+P P S  P P   + PPSP+
Sbjct: 1060 EPPSPAPPSPAPPSP-EPPSPAPPS--PAPPSPE-PPSPA 1095

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 36/97 (37%), Positives = 47/97 (48%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  P   +P+P +  P+  +PP+  PP+  PP+  PAP  P P S    SP  P P
Sbjct: 1298 PSPLPPSPEPPSPSPPSPAPSVPSPPSPAPPSPMPPS--PAPLAPQPPSPTPPSPAPPVP 1355

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             S     P       PP+PTP S  P    + TPPSP
Sbjct: 1356 PSPEPPVPPGPDPPLPPSPTPPSPQPPVPPSPTPPSP 1392

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 38/97 (39%), Positives = 44/97 (45%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P  PP   P     PP   +PP   PP  +PP   P P+ P   S P   PP P P
Sbjct: 695 PPRPPRPPPPPLPPSPPLPPVTPSPPPRPPPPKSPPP--PKPSPPPRPSPPPRPPPRPLP 752

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            S P   P P    +PP+P P S  P PS +  PPSP
Sbjct: 753 PSPPPPPPLPP---NPPSPAPPSPPPPPSPSIPPPSP 786

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 41/102 (40%), Positives = 54/102 (52%), Gaps = 5/102 (4%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA---AVPAPATPAPASSPATSPPA 249
            P  +P  P  A P+P    P   +P T +PP+  PP+   + P+P +P P S  A SPP+
Sbjct: 1174 PPPSPEPPSPAPPSPAPPLPLPPSPHTQSPPSPVPPSPAPSAPSPPSPQPPSPLAPSPPS 1233

Query: 248  PTP--ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P P   S+P   P P+   +PP P P S  P PS   TPPSP
Sbjct: 1234 PAPQAPSSPFPPPQPTAPTAPPPPFPPSPAP-PS--PTPPSP 1272

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 40/100 (40%), Positives = 54/100 (54%), Gaps = 2/100 (2%)
 Frame = -3

Query: 422  APTAAPTKPPTATP-APTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPA 249
            +PT    +PP   P +PT   P +  PP+ TPP+  PP+   P+P+ P+PA S   SPP+
Sbjct: 1266 SPTPPSPEPPAPQPPSPTPHAPPSPEPPSPTPPSPLPPSPEPPSPSPPSPAPS-VPSPPS 1324

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P P S    +P P  A  PP+PTP S  P    +  PP P
Sbjct: 1325 PAPPSPMPPSPAP-LAPQPPSPTPPSPAPPVPPSPEPPVP 1363

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 38/102 (37%), Positives = 55/102 (53%), Gaps = 2/102 (1%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS--SPATSPP 252
            Q P+  P  PP+  P P +  P +  PP+  PP+ +PP+  PAP+ P+P S   P+  PP
Sbjct: 1278 QPPSPTPHAPPS--PEPPSPTPPSPLPPSPEPPSPSPPS--PAPSVPSPPSPAPPSPMPP 1333

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            +P P +    +PTP +   P  P+P+   P P G D P  PS
Sbjct: 1334 SPAPLAPQPPSPTPPSPAPPVPPSPEP--PVPPGPDPPLPPS 1373

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 40/105 (38%), Positives = 49/105 (46%), Gaps = 6/105 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA------AVPAPATPAPASSPATS 258
            P+  P  P   +PAP+   P +  PP+  PP+  P A        P+PA P P S     
Sbjct: 1303 PSPEPPSPSPPSPAPSVPSPPSPAPPSPMPPSPAPLAPQPPSPTPPSPAPPVPPSPEPPV 1362

Query: 257  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
            PP P P   PS  P       PP+PTP S  P PS A   P+PSA
Sbjct: 1363 PPGPDPPLPPSPTPPSPQPPVPPSPTPPSPQP-PSPAPPSPAPSA 1406

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 40/106 (37%), Positives = 53/106 (50%), Gaps = 8/106 (7%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  P    P P +  P +  PP+  PP+  PP+  P+P  P+P   P+ +PP+P P
Sbjct: 894  PSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPSPPPPSP-EPPSPAPPSPPP 952

Query: 239  AS--TPSTAP--TPSTAGSPPAPTPDSLGP----GPSGADTPPSPS 126
             S   PS AP   P  +  PP+P P S  P     PS A  PP PS
Sbjct: 953  PSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPLPPPPS 998

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 40/100 (40%), Positives = 51/100 (51%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA---PATPAPASSPATSPPA 249
           P   P+ PP   P  +  PP  + PP  +PP   PP  +P    P  P P + P+ +PP+
Sbjct: 713 PPVTPSPPPRPPPPKSPPPPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLPPNPPSPAPPS 772

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P P  +PS  P PS    PP+P P S  P PS A  PPSP
Sbjct: 773 PPPPPSPSIPP-PSPG--PPSPEPPSPAP-PSAA--PPSP 806

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 49/136 (36%), Positives = 63/136 (46%), Gaps = 17/136 (12%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPA--AATPPTATPPTATPPAAVPA--------PATPAPASS 270
            P   P  PP+ TP P+ QPP   + TPP+  PP+  PP+  P+        P +P P  S
Sbjct: 1364 PGPDPPLPPSPTP-PSPQPPVPPSPTPPSPQPPSPAPPSPAPSAPLQPSPDPPSPQP-PS 1421

Query: 269  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-------PSPSAAFSY 111
            PA  PP P+P S PST   PS A   PAP    + P P     P       PSP+   + 
Sbjct: 1422 PAPGPP-PSPPSPPSTPSPPSPAPLAPAPPVPPMAPQPPSPPLPSPPFPPQPSPTITPAS 1480

Query: 110  SKPIIAATALSAALFA 63
             +P  AA  L  +  A
Sbjct: 1481 PQPAPAAAVLDCSAAA 1496

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 40/108 (37%), Positives = 55/108 (50%), Gaps = 10/108 (9%)
 Frame = -3

Query: 419  PTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPAAV------PAPATPAPASS--- 270
            P+  P  P P + P P+ +PP+ A PP   PP+  PP+        P+P  P+PA S   
Sbjct: 879  PSPEPPSPAPPSPPLPSPEPPSPA-PPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPSPPP 937

Query: 269  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P+  PP+P P S P  +P P +  +PP P P S  P      +PP PS
Sbjct: 938  PSPEPPSPAPPSPPPPSPEPPSP-APPLPPPPSPEPPSPAPPSPPPPS 984

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 35/99 (35%), Positives = 47/99 (47%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
            P+ AP+ P   +PAP +  P +  P    PP+ TPP+ A P P +P P   P   PP P 
Sbjct: 1313 PSPAPSVPSPPSPAPPSPMPPSPAPLAPQPPSPTPPSPAPPVPPSPEPPVPPGPDPPLPP 1372

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              + PS  P    + +PP+P P S  P       P  PS
Sbjct: 1373 SPTPPSPQPPVPPSPTPPSPQPPSPAPPSPAPSAPLQPS 1411

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 43/101 (42%), Positives = 57/101 (56%), Gaps = 2/101 (1%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
            APTA P   P + PAP +  P +  PP   PP+ TP A  P+P  P+P + P+  PP+P 
Sbjct: 1250 APTAPPPPFPPS-PAPPSPTPPSPEPPAPQPPSPTPHAP-PSPEPPSP-TPPSPLPPSPE 1306

Query: 242  PASTPSTAPTPSTAGSPPAPTPDS-LGPGPSG-ADTPPSPS 126
            P S    +P PS   SPP+P P S + P P+  A  PPSP+
Sbjct: 1307 PPSPSPPSPAPSVP-SPPSPAPPSPMPPSPAPLAPQPPSPT 1346

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 36/98 (36%), Positives = 45/98 (45%), Gaps = 4/98 (4%)
 Frame = -3

Query: 410  APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAST 231
            +P  P   +P P +  P A  PP+ TPP+  PP   P+P  P P       PP+PTP S 
Sbjct: 1321 SPPSPAPPSPMPPSPAPLAPQPPSPTPPSPAPPVP-PSPEPPVPPGPDPPLPPSPTPPSP 1379

Query: 230  PSTAPTPSTAGSPPAPTPDSLGPGPSG----ADTPPSP 129
                P   T  SP  P+P    P PS     +  PPSP
Sbjct: 1380 QPPVPPSPTPPSPQPPSPAPPSPAPSAPLQPSPDPPSP 1417

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 41/100 (41%), Positives = 53/100 (53%), Gaps = 3/100 (3%)
 Frame = -3

Query: 416  TAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPASSPATSPPAPTP 240
            T +P  P   +PAP+A  P +  PP+   P+  PP+  P AP++P P   P T+P AP P
Sbjct: 1200 TQSPPSPVPPSPAPSAPSPPSPQPPSPLAPS--PPSPAPQAPSSPFPPPQP-TAPTAPPP 1256

Query: 239  ASTPSTAPTPSTAGS--PPAPTPDSLGPGPSGADTPPSPS 126
               PS AP   T  S  PPAP P S  P    +  PPSP+
Sbjct: 1257 PFPPSPAPPSPTPPSPEPPAPQPPSPTPHAPPSPEPPSPT 1296

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 36/106 (33%), Positives = 49/106 (46%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P   P  P  A P+P   P  +  PP+  PP+  PP+  P  A P     P+ +PP+P P
Sbjct: 759  PPLPPNPPSPAPPSPPPPPSPSIPPPSPGPPSPEPPSPAPPSAAPPSPMPPSPAPPSPDP 818

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
             S    +P P +   PP+P P S  P PS     P P++    S P
Sbjct: 819  PSPKPPSPVPPSP-LPPSPEPPSPVP-PSPPPASPEPTSPAPPSPP 862

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 38/92 (41%), Positives = 45/92 (48%), Gaps = 1/92 (1%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT-SPPAPTPASTPST 222
           PP + P P   PP   +PP   PP   PP+  P P  P    SPA  SPP P   S P  
Sbjct: 725 PPKSPPPPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLPPNPPSPAPPSPPPPPSPSIPPP 784

Query: 221 APTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           +P P +   PP+P P S  P PS    PPSP+
Sbjct: 785 SPGPPSP-EPPSPAPPSAAP-PS--PMPPSPA 812

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 34/98 (34%), Positives = 42/98 (42%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
            +P   P+ PP   P P    P    P    PP+  PP+  P P+   P  SP    P P 
Sbjct: 735  SPPPRPSPPPRPPPRPLPPSPPPPPPLPPNPPSPAPPSPPPPPSPSIPPPSPGPPSPEPP 794

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              + PS AP      SP  P+PD   P P  +  PPSP
Sbjct: 795  SPAPPSAAPPSPMPPSPAPPSPDPPSPKPP-SPVPPSP 831

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P + P  PP     P+  PP+   PP+ + P  +P    P P +PAP   P+ +PP+P P
Sbjct: 752  PPSPPPPPPLPPNPPSPAPPSPPPPPSPSIPPPSPGPPSPEPPSPAP---PSAAPPSPMP 808

Query: 239  ASTPSTAPTPSTAGSPPAPTPDS-LGPGPS-GADTPPSPSAA 120
             S    +P P +   PP+P P S L P P   +  PPSP  A
Sbjct: 809  PSPAPPSPDPPSP-KPPSPVPPSPLPPSPEPPSPVPPSPPPA 849

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 38/99 (38%), Positives = 48/99 (48%), Gaps = 4/99 (4%)
 Frame = -3

Query: 410  APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP----APATPAPASSPATSPPAPT 243
            +P  P    P+P  Q P +  PP+  P   +PP+  P    AP+ P+PA   A S P P 
Sbjct: 1187 SPAPPLPLPPSPHTQSPPSPVPPSPAPSAPSPPSPQPPSPLAPSPPSPAPQ-APSSPFPP 1245

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P  T  TAP P    SP  P+P    P P  A  PPSP+
Sbjct: 1246 PQPTAPTAPPPPFPPSPAPPSPTPPSPEPP-APQPPSPT 1283

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 42/125 (33%), Positives = 61/125 (48%), Gaps = 2/125 (1%)
 Frame = -3

Query: 425  QAPTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
            Q P+ AP  P P+A   P+  PP+   P  A  P  +PP+    P+ P+PA   A +PP 
Sbjct: 1393 QPPSPAPPSPAPSAPLQPSPDPPSPQPPSPAPGPPPSPPSPPSTPSPPSPAPL-APAPPV 1451

Query: 248  PTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
            P  A  P + P PS    P P+PT     P P+ A      SAA + +   +A+++  A 
Sbjct: 1452 PPMAPQPPSPPLPSPPFPPQPSPTITPASPQPAPAAAVLDCSAAATRTSFAVASSSRGAF 1511

Query: 71   LFAIA 57
              A+A
Sbjct: 1512 YIAVA 1516

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 36/99 (36%), Positives = 47/99 (47%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           P   P+ P P  TP+P  +PP   +PP   PP  +PP     P  P P   P  SPP P 
Sbjct: 704 PPLPPSPPLPPVTPSPPPRPPPPKSPP---PPKPSPPPRPSPPPRPPPRPLP-PSPPPPP 759

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P      +P P +   PP+P+     PGP   + PPSP+
Sbjct: 760 PLPPNPPSPAPPSPPPPPSPSIPPPSPGPPSPE-PPSPA 797

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 38/121 (31%), Positives = 42/121 (34%), Gaps = 23/121 (19%)
 Frame = -3

Query: 419 PTAAPTKPPT------ATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT- 261
           P  AP  PP+        P P + PPA   PP   P    PPA+   PA P     P T 
Sbjct: 621 PPPAPPSPPSPPTTPDVPPMPPSSPPAPVMPPAPPPQPPIPPASPLTPAAPPRPPLPPTW 680

Query: 260 ----------------SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
                            PP P P   P + P P    SPP   P    P P     PP P
Sbjct: 681 PGKWEGAWPFRPPIPPRPPRPPPPPLPPSPPLPPVTPSPPPRPPPPKSPPPPKPSPPPRP 740

Query: 128 S 126
           S
Sbjct: 741 S 741

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 41/122 (33%), Positives = 48/122 (39%), Gaps = 24/122 (19%)
 Frame = -3

Query: 419  PTAAPTKPPT--ATPAPTAQPPAAATPPT----------------ATPPTATPPAAVPAP 294
            P A P +PP   A+P   A PP    PPT                  PP   PP   P+P
Sbjct: 651  PPAPPPQPPIPPASPLTPAAPPRPPLPPTWPGKWEGAWPFRPPIPPRPPRPPPPPLPPSP 710

Query: 293  ------ATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
                   +P P   P  SPP P P+  P  +P P     PP P P S  P P     PPS
Sbjct: 711  PLPPVTPSPPPRPPPPKSPPPPKPSPPPRPSPPPR---PPPRPLPPSPPPPPPLPPNPPS 767

Query: 131  PS 126
            P+
Sbjct: 768  PA 769

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 32/93 (34%), Positives = 38/93 (40%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTP 228
           PT PP   P P   PP+  +PPT       PP++ PAP  P     PA  P  P P ++P
Sbjct: 613 PTSPPQPPPPPA--PPSPPSPPTTPDVPPMPPSSPPAPVMP-----PAPPPQPPIPPASP 665

Query: 227 STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            T   P     PP       G  P     PP P
Sbjct: 666 LTPAAPPRPPLPPTWPGKWEGAWPFRPPIPPRP 698

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 40/118 (33%), Positives = 50/118 (42%), Gaps = 2/118 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA--PATPAPASSPATSPPAP 246
            P+  P  P   +PAP   P   + P T +PP+  P A  P   P  P P S P  SPP P
Sbjct: 1410 PSPDPPSPQPPSPAPGPPPSPPSPPSTPSPPSPAPLAPAPPVPPMAPQPPSPPLPSPPFP 1469

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
                 P  +PT + A   PAP    L    S A T  S + A S       A A+ A+
Sbjct: 1470 -----PQPSPTITPASPQPAPAAAVL--DCSAAATRTSFAVASSSRGAFYIAVAVPAS 1520

[174][TOP]
>UniRef100_Q5JN60 Os01g0750600 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5JN60_ORYSJ
          Length = 682

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 47/122 (38%), Positives = 54/122 (44%), Gaps = 13/122 (10%)
 Frame = -3

Query: 428 AQAPTA--APTKPPTATPAPTAQP--------PAAATPPTATPPTATPPAAVPAPATPAP 279
           +QAP+A   P  PP  TP  T  P        P   TPP  TPP  +PP   P P TP P
Sbjct: 3   SQAPSAPVTPAAPPPQTPPVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPVSPPPVTPPP 62

Query: 278 ASSPATSPP---APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYS 108
            S P  +PP    PTP + P   P+P     PP PTP  + P P    TP  P    S  
Sbjct: 63  VSPPPVTPPPVTPPTPVAPPPVPPSP----PPPTPTPTPVTPSPPPPVTPSPPPPVASPP 118

Query: 107 KP 102
            P
Sbjct: 119 PP 120

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 42/106 (39%), Positives = 50/106 (47%), Gaps = 13/106 (12%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA--------TSPP 252
           P  PP  TP P   PP +  PP  +PP  TPP   P P TP P + P          SPP
Sbjct: 32  PVSPPPVTPPPVTPPPVS--PPPVSPPPVTPPPVSPPPVTPPPVTPPTPVAPPPVPPSPP 89

Query: 251 APTPASTPST-APTPSTAGSPP----APTPDSLGPGPSGADTPPSP 129
            PTP  TP T +P P    SPP    +P P  +   P  ++ PPSP
Sbjct: 90  PPTPTPTPVTPSPPPPVTPSPPPPVASPPPPDVPTAPPPSNNPPSP 135

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 1/95 (1%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPT-ATPPAAVPAPATPAPASSPATSPPAPTPAST 231
           P  PP  TP P + PP   TPP  TPPT   PP   P+P  P P  +P T  P+P P  T
Sbjct: 52  PVSPPPVTPPPVSPPPV--TPPPVTPPTPVAPPPVPPSPPPPTPTPTPVT--PSPPPPVT 107

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           PS  P P  A  PP   P +  P  +    PPSPS
Sbjct: 108 PS--PPPPVASPPPPDVPTAPPPSNNPPSPPPSPS 140

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/120 (36%), Positives = 51/120 (42%), Gaps = 22/120 (18%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAA----TPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
           P A P + P  TP P   PP  +    TPP  TPP  +PP   P P TP P S P  +PP
Sbjct: 12  PAAPPPQTPPVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPVSPPPVTPPPVSPPPVTPP 71

Query: 251 APTPAS--------------TPSTAPTPSTAGSP----PAPTPDSLGPGPSGADTPPSPS 126
             TP +              TP+  PTP T   P    P+P P    P P    T P PS
Sbjct: 72  PVTPPTPVAPPPVPPSPPPPTPT--PTPVTPSPPPPVTPSPPPPVASPPPPDVPTAPPPS 129

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 41/116 (35%), Positives = 48/116 (41%), Gaps = 1/116 (0%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPA 237
           T  P  PP  TP P   P   A PP   PP+  PP   P P TP+P      SPP P  +
Sbjct: 59  TPPPVSPPPVTPPPVTPPTPVAPPP--VPPSPPPPTPTPTPVTPSPPPPVTPSPPPPVAS 116

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGPGPSGAD-TPPSPSAAFSYSKPIIAATALSAA 72
             P   PT      PP+  P S  P PS    +PP P  + S   P    T   A+
Sbjct: 117 PPPPDVPT----APPPSNNPPSPPPSPSNVPASPPPPRISLSPPPPPSTPTQSGAS 168

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 43/128 (33%), Positives = 59/128 (46%), Gaps = 7/128 (5%)
 Frame = -3

Query: 419 PTAAP--TKPPTATPAPTAQPPAAATPP----TATPPTATPPAAV-PAPATPAPASSPAT 261
           P + P  T PP   P P A PP   +PP    T TP T +PP  V P+P  P  +  P  
Sbjct: 62  PVSPPPVTPPPVTPPTPVAPPPVPPSPPPPTPTPTPVTPSPPPPVTPSPPPPVASPPPPD 121

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATAL 81
            P AP P++ P  +P PS +  P +P P  +   P    + P+ S A S SK     T +
Sbjct: 122 VPTAPPPSNNP-PSPPPSPSNVPASPPPPRISLSPPPPPSTPTQSGASSGSKSSNNGTVV 180

Query: 80  SAALFAIA 57
           +  +   A
Sbjct: 181 AVGVAVAA 188

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 39/125 (31%), Positives = 53/125 (42%), Gaps = 2/125 (1%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA-- 249
           AP   P  PP  TP PT   P+   P T +PP   PP A P P     A  P+ +PP+  
Sbjct: 80  APPPVPPSPPPPTPTPTPVTPSPPPPVTPSPP---PPVASPPPPDVPTAPPPSNNPPSPP 136

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAAL 69
           P+P++ P++ P P  + SPP P       G S      +     +    + A   L  A 
Sbjct: 137 PSPSNVPASPPPPRISLSPPPPPSTPTQSGASSGSKSSNNGTVVAVGVAVAAVVVLGLAA 196

Query: 68  FAIAF 54
             I F
Sbjct: 197 GLIYF 201

[175][TOP]
>UniRef100_Q4KXE1 Early salt stress and cold acclimation-induced protein 2-3 n=1
           Tax=Lophopyrum elongatum RepID=Q4KXE1_LOPEL
          Length = 325

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 50/131 (38%), Positives = 70/131 (53%), Gaps = 9/131 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTA-------TPPAAVPAPATPAPASSPA 264
           AP  +P  PP+ TP   A  P+  +PP+ TPP+        +PP+ VPA ATP  A SPA
Sbjct: 191 APMPSPMSPPSMTPPSAAPMPSPMSPPSMTPPSGAPTPSPMSPPSGVPA-ATPVSAPSPA 249

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA--AFSYSKPIIAA 90
            S P+  P +TP + P PST G   +P     G   SG ++PP+P A  A S +    AA
Sbjct: 250 GSVPSIAPGATPDSPPPPSTPGGGSSP-----GTPGSGTNSPPAPGADGADSTTPGSAAA 304

Query: 89  TALSAALFAIA 57
            A++  +  +A
Sbjct: 305 PAMAGLIGTLA 315

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 45/121 (37%), Positives = 62/121 (51%), Gaps = 14/121 (11%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSPPAP 246
           AP  +P  PP+ TP   A  P+  +PP+ TPP+  P P+ +  P+   P+++P  SP +P
Sbjct: 157 APMPSPMSPPSMTPPSGAPMPSPMSPPSMTPPSGAPMPSPMSPPSMTPPSAAPMPSPMSP 216

Query: 245 TPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGA----------DTPPSPSAAFSYSK 105
              + PS APTPS    P   PA TP S  P P+G+          D+PP PS     S 
Sbjct: 217 PSMTPPSGAPTPSPMSPPSGVPAATPVS-APSPAGSVPSIAPGATPDSPPPPSTPGGGSS 275

Query: 104 P 102
           P
Sbjct: 276 P 276

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 43/114 (37%), Positives = 58/114 (50%), Gaps = 1/114 (0%)
 Frame = -3

Query: 410 APTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSPPAPTPAS 234
           +P  PP+ TP   A  P+  +PP+ TPP+  P P+ +  P+   P+ +P  SP +P   +
Sbjct: 144 SPPSPPSMTPPSAAPMPSPMSPPSMTPPSGAPMPSPMSPPSMTPPSGAPMPSPMSPPSMT 203

Query: 233 TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
            PS AP PS   SPP+ TP S  P PS    P    AA   S P  A +  S A
Sbjct: 204 PPSAAPMPSPM-SPPSMTPPSGAPTPSPMSPPSGVPAATPVSAPSPAGSVPSIA 256

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 45/116 (38%), Positives = 60/116 (51%), Gaps = 8/116 (6%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSPPAPTPASTPST 222
           PP   P P    P+  +PP+ TPP+A P P+ +  P+   P+ +P  SP +P   + PS 
Sbjct: 131 PPGLLPPPPPSMPSPPSPPSMTPPSAAPMPSPMSPPSMTPPSGAPMPSPMSPPSMTPPSG 190

Query: 221 APTPSTAGSPPAPTPDSLGPGPSGAD----TPPSPSAAFSYSKP---IIAATALSA 75
           AP PS   SPP+ TP S  P PS       TPPS +   S   P   + AAT +SA
Sbjct: 191 APMPSPM-SPPSMTPPSAAPMPSPMSPPSMTPPSGAPTPSPMSPPSGVPAATPVSA 245

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 44/126 (34%), Positives = 59/126 (46%), Gaps = 5/126 (3%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP---PAAVPAPATPAPASSPATSPP 252
           AP  +P  PP+ TP     P  A TP   +PP+  P   P + P+PA   P+ +P  +P 
Sbjct: 208 APMPSPMSPPSMTP-----PSGAPTPSPMSPPSGVPAATPVSAPSPAGSVPSIAPGATPD 262

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA--ATALS 78
           +P P STP    +P T GS     P    PG  GAD+    SAA      +I   A  + 
Sbjct: 263 SPPPPSTPGGGSSPGTPGSGTNSPP---APGADGADSTTPGSAAAPAMAGLIGTLAAGIG 319

Query: 77  AALFAI 60
            A+ AI
Sbjct: 320 YAMLAI 325

[176][TOP]
>UniRef100_Q4KXE0 Cold acclimation induced protein 2-1 n=1 Tax=Triticum aestivum
           RepID=Q4KXE0_WHEAT
          Length = 321

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 52/141 (36%), Positives = 75/141 (53%), Gaps = 23/141 (16%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTA------------TPPAAVPAPATPAP 279
           AP  +P  PP+ TP   A  P+  +PP+ TPP+A            TPP+A P P+  +P
Sbjct: 166 APMPSPMSPPSMTPPSAAPMPSPMSPPSMTPPSAAPMPSPMSPPSMTPPSAAPMPSPMSP 225

Query: 278 AS-SPATSPPAP---TPASTPSTAPTPSTAGSPPAPTPDSLG----PGPSGADT--PPSP 129
            S +P +S P P   TPA+ P T P    + + PAP+P + G    PG  G+DT  PP+P
Sbjct: 226 PSMAPPSSEPMPSPMTPAAAPGTTPVSPASPAGPAPSPGTPGGGSSPGTPGSDTSSPPAP 285

Query: 128 SA-AFSYSKPIIAATALSAAL 69
           +A   + + P  AA  ++A L
Sbjct: 286 AADGANSTTPGSAAAPVTAGL 306

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 42/115 (36%), Positives = 61/115 (53%), Gaps = 3/115 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQP-PAAATPPTATPPTATP-PAAVPAPATPAPASSPATSPPAP 246
           P   P  PP + P  +A P P+  +PP+ TPP+A P P+ +  P+   P+++P  SP +P
Sbjct: 132 PGLLPPPPPPSMPPSSAPPMPSPMSPPSMTPPSAAPMPSPMSPPSMTPPSAAPMPSPMSP 191

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP-SPSAAFSYSKPIIAATA 84
              + PS AP PS   SPP+ TP S  P PS    P  +P ++     P+  A A
Sbjct: 192 PSMTPPSAAPMPSPM-SPPSMTPPSAAPMPSPMSPPSMAPPSSEPMPSPMTPAAA 245

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 41/117 (35%), Positives = 58/117 (49%), Gaps = 1/117 (0%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS-SPATSPPAPT 243
           P++AP  P   +P     P AA  P   +PP+ TPP+A P P+  +P S +P ++ P P+
Sbjct: 145 PSSAPPMPSPMSPPSMTPPSAAPMPSPMSPPSMTPPSAAPMPSPMSPPSMTPPSAAPMPS 204

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
           P S PS  P PS A  P   +P S+ P  S     P   AA   + P+  A+    A
Sbjct: 205 PMSPPSMTP-PSAAPMPSPMSPPSMAPPSSEPMPSPMTPAAAPGTTPVSPASPAGPA 260

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 42/111 (37%), Positives = 54/111 (48%), Gaps = 5/111 (4%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP--APATPAPASSPA 264
           SC A+            TP     PP    PP + PP++ PP   P   P+   P+++P 
Sbjct: 113 SCKAEQKLIVVVLSVDHTPPGLLPPP----PPPSMPPSSAPPMPSPMSPPSMTPPSAAPM 168

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS---PSAA 120
            SP +P   + PS AP PS   SPP+ TP S  P PS   +PPS   PSAA
Sbjct: 169 PSPMSPPSMTPPSAAPMPSPM-SPPSMTPPSAAPMPSPM-SPPSMTPPSAA 217

[177][TOP]
>UniRef100_B8A9G0 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8A9G0_ORYSI
          Length = 682

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 47/122 (38%), Positives = 54/122 (44%), Gaps = 13/122 (10%)
 Frame = -3

Query: 428 AQAPTA--APTKPPTATPAPTAQP--------PAAATPPTATPPTATPPAAVPAPATPAP 279
           +QAP+A   P  PP  TP  T  P        P   TPP  TPP  +PP   P P TP P
Sbjct: 3   SQAPSAPVTPAAPPPQTPPVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPVSPPPVTPPP 62

Query: 278 ASSPATSPP---APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYS 108
            S P  +PP    PTP + P   P+P     PP PTP  + P P    TP  P    S  
Sbjct: 63  VSPPPVTPPPVTPPTPVAPPPVPPSP----PPPTPTPTPVTPSPPPPVTPSPPPPVASPP 118

Query: 107 KP 102
            P
Sbjct: 119 PP 120

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 40/100 (40%), Positives = 45/100 (45%), Gaps = 6/100 (6%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTP 228
           P  PP  TP P   PP +  PP  +PP  TPP   P P TP P + P    P P P S P
Sbjct: 32  PVSPPPVTPPPVTPPPVS--PPPVSPPPVTPPPVSPPPVTPPPVTPPTPVAPPPVPPSPP 89

Query: 227 STAPTPS--TAGSP----PAPTPDSLGPGPSGADTPPSPS 126
              PTP+  T   P    P+P P    P P    T P PS
Sbjct: 90  PPTPTPTPVTPSPPPPVTPSPPPPVASPPPPDVPTAPPPS 129

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 1/95 (1%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPT-ATPPAAVPAPATPAPASSPATSPPAPTPAST 231
           P  PP  TP P + PP   TPP  TPPT   PP   P+P  P P  +P T  P+P P  T
Sbjct: 52  PVSPPPVTPPPVSPPPV--TPPPVTPPTPVAPPPVPPSPPPPTPTPTPVT--PSPPPPVT 107

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           PS  P P  A  PP   P +  P  +    PPSPS
Sbjct: 108 PS--PPPPVASPPPPDVPTAPPPSNNPPSLPPSPS 140

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 42/116 (36%), Positives = 49/116 (42%), Gaps = 1/116 (0%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPA 237
           T  P  PP  TP P   P   A PP   PP+  PP   P P TP+P      SPP P  +
Sbjct: 59  TPPPVSPPPVTPPPVTPPTPVAPPP--VPPSPPPPTPTPTPVTPSPPPPVTPSPPPPVAS 116

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGPGPSGAD-TPPSPSAAFSYSKPIIAATALSAA 72
             P   PT      PP+  P SL P PS    +PP P  + S   P    T   A+
Sbjct: 117 PPPPDVPT----APPPSNNPPSLPPSPSNVPASPPPPRISLSPPPPPSTPTQSGAS 168

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 43/128 (33%), Positives = 59/128 (46%), Gaps = 7/128 (5%)
 Frame = -3

Query: 419 PTAAP--TKPPTATPAPTAQPPAAATPP----TATPPTATPPAAV-PAPATPAPASSPAT 261
           P + P  T PP   P P A PP   +PP    T TP T +PP  V P+P  P  +  P  
Sbjct: 62  PVSPPPVTPPPVTPPTPVAPPPVPPSPPPPTPTPTPVTPSPPPPVTPSPPPPVASPPPPD 121

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATAL 81
            P AP P++ P + P PS +  P +P P  +   P    + P+ S A S SK     T +
Sbjct: 122 VPTAPPPSNNPPSLP-PSPSNVPASPPPPRISLSPPPPPSTPTQSGASSGSKSSNNGTVV 180

Query: 80  SAALFAIA 57
           +  +   A
Sbjct: 181 AVGVAVAA 188

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 39/127 (30%), Positives = 54/127 (42%), Gaps = 4/127 (3%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP----APATPAPASSPATSP 255
           AP   P  PP  TP PT   P+   P T +PP   PP A P     P  P P+++P + P
Sbjct: 80  APPPVPPSPPPPTPTPTPVTPSPPPPVTPSPP---PPVASPPPPDVPTAPPPSNNPPSLP 136

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSA 75
             P+P++ P++ P P  + SPP P       G S      +     +    + A   L  
Sbjct: 137 --PSPSNVPASPPPPRISLSPPPPPSTPTQSGASSGSKSSNNGTVVAVGVAVAAVVVLGL 194

Query: 74  ALFAIAF 54
           A   I F
Sbjct: 195 AAGLIYF 201

[178][TOP]
>UniRef100_B4IX80 GH16849 n=1 Tax=Drosophila grimshawi RepID=B4IX80_DROGR
          Length = 382

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 49/114 (42%), Positives = 59/114 (51%), Gaps = 7/114 (6%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA---TPAPAS 273
           AT+  A   T APT  PT  P PTA P    TP  A  PTATP    P+P     P P +
Sbjct: 243 ATTTAAPTTTTAPT--PTFAPTPTATP---TTPIPAPTPTATPTTPTPSPTPTFAPTPTA 297

Query: 272 SPATSPPAPTPASTPST---APTPSTA-GSPPAPTPDSLGPGPSGADTPPSPSA 123
           +P T  PAPTP +TP+T   +PTP  A  +P AP      P P   + PP+P A
Sbjct: 298 TPTTPIPAPTPTATPTTPTPSPTPPPAPENPEAPEDPEAPPAPEDPEAPPAPEA 351

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 49/133 (36%), Positives = 57/133 (42%), Gaps = 10/133 (7%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPA-PTAQPPAAATPPTATP----- 330
           +A+  A   F       T+  A  PT APT  PTATP  P   P   ATP T TP     
Sbjct: 233 VATKPATCSFATTTAAPTTTTAPTPTFAPT--PTATPTTPIPAPTPTATPTTPTPSPTPT 290

Query: 329 ----PTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP 162
               PTATP   +PA   P P ++P T  P+PTP   P     P    +PPAP      P
Sbjct: 291 FAPTPTATPTTPIPA---PTPTATPTTPTPSPTPPPAPENPEAPEDPEAPPAPEDPEAPP 347

Query: 161 GPSGADTPPSPSA 123
            P     P  P A
Sbjct: 348 APEAPPAPEDPEA 360

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 48/117 (41%), Positives = 53/117 (45%), Gaps = 8/117 (6%)
 Frame = -3

Query: 428 AQAPTAAPTKP-----PTATPAPTAQP--PAAATPPTATPPTATP-PAAVPAPATPAPAS 273
           A  PTA PT P     PT  P PTA P  P  A  PTATP T TP P   PAP  P    
Sbjct: 273 APTPTATPTTPTPSPTPTFAPTPTATPTTPIPAPTPTATPTTPTPSPTPPPAPENPEAPE 332

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P  +PPAP     P   P P    +PPAP      P P   + PP+P    +  KP
Sbjct: 333 DP-EAPPAP---EDPEAPPAPE---APPAPEDPEAPPAPEDPEAPPAPEDPEAPRKP 382

[179][TOP]
>UniRef100_A4RII2 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea
           RepID=A4RII2_MAGGR
          Length = 504

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 49/117 (41%), Positives = 56/117 (47%), Gaps = 2/117 (1%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPA-SSPATSP 255
           A+AP  A  KP  A PAP   P  A   P   P  A P PA  PAPA PAP  S PA +P
Sbjct: 66  AKAPAKAAPKPAPAKPAPAPAPAPAKPAPAPAPAPAKPAPAPAPAPAKPAPVPSQPAAAP 125

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATA 84
             P P    +    P+ A   PAP+P      PS   T PS +AA S +    AATA
Sbjct: 126 AKPAPTQPAAAPAAPTKAAGTPAPSPSKPVVTPSSPATAPSKAAATSPAASSAAATA 182

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 53/121 (43%), Positives = 61/121 (50%), Gaps = 4/121 (3%)
 Frame = -3

Query: 428 AQAPTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
           A AP  AP KP P   PAP    PA A  P    P  + PAA  APA PAP + PA +P 
Sbjct: 82  APAPAPAPAKPAPAPAPAPAKPAPAPAPAPAKPAPVPSQPAA--APAKPAP-TQPAAAPA 138

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS-GADTPP--SPSAAFSYSKPIIAATAL 81
           APT A     A TP+ + S P  TP S    PS  A T P  S +AA + +KP   A A 
Sbjct: 139 APTKA-----AGTPAPSPSKPVVTPSSPATAPSKAAATSPAASSAAATAPAKPPTGALAP 193

Query: 80  S 78
           S
Sbjct: 194 S 194

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 50/164 (30%), Positives = 67/164 (40%), Gaps = 24/164 (14%)
 Frame = -3

Query: 491 MASSAAVQIFLILGLLATSCLAQAPTAAPT------------KPPTATPAPTAQPPAAAT 348
           M  S A  +F  +   A   + +AP  AP               P A  A    P A   
Sbjct: 1   MHFSLATLLFANVAAAAVLPVVRAPEPAPIILRAVTRRQIQPDEPAAAGAEHLVPRAKKA 60

Query: 347 PPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPS-TAPTPSTAGSPPAPTPDS 171
           P  A        A  PAPA PAPA +PA + PAP PA  P+  AP P+ A + PAP P  
Sbjct: 61  PAKAPAKAPAKAAPKPAPAKPAPAPAPAPAKPAPAPAPAPAKPAPAPAPAPAKPAPVPSQ 120

Query: 170 LGPGPS-----------GADTPPSPSAAFSYSKPIIAATALSAA 72
               P+            A T  + + A S SKP++  ++ + A
Sbjct: 121 PAAAPAKPAPTQPAAAPAAPTKAAGTPAPSPSKPVVTPSSPATA 164

[180][TOP]
>UniRef100_P41479 Uncharacterized 24.1 kDa protein in LEF4-P33 intergenic region n=1
           Tax=Autographa californica nucleopolyhedrovirus
           RepID=Y091_NPVAC
          Length = 224

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 50/136 (36%), Positives = 63/136 (46%), Gaps = 16/136 (11%)
 Frame = -3

Query: 419 PTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATP------------PAAVPAPATPAP 279
           PT+ P  P PT  P PT  PP+   PPT  PPT TP            P   P+P  P P
Sbjct: 43  PTSPPIVPLPTPPPTPTPSPPSPTPPPTPIPPTPTPTPPPTPIPPTPTPTPPPSPIPPTP 102

Query: 278 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG---PSGADTPPSPSAAFSYS 108
             SP  SP  PTP  +P  +P P T    P P+P  LG     PS  DT     A  ++ 
Sbjct: 103 TPSPPPSPIPPTPTPSPPPSPIPPTPTPSPPPSPSPLGEPMYYPSNIDT---NEALINFL 159

Query: 107 KPIIAATALSAALFAI 60
           +P + AT  + A +A+
Sbjct: 160 RP-LCATDRTRATYAV 174

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 42/105 (40%), Positives = 48/105 (45%), Gaps = 7/105 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTAT------PPTATP-PAAVPAPATPAPASSPAT 261
           P   P   P   P PT  P    +PP+ T      PPT TP P   P P TP P   P+ 
Sbjct: 38  PIVPPPTSPPIVPLPTPPPTPTPSPPSPTPPPTPIPPTPTPTPPPTPIPPTPTPTPPPSP 97

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            PP PTP+  PS  P   T   PP+P P +  P P     PPSPS
Sbjct: 98  IPPTPTPSPPPSPIPPTPTPSPPPSPIPPTPTPSP-----PPSPS 137

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 31/81 (38%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -3

Query: 362 PAAATPPTATP--PTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPP 189
           P    PPT+ P  P  TPP   P P+ P+P   P   PP PTP   P+  P   T   PP
Sbjct: 37  PPIVPPPTSPPIVPLPTPPPT-PTPSPPSPTPPPTPIPPTPTPTPPPTPIPPTPTPTPPP 95

Query: 188 APTPDSLGPGPSGADTPPSPS 126
           +P P +  P P  +  PP+P+
Sbjct: 96  SPIPPTPTPSPPPSPIPPTPT 116

[181][TOP]
>UniRef100_UPI0001B4102B Rhs element Vgr protein n=1 Tax=Burkholderia thailandensis E264
            RepID=UPI0001B4102B
          Length = 856

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 49/107 (45%), Positives = 59/107 (55%), Gaps = 7/107 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPA-TPAPASSPATSP- 255
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P  TP P  +P  +P 
Sbjct: 749  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT 808

Query: 254  PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
            P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+++
Sbjct: 809  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPT-PTPTPTPTPTPTPTSS 854

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 729  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 787

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 788  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 828

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 725  PTPEPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 783

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 784  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 824

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 48/105 (45%), Positives = 58/105 (55%), Gaps = 7/105 (6%)
 Frame = -3

Query: 419  PTAAPTKP-PTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP- 255
            PT  P +P PT  P PT +P    TP PT TP PT TP P   P P TP P  +P  +P 
Sbjct: 710  PTEVPPEPTPTPEPTPTPEPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPT 768

Query: 254  PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 769  PTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 810

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 48/112 (42%), Positives = 58/112 (51%), Gaps = 7/112 (6%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTK-PPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPAS 273
            T  +   P   PT+ PP  TP P   P    TP PT TP PT TP P   P P TP P  
Sbjct: 699  TKPILPPPPPPPTEVPPEPTPTPEPTPTPEPTPTPTPTPTPTPTPTPTPTPTP-TPTPTP 757

Query: 272  SPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            +P  +P P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 758  TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 806

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 37/95 (38%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP-ATPAPASSPATSP-PAPTPASTPS 225
           PP   P+          PP   PPT  PP   P P  TP P  +P  +P P PTP  TP+
Sbjct: 687 PPIPLPSFFLDITKPILPPPPPPPTEVPPEPTPTPEPTPTPEPTPTPTPTPTPTPTPTPT 746

Query: 224 TAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 747 PTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 778

[182][TOP]
>UniRef100_O39266 24 n=1 Tax=Equid herpesvirus 4 RepID=O39266_9ALPH
          Length = 3534

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 56/130 (43%), Positives = 68/130 (52%), Gaps = 11/130 (8%)
 Frame = -3

Query: 449  LLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA---- 282
            L A S  A AP  AP+KP  A PAP+    A A    A  P  + PAA PAP+ PA    
Sbjct: 2716 LTAPSKPAAAP--APSKP-AAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPA 2772

Query: 281  ---PASSPATSPPAPTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPS---GADTPPSPSA 123
               PA++PA S PA  PA S P+ AP PS   + PAP+  +  P PS    A  P  P+A
Sbjct: 2773 PSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAA 2832

Query: 122  AFSYSKPIIA 93
            A + SKP  A
Sbjct: 2833 APAPSKPAAA 2842

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 51/121 (42%), Positives = 62/121 (51%), Gaps = 12/121 (9%)
 Frame = -3

Query: 419  PTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA-------PASSPA 264
            P AAP    P A PAP+    A A    A  P  + PAA PAP+ PA       PA++PA
Sbjct: 2740 PAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPA 2799

Query: 263  TSPPAPTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPS---GADTPPSPSAAFSYSKPII 96
             S PA  PA S P+ AP PS   + PAP+  +  P PS    A  P  P+AA + SKP  
Sbjct: 2800 PSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAA 2859

Query: 95   A 93
            A
Sbjct: 2860 A 2860

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 51/121 (42%), Positives = 62/121 (51%), Gaps = 12/121 (9%)
 Frame = -3

Query: 419  PTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA-------PASSPA 264
            P AAP    P A PAP+    A A    A  P  + PAA PAP+ PA       PA++PA
Sbjct: 2749 PAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPA 2808

Query: 263  TSPPAPTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPS---GADTPPSPSAAFSYSKPII 96
             S PA  PA S P+ AP PS   + PAP+  +  P PS    A  P  P+AA + SKP  
Sbjct: 2809 PSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAA 2868

Query: 95   A 93
            A
Sbjct: 2869 A 2869

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 51/121 (42%), Positives = 62/121 (51%), Gaps = 12/121 (9%)
 Frame = -3

Query: 419  PTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA-------PASSPA 264
            P AAP    P A PAP+    A A    A  P  + PAA PAP+ PA       PA++PA
Sbjct: 2758 PAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPA 2817

Query: 263  TSPPAPTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPS---GADTPPSPSAAFSYSKPII 96
             S PA  PA S P+ AP PS   + PAP+  +  P PS    A  P  P+AA + SKP  
Sbjct: 2818 PSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAA 2877

Query: 95   A 93
            A
Sbjct: 2878 A 2878

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 51/121 (42%), Positives = 62/121 (51%), Gaps = 12/121 (9%)
 Frame = -3

Query: 419  PTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA-------PASSPA 264
            P AAP    P A PAP+    A A    A  P  + PAA PAP+ PA       PA++PA
Sbjct: 2767 PAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPA 2826

Query: 263  TSPPAPTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPS---GADTPPSPSAAFSYSKPII 96
             S PA  PA S P+ AP PS   + PAP+  +  P PS    A  P  P+AA + SKP  
Sbjct: 2827 PSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAA 2886

Query: 95   A 93
            A
Sbjct: 2887 A 2887

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 51/121 (42%), Positives = 62/121 (51%), Gaps = 12/121 (9%)
 Frame = -3

Query: 419  PTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA-------PASSPA 264
            P AAP    P A PAP+    A A    A  P  + PAA PAP+ PA       PA++PA
Sbjct: 2776 PAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPA 2835

Query: 263  TSPPAPTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPS---GADTPPSPSAAFSYSKPII 96
             S PA  PA S P+ AP PS   + PAP+  +  P PS    A  P  P+AA + SKP  
Sbjct: 2836 PSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAA 2895

Query: 95   A 93
            A
Sbjct: 2896 A 2896

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 51/121 (42%), Positives = 62/121 (51%), Gaps = 12/121 (9%)
 Frame = -3

Query: 419  PTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA-------PASSPA 264
            P AAP    P A PAP+    A A    A  P  + PAA PAP+ PA       PA++PA
Sbjct: 2785 PAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPA 2844

Query: 263  TSPPAPTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPS---GADTPPSPSAAFSYSKPII 96
             S PA  PA S P+ AP PS   + PAP+  +  P PS    A  P  P+AA + SKP  
Sbjct: 2845 PSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAA 2904

Query: 95   A 93
            A
Sbjct: 2905 A 2905

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 52/127 (40%), Positives = 64/127 (50%), Gaps = 12/127 (9%)
 Frame = -3

Query: 419  PTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA-------PASSPA 264
            P AAP    P A PAP+    A A    A  P  + PAA PAP+ PA       PA++PA
Sbjct: 2794 PAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPA 2853

Query: 263  TSPPAPTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPS---GADTPPSPSAAFSYSKPII 96
             S PA  PA S P+ AP PS   + PAP+  +  P PS    A  P  P+AA + SKP  
Sbjct: 2854 PSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPQN 2913

Query: 95   AATALSA 75
               A+ A
Sbjct: 2914 TLVAIVA 2920

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 51/122 (41%), Positives = 64/122 (52%), Gaps = 11/122 (9%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPA-------PASSP 267
            +A   AP+KP  A PAP+    A A    A  P  + PAA PAP+ PA       PA++P
Sbjct: 2713 EALLTAPSKP-AAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAP 2771

Query: 266  ATSPPAPTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPS---GADTPPSPSAAFSYSKPI 99
            A S PA  PA S P+ AP PS   + PAP+  +  P PS    A  P  P+AA + SKP 
Sbjct: 2772 APSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPA 2831

Query: 98   IA 93
             A
Sbjct: 2832 AA 2833

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 46/125 (36%), Positives = 59/125 (47%), Gaps = 20/125 (16%)
 Frame = -3

Query: 407  PTKPPTATPAPTAQPPAAATPPTATPP---------TATPPAAVPAPATPA-------PA 276
            P+  P+  P     PP  + P    PP           + PAA PAP+ PA       PA
Sbjct: 2682 PSIRPSLGPFKFTAPPGYSIPMDGLPPPDPNEALLTAPSKPAAAPAPSKPAAAPAPSKPA 2741

Query: 275  SSPATSPPAPTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPS---GADTPPSPSAAFSYS 108
            ++PA S PA  PA S P+ AP PS   + PAP+  +  P PS    A  P  P+AA + S
Sbjct: 2742 AAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPSKPAAAPAPS 2801

Query: 107  KPIIA 93
            KP  A
Sbjct: 2802 KPAAA 2806

[183][TOP]
>UniRef100_Q3JI33 Rhs element Vgr protein n=1 Tax=Burkholderia pseudomallei 1710b
            RepID=Q3JI33_BURP1
          Length = 858

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 49/107 (45%), Positives = 59/107 (55%), Gaps = 7/107 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPA-TPAPASSPATSP- 255
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P  TP P  +P  +P 
Sbjct: 753  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT 812

Query: 254  PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
            P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+++
Sbjct: 813  PTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPTSS 856

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 733  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 791

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 792  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 832

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 49/112 (43%), Positives = 59/112 (52%), Gaps = 7/112 (6%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTK-PPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPAS 273
            T  +   P   PT+ PP  TP PT  P    TP PT TP PT TP P   P P TP P  
Sbjct: 715  TKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTP 773

Query: 272  SPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            +P  +P P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 774  TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 822

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 37/94 (39%), Positives = 46/94 (48%), Gaps = 3/94 (3%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAPTPASTPST 222
           PP   P+          PP   PPT  PP   P P TP P  +P  +P P PTP  TP+ 
Sbjct: 703 PPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 761

Query: 221 APTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 762 TPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 792

[184][TOP]
>UniRef100_Q2T918 Rhs element Vgr protein n=1 Tax=Burkholderia thailandensis E264
            RepID=Q2T918_BURTA
          Length = 872

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 49/107 (45%), Positives = 59/107 (55%), Gaps = 7/107 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPA-TPAPASSPATSP- 255
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P  TP P  +P  +P 
Sbjct: 765  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT 824

Query: 254  PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
            P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+++
Sbjct: 825  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPT-PTPTPTPTPTPTPTSS 870

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 745  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 803

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 804  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 844

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 741  PTPEPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 799

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 800  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 840

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 48/105 (45%), Positives = 58/105 (55%), Gaps = 7/105 (6%)
 Frame = -3

Query: 419  PTAAPTKP-PTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP- 255
            PT  P +P PT  P PT +P    TP PT TP PT TP P   P P TP P  +P  +P 
Sbjct: 726  PTEVPPEPTPTPEPTPTPEPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPT 784

Query: 254  PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 785  PTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 826

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 48/112 (42%), Positives = 58/112 (51%), Gaps = 7/112 (6%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTK-PPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPAS 273
            T  +   P   PT+ PP  TP P   P    TP PT TP PT TP P   P P TP P  
Sbjct: 715  TKPILPPPPPPPTEVPPEPTPTPEPTPTPEPTPTPTPTPTPTPTPTPTPTPTP-TPTPTP 773

Query: 272  SPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            +P  +P P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 774  TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 822

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 37/95 (38%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP-ATPAPASSPATSP-PAPTPASTPS 225
           PP   P+          PP   PPT  PP   P P  TP P  +P  +P P PTP  TP+
Sbjct: 703 PPIPLPSFFLDITKPILPPPPPPPTEVPPEPTPTPEPTPTPEPTPTPTPTPTPTPTPTPT 762

Query: 224 TAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 763 PTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 794

[185][TOP]
>UniRef100_A3NFQ1 Rhs element Vgr protein n=1 Tax=Burkholderia pseudomallei 668
            RepID=A3NFQ1_BURP6
          Length = 930

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 49/106 (46%), Positives = 59/106 (55%), Gaps = 6/106 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 827  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 885

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+++
Sbjct: 886  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPTSS 928

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 733  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 791

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 792  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 832

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 753  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 811

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 812  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 852

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 773  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 831

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 832  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 872

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 793  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 851

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 852  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 892

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 813  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 871

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 872  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 912

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 49/112 (43%), Positives = 59/112 (52%), Gaps = 7/112 (6%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTK-PPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPAS 273
            T  +   P   PT+ PP  TP PT  P    TP PT TP PT TP P   P P TP P  
Sbjct: 715  TKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTP 773

Query: 272  SPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            +P  +P P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 774  TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 822

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 37/94 (39%), Positives = 46/94 (48%), Gaps = 3/94 (3%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAPTPASTPST 222
           PP   P+          PP   PPT  PP   P P TP P  +P  +P P PTP  TP+ 
Sbjct: 703 PPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 761

Query: 221 APTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 762 TPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 792

[186][TOP]
>UniRef100_A3P1H6 Rhs element Vgr protein n=2 Tax=Burkholderia pseudomallei
            RepID=A3P1H6_BURP0
          Length = 896

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 49/106 (46%), Positives = 59/106 (55%), Gaps = 6/106 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 793  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 851

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+++
Sbjct: 852  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPTSS 894

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 733  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 791

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 792  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 832

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 753  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 811

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 812  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 852

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 773  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 831

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 832  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 872

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 49/112 (43%), Positives = 59/112 (52%), Gaps = 7/112 (6%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTK-PPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPAS 273
            T  +   P   PT+ PP  TP PT  P    TP PT TP PT TP P   P P TP P  
Sbjct: 715  TKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTP 773

Query: 272  SPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            +P  +P P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 774  TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 822

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 37/94 (39%), Positives = 46/94 (48%), Gaps = 3/94 (3%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAPTPASTPST 222
           PP   P+          PP   PPT  PP   P P TP P  +P  +P P PTP  TP+ 
Sbjct: 703 PPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 761

Query: 221 APTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 762 TPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 792

[187][TOP]
>UniRef100_C4I5F4 Rhs element Vgr protein n=1 Tax=Burkholderia pseudomallei MSHR346
            RepID=C4I5F4_BURPS
          Length = 860

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 49/107 (45%), Positives = 59/107 (55%), Gaps = 7/107 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPA-TPAPASSPATSP- 255
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P  TP P  +P  +P 
Sbjct: 753  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT 812

Query: 254  PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
            P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+++
Sbjct: 813  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPT-PTPTPTPTPTPTPTSS 858

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 733  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 791

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 792  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 832

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 49/112 (43%), Positives = 59/112 (52%), Gaps = 7/112 (6%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTK-PPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPAS 273
            T  +   P   PT+ PP  TP PT  P    TP PT TP PT TP P   P P TP P  
Sbjct: 715  TKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTP 773

Query: 272  SPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            +P  +P P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 774  TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 822

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 37/94 (39%), Positives = 46/94 (48%), Gaps = 3/94 (3%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAPTPASTPST 222
           PP   P+          PP   PPT  PP   P P TP P  +P  +P P PTP  TP+ 
Sbjct: 703 PPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 761

Query: 221 APTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 762 TPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 792

[188][TOP]
>UniRef100_C2BJ30 Fe-S oxidoreductase n=1 Tax=Corynebacterium pseudogenitalium ATCC
            33035 RepID=C2BJ30_9CORY
          Length = 969

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 56/157 (35%), Positives = 75/157 (47%), Gaps = 24/157 (15%)
 Frame = -3

Query: 500  HPKMASSAAVQIFLILGLLATSCLAQAPTA-APTKP---------PTATPAPTAQPPAAA 351
            HPK   +  V+     G    + LA APT+ AP+ P         P+   AP A  P+A 
Sbjct: 682  HPKAFLATPVRHHKSAGTNNEAPLANAPTSVAPSAPAPSASAPAAPSTPAAPAAPAPSAP 741

Query: 350  TPPTATPPTATP-----PAAVPAPATPAPASSPAT----SPPAPTPASTPS-----TAPT 213
            + P+A  P A P     PAA  AP+ P P S+PAT    +P APTP S P+      AP 
Sbjct: 742  SAPSAPTPPAAPQAPQAPAAPAAPSAPTPPSAPATPAPKAPAAPTPPSAPAAPVAPAAPA 801

Query: 212  PSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            PS   +P  PTP +    P+    P +P+A  + S P
Sbjct: 802  PSAPPAPSTPTPHAAPAAPTPPSAPAAPAAPAAPSAP 838

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 51/127 (40%), Positives = 68/127 (53%), Gaps = 8/127 (6%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATPPTA----TPPTATPPAAVPAPATPAPASSPA- 264
            A A  +APT PP+A   P  + PAA TPP+A      P A  P+A PAP+TP P ++PA 
Sbjct: 761  APAAPSAPT-PPSAPATPAPKAPAAPTPPSAPAAPVAPAAPAPSAPPAPSTPTPHAAPAA 819

Query: 263  -TSPPAPTPASTPS--TAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
             T P AP   + P+  +APTP +A + PAP   S  P    A  P +PSA  + + P   
Sbjct: 820  PTPPSAPAAPAAPAAPSAPTPPSAPAAPAPKAPS-APAAPAAPAPSAPSAPSAPTPPAAP 878

Query: 92   ATALSAA 72
             T  + A
Sbjct: 879  QTPQAPA 885

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 48/118 (40%), Positives = 60/118 (50%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
            QAP AAP  P   TP      PA   P   TPP+A  PAA  APA PAP++ PA  P  P
Sbjct: 757  QAP-AAPAAPSAPTPPSAPATPAPKAPAAPTPPSA--PAAPVAPAAPAPSAPPA--PSTP 811

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
            TP + P+ APTP +A + PA       P P  A   P+P A  + + P   A +  +A
Sbjct: 812  TPHAAPA-APTPPSAPAAPAAPAAPSAPTPPSAPAAPAPKAPSAPAAPAAPAPSAPSA 868

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/117 (40%), Positives = 58/117 (49%), Gaps = 8/117 (6%)
 Frame = -3

Query: 428  AQAPTAAPTKPPT-ATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPA------PAS 273
            A  P +AP  P   A PAP+A PPA +TP P A P   TPP+A  APA PA      P S
Sbjct: 784  APTPPSAPAAPVAPAAPAPSA-PPAPSTPTPHAAPAAPTPPSAPAAPAAPAAPSAPTPPS 842

Query: 272  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            +PA   P    A     AP PS   +P APTP +    P     P +P+A  + + P
Sbjct: 843  APAAPAPKAPSAPAAPAAPAPSAPSAPSAPTPPAAPQTPQAPAAPAAPAAPSAPTPP 899

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 51/126 (40%), Positives = 63/126 (50%), Gaps = 19/126 (15%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP--------PAAVPAPATPAPASSP 267
            AP A   K P+A  AP A  P+A + P+A  P A P        PAA  AP+ P P S+P
Sbjct: 843  APAAPAPKAPSAPAAPAAPAPSAPSAPSAPTPPAAPQTPQAPAAPAAPAAPSAPTPPSAP 902

Query: 266  AT----SPPAPTPASTPST--APTPSTAGSPP-APT----PDSLGPGPSGADTPPSPSAA 120
            A     +P APTP + P+   APTP  A  PP AP     P +  P P  A   P+P A+
Sbjct: 903  AAPAPKAPAAPTPPNVPAAPAAPTPPAAPKPPQAPAAPKPPQAAPPAPPAA---PAPPAS 959

Query: 119  FSYSKP 102
             S  KP
Sbjct: 960  ESVPKP 965

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 47/114 (41%), Positives = 60/114 (52%), Gaps = 4/114 (3%)
 Frame = -3

Query: 419  PTAAPTKP-PTATPAPTAQP--PAAATPPTATPPTATPPAAVPAPATP-APASSPATSPP 252
            P AAP  P P + PA  A P  P+A TPP+A  P A  P A  APA P APA S  ++P 
Sbjct: 813  PHAAPAAPTPPSAPAAPAAPAAPSAPTPPSA--PAAPAPKAPSAPAAPAAPAPSAPSAPS 870

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAA 90
            APTP + P T   P+   +P AP+     P P  A   P+P A  + + P + A
Sbjct: 871  APTPPAAPQTPQAPAAPAAPAAPS----APTPPSAPAAPAPKAPAAPTPPNVPA 920

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 52/123 (42%), Positives = 63/123 (51%), Gaps = 6/123 (4%)
 Frame = -3

Query: 422  APTA--APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT---- 261
            AP+A  APT PP A  AP A P A A P   TPP+A    A  APA P P S+PA     
Sbjct: 740  APSAPSAPT-PPAAPQAPQA-PAAPAAPSAPTPPSAPATPAPKAPAAPTPPSAPAAPVAP 797

Query: 260  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATAL 81
            + PAP+    PST PTP  A  P APTP S    P+    P +P+   + + P   A + 
Sbjct: 798  AAPAPSAPPAPST-PTPHAA--PAAPTPPSAPAAPAAPAAPSAPTPPSAPAAPAPKAPSA 854

Query: 80   SAA 72
             AA
Sbjct: 855  PAA 857

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 44/102 (43%), Positives = 50/102 (49%), Gaps = 1/102 (0%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTA-TPPAAVPAPATPAPASSPATSPPAP 246
            AP A  T  P A PA    P A A P     P+A TPP+A  APA  AP++  A + PAP
Sbjct: 804  APPAPSTPTPHAAPAAPTPPSAPAAPAAPAAPSAPTPPSAPAAPAPKAPSAPAAPAAPAP 863

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            +  S PS APTP  A   P        P    A TPPS  AA
Sbjct: 864  SAPSAPS-APTPPAAPQTPQAPAAPAAPAAPSAPTPPSAPAA 904

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 50/122 (40%), Positives = 64/122 (52%), Gaps = 9/122 (7%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTA-------TPPAAVPAPATPAPASS 270
            A A  +APT PP+A  AP  + P+A   P A  P+A       TPPAA   P  PA  ++
Sbjct: 831  APAAPSAPT-PPSAPAAPAPKAPSAPAAPAAPAPSAPSAPSAPTPPAAPQTPQAPAAPAA 889

Query: 269  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP--PSPSAAFSYSKPII 96
            PA +P APTP S P+ AP P    +P APTP ++   P+    P  P P  A +  KP  
Sbjct: 890  PA-APSAPTPPSAPA-APAPK---APAAPTPPNVPAAPAAPTPPAAPKPPQAPAAPKPPQ 944

Query: 95   AA 90
            AA
Sbjct: 945  AA 946

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 43/109 (39%), Positives = 53/109 (48%), Gaps = 6/109 (5%)
 Frame = -3

Query: 428  AQAPTAAPTKP--PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP 255
            A  P +AP  P  P A  APT  PP+A   P    P+A    A PAP+ P+  S+P T P
Sbjct: 819  APTPPSAPAAPAAPAAPSAPT--PPSAPAAPAPKAPSAPAAPAAPAPSAPSAPSAP-TPP 875

Query: 254  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS----GADTPPSPSAA 120
             AP    TP     P+   +P APTP S    P+     A TPP+  AA
Sbjct: 876  AAP---QTPQAPAAPAAPAAPSAPTPPSAPAAPAPKAPAAPTPPNVPAA 921

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATPPT--ATPPTATPPAAVPAPATPAPASSPATSP 255
            A A  +APT PP+A  AP  + PAA TPP   A P   TPPAA   P  PA    P  +P
Sbjct: 889  APAAPSAPT-PPSAPAAPAPKAPAAPTPPNVPAAPAAPTPPAAPKPPQAPAAPKPPQAAP 947

Query: 254  PAPTPASTPSTAPTPSTAGSPPAPTPDS 171
            PAP PA     AP P  + S P P P+S
Sbjct: 948  PAP-PA-----APAPPASESVPKP-PES 968

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 43/109 (39%), Positives = 50/109 (45%), Gaps = 9/109 (8%)
 Frame = -3

Query: 428  AQAPTAAPTKP--PTATPAPTAQPPAAATPPTA-------TPPTATPPAAVPAPATPAPA 276
            A  P AAP  P  P A  AP A  P+A TPP+A        P   TPP    APA P P 
Sbjct: 871  APTPPAAPQTPQAPAAPAAPAA--PSAPTPPSAPAAPAPKAPAAPTPPNVPAAPAAPTP- 927

Query: 275  SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
                  P AP P   P+ AP P  A +PPAP      P P  +++ P P
Sbjct: 928  ------PAAPKPPQAPA-APKPPQA-APPAP---PAAPAPPASESVPKP 965

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 40/120 (33%), Positives = 54/120 (45%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
            L ++ T     P      P     +A T   A  P A  P +V AP+ PAP++S   +P 
Sbjct: 672  LDESGTLPEPHPKAFLATPVRHHKSAGTNNEA--PLANAPTSV-APSAPAPSAS---APA 725

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
            AP+  + P+ AP PS   +P APTP +    P     P +PSA    S P   A    AA
Sbjct: 726  APSTPAAPA-APAPSAPSAPSAPTPPAAPQAPQAPAAPAAPSAPTPPSAPATPAPKAPAA 784

[189][TOP]
>UniRef100_C0YC76 Rhs element Vgr protein n=5 Tax=Burkholderia pseudomallei
            RepID=C0YC76_BURPS
          Length = 844

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 49/107 (45%), Positives = 59/107 (55%), Gaps = 7/107 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPA-TPAPASSPATSP- 255
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P  TP P  +P  +P 
Sbjct: 737  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT 796

Query: 254  PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
            P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+++
Sbjct: 797  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPT-PTPTPTPTPTPTPTSS 842

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 717  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 775

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 776  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 816

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 49/112 (43%), Positives = 59/112 (52%), Gaps = 7/112 (6%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTK-PPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPAS 273
            T  +   P   PT+ PP  TP PT  P    TP PT TP PT TP P   P P TP P  
Sbjct: 699  TKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTP 757

Query: 272  SPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            +P  +P P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 758  TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 806

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 37/94 (39%), Positives = 46/94 (48%), Gaps = 3/94 (3%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAPTPASTPST 222
           PP   P+          PP   PPT  PP   P P TP P  +P  +P P PTP  TP+ 
Sbjct: 687 PPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 745

Query: 221 APTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 746 TPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 776

[190][TOP]
>UniRef100_B7CT47 Rhs element Vgr protein n=1 Tax=Burkholderia pseudomallei 576
            RepID=B7CT47_BURPS
          Length = 872

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 49/106 (46%), Positives = 59/106 (55%), Gaps = 6/106 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 769  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 827

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+++
Sbjct: 828  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPTSS 870

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 733  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 791

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 792  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 832

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 753  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 811

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 812  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 852

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 49/112 (43%), Positives = 59/112 (52%), Gaps = 7/112 (6%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTK-PPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPAS 273
            T  +   P   PT+ PP  TP PT  P    TP PT TP PT TP P   P P TP P  
Sbjct: 715  TKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTP 773

Query: 272  SPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            +P  +P P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 774  TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 822

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 37/94 (39%), Positives = 46/94 (48%), Gaps = 3/94 (3%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAPTPASTPST 222
           PP   P+          PP   PPT  PP   P P TP P  +P  +P P PTP  TP+ 
Sbjct: 703 PPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 761

Query: 221 APTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 762 TPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 792

[191][TOP]
>UniRef100_B1HC61 Rhs element Vgr protein n=1 Tax=Burkholderia pseudomallei S13
            RepID=B1HC61_BURPS
          Length = 878

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 49/107 (45%), Positives = 59/107 (55%), Gaps = 7/107 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPA-TPAPASSPATSP- 255
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P  TP P  +P  +P 
Sbjct: 773  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT 832

Query: 254  PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
            P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+++
Sbjct: 833  PTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPTSS 876

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 733  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 791

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 792  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 832

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 753  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 811

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 812  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 852

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 49/112 (43%), Positives = 59/112 (52%), Gaps = 7/112 (6%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTK-PPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPAS 273
            T  +   P   PT+ PP  TP PT  P    TP PT TP PT TP P   P P TP P  
Sbjct: 715  TKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTP 773

Query: 272  SPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            +P  +P P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 774  TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 822

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 37/94 (39%), Positives = 46/94 (48%), Gaps = 3/94 (3%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAPTPASTPST 222
           PP   P+          PP   PPT  PP   P P TP P  +P  +P P PTP  TP+ 
Sbjct: 703 PPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 761

Query: 221 APTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 762 TPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 792

[192][TOP]
>UniRef100_A4LM22 Rhs element Vgr protein n=1 Tax=Burkholderia pseudomallei 305
            RepID=A4LM22_BURPS
          Length = 868

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 49/106 (46%), Positives = 59/106 (55%), Gaps = 6/106 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 765  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 823

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+++
Sbjct: 824  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPTSS 866

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 733  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 791

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 792  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 832

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 753  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 811

Query: 251  APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 812  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 852

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 49/112 (43%), Positives = 59/112 (52%), Gaps = 7/112 (6%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTK-PPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPAS 273
            T  +   P   PT+ PP  TP PT  P    TP PT TP PT TP P   P P TP P  
Sbjct: 715  TKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTP 773

Query: 272  SPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            +P  +P P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 774  TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 822

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 37/94 (39%), Positives = 46/94 (48%), Gaps = 3/94 (3%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAPTPASTPST 222
           PP   P+          PP   PPT  PP   P P TP P  +P  +P P PTP  TP+ 
Sbjct: 703 PPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 761

Query: 221 APTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 762 TPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 792

[193][TOP]
>UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f.
           nagariensis RepID=Q9SBM1_VOLCA
          Length = 409

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 40/97 (41%), Positives = 50/97 (51%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP   P P   PP    PP+ +PP + PP+  P+P  P+P  SP  SPP P+P
Sbjct: 123 PSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSP-PPSPPPSPPPSPP-PSP 180

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             +P   P PS   SPP   P S  P P  +  PPSP
Sbjct: 181 PPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSP 217

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 38/97 (39%), Positives = 43/97 (44%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P  PP   P P   PP    PP   PP+  PP   P P  P P   P   PP+P+P
Sbjct: 93  PPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSP 152

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             +P  +P PS   SPP   P S  P P     PPSP
Sbjct: 153 PPSPPPSPPPSPPPSPPPSPPPSPPPSP-----PPSP 184

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 39/99 (39%), Positives = 45/99 (45%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P  +P  PP   P P   PP    PP   PP   PP   P P+   P S P + PP+P P
Sbjct: 107 PPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPP 166

Query: 239 ASTPS--TAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           +  PS   +P PS   SPP   P S  P P     PPSP
Sbjct: 167 SPPPSPPPSPPPSPPPSPPPRPPPSPPPSPP-PSPPPSP 204

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 43/107 (40%), Positives = 49/107 (45%), Gaps = 1/107 (0%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS-SPATSPPAPT 243
           P   P  PP+  P P   PP   +PP   PP   PP   P P  P P S SP  SPP P+
Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPP-PS 159

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           P  +P  +P PS   SPP   P S  P P     PPSP  +   S P
Sbjct: 160 PPPSPPPSPPPSPPPSPPPSPPPSPPPRPP-PSPPPSPPPSPPPSPP 205

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTA--TPPTATPPAAVPAPATPAPASSPATSPPAP 246
           P   P  PP   P P   PP+ + PP+   +PP + PP+  P+P    P S P + PP P
Sbjct: 129 PPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRP 188

Query: 245 TPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPSP 129
            P+  PS  P+P  +  P P P+P+   P P  + +PPSP
Sbjct: 189 PPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPP-SPSPPSP 227

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 36/98 (36%), Positives = 50/98 (51%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P+ PP+  P+P  +PP +  PP+  PP+ +PP+  P P  P P   P+  PP P P
Sbjct: 190 PSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRP-PFPPPSPPPPRPPP 248

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            + P   P P +   PP P P S  P      +PP PS
Sbjct: 249 PAPPPPRPPPPSP-PPPLPPPPSPPPPLPPPPSPPPPS 285

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 38/101 (37%), Positives = 42/101 (41%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
           L  +P+  P  PP   P P   PP    P    PP   PP     P  P P   P  +PP
Sbjct: 81  LPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPP 140

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P P   PS +P PS   SPP   P S  P P     PPSP
Sbjct: 141 PPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSP 180

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 36/98 (36%), Positives = 42/98 (42%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           PT +  + P   P P   PP    PP+ +PP   PP   P P  P P   P + PP P P
Sbjct: 58  PTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPP 117

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              P  +P P     PP P P    P P     PPSPS
Sbjct: 118 PPPPPPSPPP----PPPPPPPPPPNPPPPPPPPPPSPS 151

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 36/106 (33%), Positives = 41/106 (38%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P  PP   P P +  P    PP   PP   PP   P P+ P P   P   PP+P P
Sbjct: 68  PPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPP 127

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
              P   P P+    PP P P    P       PPSP  +   S P
Sbjct: 128 PPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPP 173

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 34/92 (36%), Positives = 47/92 (51%), Gaps = 1/92 (1%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAST 231
           P  PP  +P+P   PP +  P P  +PP + PP+  P+P    P   P + PP+P P+  
Sbjct: 142 PPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPP 201

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           PS  P P  + +PP+P P S  P P     PP
Sbjct: 202 PSPPPRPPPSPNPPSPRPPS--PSPPSPRPPP 231

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 40/106 (37%), Positives = 46/106 (43%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P  PP     P   PP    PP+  PP   PP   P P  P P   P+ SPP P+P
Sbjct: 98  PPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPP-PSP 156

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
             +P  +P PS   SPP   P S  P P     PPSP  +   S P
Sbjct: 157 PPSPPPSPPPSPPPSPPPSPPPSPPPSPP-PRPPPSPPPSPPPSPP 201

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 38/102 (37%), Positives = 42/102 (41%), Gaps = 1/102 (0%)
 Frame = -3

Query: 431 LAQAPTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP 255
           L + P A P   PP  TP P   PP  + P    PP   PP     P  P+P+  P   P
Sbjct: 34  LVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPP 93

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P P P   P   P P    SPP P P    P PS    PP P
Sbjct: 94  PVPPPPPPPPPPPPPP---SPPPPPPPPPPPPPSPPPPPPPP 132

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 37/106 (34%), Positives = 43/106 (40%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P  PP+ +P P   PP    PP   PP   PP   P P  P P   P + PP P P
Sbjct: 75  PPPQPPLPPSPSPPPPPPPPVPPPPPPPPPP---PPPPSPPPPPPPPPPPPPSPPPPPPP 131

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
              P   P P     PP+P+P    P       PPSP  +   S P
Sbjct: 132 PPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPP 177

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 37/116 (31%), Positives = 44/116 (37%), Gaps = 6/116 (5%)
 Frame = -3

Query: 458 ILGLLATSCLAQAPTAAPTKPPTATPAPTAQ------PPAAATPPTATPPTATPPAAVPA 297
           ++ L+ T       +  P  PP   P PT        PP    PP   PP    P+  P 
Sbjct: 31  VVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPP 90

Query: 296 PATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P  P P   P   PP P P+  P   P P    SPP P P    P P+    PP P
Sbjct: 91  PPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPP 146

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 36/106 (33%), Positives = 50/106 (47%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P   PP +  PP+  PP+  PP+  P P  P+P ++P   PP P P
Sbjct: 259 PSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPS--PRPPKPSPPNNPFPRPPPPNP 316

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
                  P+P+    PP P+P    P P   + P  P  + S  KP
Sbjct: 317 PPPRPPPPSPNPP-RPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKP 361

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 34/95 (35%), Positives = 38/95 (40%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P  PP   P P    P + +PP   PP   PP   P P  P P+  P   PP P P
Sbjct: 63  PEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPP 122

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
            S P   P P      P P P    P PS   +PP
Sbjct: 123 PSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPP 157

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 35/96 (36%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P  +P+ PP+  P+P   PP +  PP  +PP + PP+  P+P    P S P + PP+P P
Sbjct: 146 PPPSPSPPPSPPPSPPPSPPPSP-PP--SPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPP 202

Query: 239 ASTPSTAPTPS-TAGSPPAPTPDSLGPGPSGADTPP 135
           +  P   P+P+  +  PP+P+P S  P P     PP
Sbjct: 203 SPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPP 238

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 36/99 (36%), Positives = 50/99 (50%), Gaps = 1/99 (1%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           +P+  P+ PP+  P+P   PP +  P P  +PP + PP   P+P    P S P + PP P
Sbjct: 149 SPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRP 208

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P+  P +   PS   SPP+P P    P P    +PP P
Sbjct: 209 PPSPNPPSPRPPSP--SPPSPRPPPRRP-PFPPPSPPPP 244

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 40/106 (37%), Positives = 48/106 (45%), Gaps = 5/106 (4%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP---PAAVPAPATPAPASSPAT 261
           L   P+  P  PP  +P P + PP +  PP+  PP  +P   P   P P  P P   P  
Sbjct: 265 LPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPP 324

Query: 260 S--PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           S  PP P P S P   P P +  +PP P P S  P P     PPSP
Sbjct: 325 SPNPPRPPPPSPPPPRPPPPSP-NPPRPPPPS--PSPPKPPPPPSP 367

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 38/97 (39%), Positives = 48/97 (49%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P + P +PP +   P+ +PP+ + PP+  PP   PP   P+P  P P   PA  PP P P
Sbjct: 201 PPSPPPRPPPSPNPPSPRPPSPS-PPSPRPPPRRPPFPPPSPPPPRP-PPPAPPPPRPPP 258

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            S P   P P    SPP P P    P P  +  PPSP
Sbjct: 259 PSPPPPLPPPP---SPPPPLPPPPSP-PPPSPPPPSP 291

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 38/104 (36%), Positives = 47/104 (45%), Gaps = 7/104 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP----- 255
           P+  P +PP   P P   PP +  PP   PP+  PP  +P P +P P S P  SP     
Sbjct: 239 PSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPP--LPPPPSPPPPSPPPPSPLPPSP 296

Query: 254 --PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             P P+P + P   P P    +PP P P    P P     PPSP
Sbjct: 297 RPPKPSPPNNPFPRPPPP---NPPPPRPPPPSPNPP-RPPPPSP 336

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 33/98 (33%), Positives = 46/98 (46%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           P+  P+ PP+  P+P   PP +  P P  +PP   PP+  P+P    P S P   PP+P 
Sbjct: 154 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPN 213

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P S    +P+P +   PP   P      P     PP+P
Sbjct: 214 PPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAP 251

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           P+  P+ PP+  P+P  +PP +  P P  +PP + PP   P+P  P+P   P+ SPP+P 
Sbjct: 170 PSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRP-PSPSPPSPR 228

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P   P   P P  +  PP P P +  P      +PP P
Sbjct: 229 P--PPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPP 264

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 37/115 (32%), Positives = 43/115 (37%)
 Frame = -3

Query: 473 VQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP 294
           V + L+L     +  A A    P + P      T   P   +PP  TPP   PP     P
Sbjct: 4   VALLLLLASSPHALGAPARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGP 63

Query: 293 ATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             P P   P   PP P    +PS  P P     PP P P    P PS    PP P
Sbjct: 64  EHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPP 118

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 32/96 (33%), Positives = 44/96 (45%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           +P   P +PP   P+P    P    PP   PP  +PP  +P P +P P   P  SPP P+
Sbjct: 226 SPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPS 285

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           P   P  +P P +   P    P++  P P   + PP
Sbjct: 286 P---PPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPP 318

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 36/100 (36%), Positives = 50/100 (50%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPA-PATPAPASSPATSPPAP 246
           P+  P+ PP+  P+P   PP +  P P   PP + PP+  P+ P +P P   P+ +PP+P
Sbjct: 158 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSP 217

Query: 245 TPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPSP 129
            P S    +P P     P P P+P    P P  A  PP P
Sbjct: 218 RPPSPSPPSPRPPPRRPPFPPPSPPPPRP-PPPAPPPPRP 256

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 36/95 (37%), Positives = 43/95 (45%)
 Frame = -3

Query: 410 APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAST 231
           +P  PP   P P   PP    PP A PP   PP + P P  P P S P   PP P P S 
Sbjct: 226 SPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPS-PPPPLPPPPSPP---PPLPPPPSP 281

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P  +P P +   PP+P P    P  +    PP P+
Sbjct: 282 PPPSPPPPSP-LPPSPRPPKPSPPNNPFPRPPPPN 315

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 42/129 (32%), Positives = 51/129 (39%), Gaps = 15/129 (11%)
 Frame = -3

Query: 470 QIFLILGLLATSCLAQAPTAAPTKPPTATPA------PTAQPPAA---ATPPTATPPTA- 321
           ++ L+L L ++     AP   P  PP  +P       P A PP +    TPP   PP   
Sbjct: 3   KVALLLLLASSPHALGAPARKP--PPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTP 60

Query: 320 -----TPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGP 156
                 PP   P P  P P   P+ SPP P P   P   P P     PP+P P    P P
Sbjct: 61  SGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPP 120

Query: 155 SGADTPPSP 129
                PP P
Sbjct: 121 PPPSPPPPP 129

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 37/101 (36%), Positives = 42/101 (41%), Gaps = 4/101 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P  PP   P P A PP    PP+  PP   PP + P P  P P S P  SPP P+P
Sbjct: 234 PPFPPPSPPPPRPPPPAPPPPRPPPPSP-PPPLPPPPS-PPPPLPPPPSPPPPSPPPPSP 291

Query: 239 ASTPSTAPTPSTAGS----PPAPTPDSLGPGPSGADTPPSP 129
                  P PS   +    PP P P    P P   + P  P
Sbjct: 292 LPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPP 332

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 37/99 (37%), Positives = 47/99 (47%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS--SPATSPPAP 246
           P+  P  PP+  P+P   PP +  PP   PP+  PP+  P P +P+P S   P   PP P
Sbjct: 182 PSPPPRPPPSPPPSPPPSPPPS--PPPRPPPSPNPPS--PRPPSPSPPSPRPPPRRPPFP 237

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P+  P   P P  A  PP P P S  P      +PP P
Sbjct: 238 PPSPPPPRPPPP--APPPPRPPPPSPPPPLPPPPSPPPP 274

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 35/102 (34%), Positives = 42/102 (41%), Gaps = 3/102 (2%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATPPT---ATPPTATPPAAVPAPATPAPASSPAT 261
           L   P+  P  PP  +P P +  P   +PP      PP   PP   P P +P P   P  
Sbjct: 275 LPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPP 334

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           SPP P P       P P     PP+P+P    P PS    PP
Sbjct: 335 SPPPPRPPPPSPNPPRP----PPPSPSPPKPPPPPSPPPRPP 372

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 36/95 (37%), Positives = 41/95 (43%)
 Frame = -3

Query: 410 APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAST 231
           +P  P  + P+P   P     PP + PP   PP A P P  P P S P   PP P P S 
Sbjct: 216 SPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPA-PPPPRPPPPSPP---PPLPPPPSP 271

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P   P P +   P  P P  L P P     PP PS
Sbjct: 272 PPPLPPPPSPPPPSPPPPSPLPPSP----RPPKPS 302

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 34/97 (35%), Positives = 38/97 (39%), Gaps = 7/97 (7%)
 Frame = -3

Query: 395 PTATPAPTAQPPAAATP-------PTATPPTATPPAAVPAPATPAPASSPATSPPAPTPA 237
           P A  AP  +PP   +P       P A PP + PP   P    P   S P   PP P P 
Sbjct: 14  PHALGAPARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPP 73

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P   P P +   PP P P    P P     PP PS
Sbjct: 74  PPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPS 110

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 33/97 (34%), Positives = 41/97 (42%), Gaps = 1/97 (1%)
 Frame = -3

Query: 419 PTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           P+  P KP P   P P   PP    PP   PP  +P    P P +P P   P   PP+P 
Sbjct: 294 PSPRPPKPSPPNNPFPRPPPP---NPPPPRPPPPSPNPPRPPPPSPPP---PRPPPPSPN 347

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
           P   P  +P+P     PP+P P      P     PP+
Sbjct: 348 PPRPPPPSPSPPKPPPPPSPPPRPPRRPPRPPRRPPT 384

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 28/79 (35%), Positives = 33/79 (41%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P  PP   P P +  P    PP+  PP   PP+  P P  P P+ SP   PP P+P
Sbjct: 309 PRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNP-PRPPPPSPSPPKPPPPPSP 367

Query: 239 ASTPSTAPTPSTAGSPPAP 183
              P   P       P AP
Sbjct: 368 PPRPPRRPPRPPRRPPTAP 386

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 27/79 (34%), Positives = 33/79 (41%)
 Frame = -3

Query: 401 KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPST 222
           +PP   P P   PP +  PP   PP+  PP   P    P     P+ SPP P P  +P  
Sbjct: 310 RPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSPPP 369

Query: 221 APTPSTAGSPPAPTPDSLG 165
            P P     PP   P + G
Sbjct: 370 RP-PRRPPRPPRRPPTAPG 387

[194][TOP]
>UniRef100_Q6SSE6 Plus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE6_CHLRE
          Length = 3409

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 42/99 (42%), Positives = 57/99 (57%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
            P+ AP  P   +PAP +  P +  PP+  PP+  PP+ A P+PA P+PA  P+  PP+P 
Sbjct: 1246 PSPAPPSPQPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAP-PSPEPPSPA 1304

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P   PS  P PS A  PP+PTP +  P  +    PPSP+
Sbjct: 1305 PPQPPSPVP-PSPA--PPSPTPPAPAPAAALPPLPPSPA 1340

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTA---TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           P+ AP  PP+    +PAP +  P +  PP+  PP+  PP+  PAP +PAP + P+  PP+
Sbjct: 690 PSPAPPLPPSPEPPSPAPPSPEPPSPAPPSPAPPSPAPPS--PAPPSPAPPAPPSPEPPS 747

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P P S    +P P +  +PP+P P S  P       PPSP
Sbjct: 748 PAPPSPEPPSPAPPSP-APPSPAPPSPAPPSPAPPAPPSP 786

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 39/101 (38%), Positives = 57/101 (56%), Gaps = 3/101 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTA---TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
            P+ AP  PP+    +PAP +  P +  PP+  PP+  PP+  PAP +PAP + P+  PP+
Sbjct: 733  PSPAPPAPPSPEPPSPAPPSPEPPSPAPPSPAPPSPAPPS--PAPPSPAPPAPPSPEPPS 790

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P P S    +P P +  +PP+P P S  P    +  PPSP+
Sbjct: 791  PAPPSPEPPSPAPPSP-APPSPEPPSPSPPAPPSPEPPSPA 830

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 38/99 (38%), Positives = 51/99 (51%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           Q P+  P  P   +PAP +  P +  PP+  PP+  PP   PAP +PAP   P+  PP+P
Sbjct: 648 QPPSPVPPSPKPPSPAPPSPVPPSPAPPSPAPPSPAPPN--PAPPSPAPPLPPSPEPPSP 705

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P S    +P P +  +PP+P P S  P       PPSP
Sbjct: 706 APPSPEPPSPAPPSP-APPSPAPPSPAPPSPAPPAPPSP 743

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 42/104 (40%), Positives = 56/104 (53%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV-PAPATPAPAS----SPATSP 255
            P+ AP  P   +PAP +  P +  PP+  PP+  PP+ V P P +P P S    SPA SP
Sbjct: 974  PSPAPPSPDPPSPAPPSPDPPSPAPPSPAPPSPNPPSPVPPTPPSPGPPSPEPPSPAPSP 1033

Query: 254  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS-GADTPPSPS 126
            P PTP ++P   P    +  PP+P P  L P P   +  PPSP+
Sbjct: 1034 PPPTPPTSPPPPPPEPPSPEPPSPAP-PLPPSPEPPSPAPPSPA 1076

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 41/104 (39%), Positives = 56/104 (53%), Gaps = 2/104 (1%)
 Frame = -3

Query: 407  PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS--SPATSPPAPTPAS 234
            P+ PP  +PAP +  P + TPP+  PP+  PP+  P P +PAP S   P+ +PP+P P S
Sbjct: 948  PSPPPPPSPAPPSPAPPSPTPPSPVPPSPAPPS--PDPPSPAPPSPDPPSPAPPSPAPPS 1005

Query: 233  TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
                +P P T  SP  P+P+   P PS    PP P+   S   P
Sbjct: 1006 PNPPSPVPPTPPSPGPPSPEPPSPAPS----PPPPTPPTSPPPP 1045

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 42/101 (41%), Positives = 55/101 (54%), Gaps = 4/101 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+ AP  P   +P P +  P +  PP+  PP+  PP+  PAP +PAP   P+ +PP+P P
Sbjct: 959  PSPAPPSPTPPSPVPPSPAPPSPDPPSPAPPSPDPPS--PAPPSPAP---PSPNPPSPVP 1013

Query: 239  ASTPSTAP----TPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             + PS  P     PS A SPP PTP +  P P     PPSP
Sbjct: 1014 PTPPSPGPPSPEPPSPAPSPPPPTPPTSPPPP--PPEPPSP 1052

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 39/101 (38%), Positives = 57/101 (56%), Gaps = 1/101 (0%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
            P+ AP  P   +PAP +  P +  PP+  PP+  PP+ A P+PA P+PA  P+ +PP+P 
Sbjct: 1231 PSPAPPSPAPPSPAPPSPAPPSPQPPSPAPPSPEPPSPAPPSPAPPSPAP-PSPAPPSPA 1289

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            P S    +P P +   P  P+P    P P  + TPP+P+ A
Sbjct: 1290 PPSPAPPSPEPPSPAPPQPPSPVPPSPAPP-SPTPPAPAPA 1329

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 38/103 (36%), Positives = 55/103 (53%), Gaps = 3/103 (2%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPAS--SPATSP 255
            + P+ AP  P   +PAP +  P +  PP+  PP+  PPA   P P +PAP S   P+ +P
Sbjct: 701  EPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPEPPSPAP 760

Query: 254  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P+P P S    +P P +   P  P+P+   P P   + PPSP+
Sbjct: 761  PSPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPE-PPSPA 802

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 44/111 (39%), Positives = 58/111 (52%), Gaps = 5/111 (4%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+ AP  P   +PAP +  P +  PP+  PP+  PP+  PAP +P+P + P+  PP+P P
Sbjct: 1073 PSPAPPSPQPPSPAPPSPAPPSPAPPSPAPPSPEPPS--PAPPSPSPPAPPSPEPPSPAP 1130

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSL-----GPGPSGADTPPSPSAAFSYSKP 102
               PS  P PS A  PP+P P  L      P P     PPSP A  S + P
Sbjct: 1131 LLPPSPDP-PSPA--PPSPMPPPLPTSPPSPEPVPPTPPPSPPAPPSPAPP 1178

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 47/115 (40%), Positives = 57/115 (49%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
            Q P+  P  P   +P P A  PAAA PP   PP+  PP  VP PA+PAP+ SP   P   
Sbjct: 1307 QPPSPVPPSPAPPSPTPPAPAPAAALPP--LPPSPAPPLPVP-PASPAPSPSPLRPPQPQ 1363

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATAL 81
            TPA  P +   PS A  PP+P P  + P P    TP  P A       ++A  AL
Sbjct: 1364 TPAMPPPSPAPPSPA--PPSPAPPGVPPPP---PTPTPPLAPLPPDCTLLAQAAL 1413

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 39/102 (38%), Positives = 54/102 (52%), Gaps = 2/102 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
            P+ AP  P   +P P +  P +  PP+  PP+  PP+ A P+P  P+PA  P+ +PP+P 
Sbjct: 857  PSPAPPSPAPPSPEPPSPEPPSPAPPSLEPPSPAPPSPAPPSPEPPSPAP-PSPAPPSPQ 915

Query: 242  PASTPSTAPTPSTAGSPPAPTPDS-LGPGPSGADTPPSPSAA 120
            P S    +P P +   PP+P P S   P P     PP PS A
Sbjct: 916  PPSPEPPSPEPPSPPPPPSPAPPSPAPPSPEPPSPPPPPSPA 957

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 36/97 (37%), Positives = 46/97 (47%)
 Frame = -3

Query: 410  APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAST 231
            +P  P  A P+P    P   TPP+  PP+  PP+  P+P  P P +SP   PP P     
Sbjct: 995  SPAPPSPAPPSPNPPSPVPPTPPSPGPPSPEPPSPAPSPPPPTPPTSPPPPPPEPPSPEP 1054

Query: 230  PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            PS AP    +  PP+P P S  P      +P  PS A
Sbjct: 1055 PSPAPPLPPSPEPPSPAPPSPAPPSPQPPSPAPPSPA 1091

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 41/109 (37%), Positives = 58/109 (53%), Gaps = 1/109 (0%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPASSPATSPPA 249
            + P+ AP  P   +PAP +  P +  PP+  PP+  PP+  P +PA P+PA  P+  PP+
Sbjct: 845  EPPSPAPPSPVPPSPAPPSPAPPSPEPPSPEPPSPAPPSLEPPSPAPPSPAP-PSPEPPS 903

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P P S    +P P +   PP+P P S  P PS A   P+P +    S P
Sbjct: 904  PAPPSPAPPSPQPPSP-EPPSPEPPSPPPPPSPAPPSPAPPSPEPPSPP 951

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 42/101 (41%), Positives = 55/101 (54%), Gaps = 1/101 (0%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV-PAPATPAPASSPATSPPA 249
            Q P+ AP  P   +PAP +  P +  PP+  PP+ +PPA   P P +PAP   P+  PP+
Sbjct: 1081 QPPSPAPPSPAPPSPAPPSPAPPSPEPPSPAPPSPSPPAPPSPEPPSPAPLLPPSPDPPS 1140

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P P S P   P P+   SPP+P P    P PS    PPSP+
Sbjct: 1141 PAPPS-PMPPPLPT---SPPSPEPVPPTPPPS-PPAPPSPA 1176

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 42/101 (41%), Positives = 59/101 (58%), Gaps = 1/101 (0%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPA 249
            + P+ AP  P   +PAP +  P +  PP+  PP+  PP+ A P+PA P+PA  P+ +PP+
Sbjct: 1189 EPPSPAPPSPAPPSPAPPSPEPPSPEPPSPEPPSPAPPSPAPPSPAPPSPAP-PSPAPPS 1247

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P P S    +P P +   PP+P P S  P PS A  PPSP+
Sbjct: 1248 PAPPSPQPPSPAPPSP-EPPSPAPPSPAP-PSPA--PPSPA 1284

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 44/122 (36%), Positives = 62/122 (50%), Gaps = 14/122 (11%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPP-------AAATPPTATPPTATPPA-AVPAPATPAPA--- 276
            AP+  P  PPT+ P P  +PP       A   PP+  PP+  PP+ A P+P  P+PA   
Sbjct: 1030 APSPPPPTPPTSPPPPPPEPPSPEPPSPAPPLPPSPEPPSPAPPSPAPPSPQPPSPAPPS 1089

Query: 275  -SSPATSPPAPTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSK 105
             + P+ +PP+P P S   PS AP   +  +PP+P P S  P    +  PPSP+       
Sbjct: 1090 PAPPSPAPPSPAPPSPEPPSPAPPSPSPPAPPSPEPPSPAPLLPPSPDPPSPAPPSPMPP 1149

Query: 104  PI 99
            P+
Sbjct: 1150 PL 1151

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 35/103 (33%), Positives = 52/103 (50%), Gaps = 4/103 (3%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           + P+  P  P   +PAP + PP +  PP+  PP+  PP+  P P +P P   P+  PP+P
Sbjct: 600 EPPSPKPPSPAPPSPAPPSPPPPSPAPPSPAPPSPAPPS--PQPPSPVPPQPPSPVPPSP 657

Query: 245 TPASTPSTAPTPST----AGSPPAPTPDSLGPGPSGADTPPSP 129
            P S    +P P +    + +PP+P P +  P       PPSP
Sbjct: 658 KPPSPAPPSPVPPSPAPPSPAPPSPAPPNPAPPSPAPPLPPSP 700

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/99 (37%), Positives = 53/99 (53%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
            + P+ AP  P   +PAP +  P +  PP+  PP+  PPA  P+P  P+PA  P+  PP+P
Sbjct: 744  EPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPAP-PSPEPPSPA-PPSPEPPSP 801

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             P S    +P P +   P  P+P+   P P  +  PPSP
Sbjct: 802  APPSPAPPSPEPPSPSPPAPPSPEPPSPAPP-SPFPPSP 839

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 39/98 (39%), Positives = 50/98 (51%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+ AP  P   +PAP +  P +  PP+  PP+  PP+  P P +PAP S    SP  P+P
Sbjct: 892  PSPAPPSPEPPSPAPPSPAPPSPQPPSPEPPSPEPPSP-PPPPSPAPPSPAPPSPEPPSP 950

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
               PS AP      SP  P+P    P P   D PPSP+
Sbjct: 951  PPPPSPAPPSPAPPSPTPPSPVPPSPAPPSPD-PPSPA 987

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 43/103 (41%), Positives = 54/103 (52%), Gaps = 5/103 (4%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  P   +PAP +  P +  PP+  PP+  PP + PAP +PAP S    SPP P  
Sbjct: 897  PSPEPPSPAPPSPAPPSPQPPSPEPPSPEPPSPPPPPS-PAPPSPAPPSPEPPSPPPPPS 955

Query: 239  ASTPSTAPTPSTAGSP----PA-PTPDSLGPGPSGADTPPSPS 126
             + PS AP   T  SP    PA P+PD   P P   D PPSP+
Sbjct: 956  PAPPSPAPPSPTPPSPVPPSPAPPSPDPPSPAPPSPD-PPSPA 997

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 35/101 (34%), Positives = 49/101 (48%), Gaps = 3/101 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA---PATPAPASSPATSPPA 249
            P+  P  P   +PAP +  P +  PP+  PP+  PP+  P    P +P P + P+  PP+
Sbjct: 964  PSPTPPSPVPPSPAPPSPDPPSPAPPSPDPPSPAPPSPAPPSPNPPSPVPPTPPSPGPPS 1023

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P P S   + P P+   SPP P P+   P P     P  PS
Sbjct: 1024 PEPPSPAPSPPPPTPPTSPPPPPPEPPSPEPPSPAPPLPPS 1064

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 45/119 (37%), Positives = 59/119 (49%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
            + P+ AP  P   +PAP +  P +  PP+  PP+  PP+  PAP +P P S PA   PAP
Sbjct: 1219 EPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPQPPS--PAPPSPEPPS-PAPPSPAP 1275

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAAL 69
               + PS AP      SP  P+P+   P P    +P  PS A     P   A A +AAL
Sbjct: 1276 PSPAPPSPAPPSPAPPSPAPPSPEPPSPAPPQPPSPVPPSPA--PPSPTPPAPAPAAAL 1332

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 41/101 (40%), Positives = 55/101 (54%), Gaps = 3/101 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS--PATSPPAP 246
            P+  P  P   +PAP +  P +  PP+  PP+  PP+  PAP +PAP S   P+  PP+P
Sbjct: 867  PSPEPPSPEPPSPAPPSLEPPSPAPPSPAPPSPEPPS--PAPPSPAPPSPQPPSPEPPSP 924

Query: 245  TPASTPSTAPTPSTA-GSPPAPTPDSLGPGPSGADTPPSPS 126
             P   PS  P PS A  SP  P+P+   P P  +  PPSP+
Sbjct: 925  EP---PSPPPPPSPAPPSPAPPSPEPPSPPPPPSPAPPSPA 962

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 40/98 (40%), Positives = 53/98 (54%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
            P+  P  P   +PAP +  P +  PP+  PP+  PP+ A P+P  P+PA  P+ SPPAP 
Sbjct: 1063 PSPEPPSPAPPSPAPPSPQPPSPAPPSPAPPSPAPPSPAPPSPEPPSPA-PPSPSPPAPP 1121

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
                PS AP    +  PP+P P S  P P    +PPSP
Sbjct: 1122 SPEPPSPAPLLPPSPDPPSPAPPSPMPPPL-PTSPPSP 1158

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 37/98 (37%), Positives = 53/98 (54%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+ AP  PP  +PAP +  P +  PP+  PP+  PP   P+P  P+P   P+ +PP+P P
Sbjct: 612 PSPAPPSPPPPSPAPPSPAPPSPAPPSPQPPSPVPPQP-PSPVPPSP-KPPSPAPPSPVP 669

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S    +P P +  +PP P P S  P    +  PPSP+
Sbjct: 670 PSPAPPSPAPPSP-APPNPAPPSPAPPLPPSPEPPSPA 706

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 39/102 (38%), Positives = 53/102 (51%), Gaps = 4/102 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS--SPATSPPAP 246
            P+  P  P   +PAP +  P +  PP+  PP+  PP+  P P +PAP S   P+ +PP+P
Sbjct: 837  PSPQPPSPEPPSPAPPSPVPPSPAPPSPAPPSPEPPS--PEPPSPAPPSLEPPSPAPPSP 894

Query: 245  TPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P S   PS AP      SP  P+P+   P P     PPSP+
Sbjct: 895  APPSPEPPSPAPPSPAPPSPQPPSPEPPSPEPPSPPPPPSPA 936

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 37/99 (37%), Positives = 54/99 (54%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPASSPATSPPAPT 243
            P+  P  P   +PAP +  P +  PP+  PP+  PP+  P +P  P+P   P+ +PP+P 
Sbjct: 882  PSLEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPQPPSPEPPSPEPPSPPPPPSPAPPSPA 941

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P S    +P P  + +PP+P P S  P PS    PPSP+
Sbjct: 942  PPSPEPPSPPPPPSPAPPSPAPPSPTP-PS--PVPPSPA 977

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 41/99 (41%), Positives = 57/99 (57%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
            P+ AP  P   +P P +  P +  PP+  PP+  PP+ A P+PA P+PA  P+  PP+P 
Sbjct: 1201 PSPAPPSPEPPSPEPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPSPA-PPSPQPPSPA 1259

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P S    +P P +  +PP+P P S  P PS A  PPSP+
Sbjct: 1260 PPSPEPPSPAPPSP-APPSPAPPSPAP-PSPA--PPSPA 1294

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 42/105 (40%), Positives = 57/105 (54%), Gaps = 8/105 (7%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+ AP  P   +PAP  QPP+   PP+  PP+ TPPA  PAPA   P   P+ +PP P P
Sbjct: 1291 PSPAPPSPEPPSPAPP-QPPSPV-PPSPAPPSPTPPA--PAPAAALPPLPPSPAPPLPVP 1346

Query: 239  ASTPSTAPTP-------STAGSPPAPTPDS-LGPGPSGADTPPSP 129
             ++P+ +P+P       + A  PP+P P S   P P+    PP P
Sbjct: 1347 PASPAPSPSPLRPPQPQTPAMPPPSPAPPSPAPPSPAPPGVPPPP 1391

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 37/101 (36%), Positives = 52/101 (51%), Gaps = 3/101 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPP-AAVPAPATPAPAS--SPATSPPA 249
           P+ AP  P   +PAP +  P +  PP   PP+  PP    P P +PAP S   P+ +PP+
Sbjct: 660 PSPAPPSPVPPSPAPPSPAPPSPAPPNPAPPSPAPPLPPSPEPPSPAPPSPEPPSPAPPS 719

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P P S    +P P +   P  P+P+   P P   + PPSP+
Sbjct: 720 PAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPE-PPSPA 759

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 42/100 (42%), Positives = 54/100 (54%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS--SPATSPPAP 246
            P+ AP  P   +PAP A P  +  PP+  PP+  PP+  PAP +PAP S   P+ SPPAP
Sbjct: 766  PSPAPPSPAPPSPAPPAPP--SPEPPSPAPPSPEPPS--PAPPSPAPPSPEPPSPSPPAP 821

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
                 PS AP      SP  P+P+   P P  +  PPSP+
Sbjct: 822  PSPEPPSPAPPSPFPPSPQPPSPEPPSPAPP-SPVPPSPA 860

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 40/106 (37%), Positives = 58/106 (54%), Gaps = 5/106 (4%)
 Frame = -3

Query: 425  QAPTAAPTKPPTA---TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS--SPAT 261
            + P+ AP  PP+    +PAP +  P +  PP+  PP+  PP+  PAP +PAP S   P+ 
Sbjct: 1053 EPPSPAPPLPPSPEPPSPAPPSPAPPSPQPPSPAPPSPAPPS--PAPPSPAPPSPEPPSP 1110

Query: 260  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
            +PP+P+P + PS  P       PP+P P S  P P     PP P++
Sbjct: 1111 APPSPSPPAPPSPEPPSPAPLLPPSPDPPS--PAPPSPMPPPLPTS 1154

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 2/102 (1%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
            Q P+  P  P   +P P +  P +  PP+  PP+  PP+  P    P   + P+ +PP+P
Sbjct: 840  QPPSPEPPSPAPPSPVPPSPAPPSPAPPSPEPPSPEPPSPAPPSLEPPSPAPPSPAPPSP 899

Query: 245  TPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P S   PS AP      SP  P+P+   P P  +  PPSP+
Sbjct: 900  EPPSPAPPSPAPPSPQPPSPEPPSPEPPSPPPPPSPAPPSPA 941

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 42/104 (40%), Positives = 56/104 (53%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTA-QPPAAATPPTATPPTATPPAAVPAPATPAPASSPA---TSPP 252
            P+ AP  P   +P P + +PP+   PP+  PP+  PP+  P P +P P  SPA    +PP
Sbjct: 907  PSPAPPSPQPPSPEPPSPEPPSPPPPPSPAPPSPAPPS--PEPPSPPPPPSPAPPSPAPP 964

Query: 251  APTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            +PTP S   PS AP      SP  P+PD   P P  +  PPSP+
Sbjct: 965  SPTPPSPVPPSPAPPSPDPPSPAPPSPDPPSPAPP-SPAPPSPN 1007

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 41/99 (41%), Positives = 58/99 (58%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAPT 243
            P+ AP  P   +P P +  P +  PP+  PP+  PP+ A P+PA P+PA  P+ +PP+P 
Sbjct: 1196 PSPAPPSPAPPSPEPPSPEPPSPEPPSPAPPSPAPPSPAPPSPAPPSPA-PPSPAPPSPQ 1254

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P S    +P P +  +PP+P P S  P PS A  PPSP+
Sbjct: 1255 PPSPAPPSPEPPSP-APPSPAPPSPAP-PSPA--PPSPA 1289

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 41/120 (34%), Positives = 53/120 (44%), Gaps = 18/120 (15%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPA---PATPAPASSPATSP 255
            Q P+ AP  P   +PAP +  P +  PP+  PP+  PP+  P    P +PAP   P+  P
Sbjct: 1254 QPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPEPPSPAPPQPPSPVP 1313

Query: 254  PAPTPASTPSTAPTPSTAGSP---------------PAPTPDSLGPGPSGADTPPSPSAA 120
            P+P P S    AP P+ A  P               PAP+P  L P        P PS A
Sbjct: 1314 PSPAPPSPTPPAPAPAAALPPLPPSPAPPLPVPPASPAPSPSPLRPPQPQTPAMPPPSPA 1373

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 45/108 (41%), Positives = 60/108 (55%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
            + P+ AP+ PP  TP PT+ PP    PP+  PP+  PP   P+P  P+PA  P+ +PP+P
Sbjct: 1025 EPPSPAPSPPPP-TP-PTSPPPPPPEPPSPEPPSPAPPLP-PSPEPPSPA-PPSPAPPSP 1080

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
             P S    +P P +  +PP+P P S  P PS A   PSP A  S   P
Sbjct: 1081 QPPSPAPPSPAPPSP-APPSPAPPSPEP-PSPAPPSPSPPAPPSPEPP 1126

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 42/107 (39%), Positives = 56/107 (52%), Gaps = 7/107 (6%)
 Frame = -3

Query: 425  QAPTAAPTKPPTA---TPAPTAQ--PPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
            + P+ AP  PP+    +PAP +   PP   +PP+  P   TPP + PAP +PAP S    
Sbjct: 1124 EPPSPAPLLPPSPDPPSPAPPSPMPPPLPTSPPSPEPVPPTPPPSPPAPPSPAPPSPQPL 1183

Query: 260  SPPAPTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             PP+P P S   PS AP      SP  P+P+   P P  +  PPSP+
Sbjct: 1184 EPPSPEPPSPAPPSPAPPSPAPPSPEPPSPEPPSPEPP-SPAPPSPA 1229

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 44/110 (40%), Positives = 56/110 (50%), Gaps = 12/110 (10%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTA--------QPPAAATPPTATPPTATPPAAVPAPATPAPASSP 267
           +P   P +PP   P P+          PPA++ PP+  PP+  PP+  PAP +PAP S P
Sbjct: 563 SPPPPPPRPPPRAPRPSPPFHPPSPDSPPASSVPPSPEPPSPKPPS--PAPPSPAPPSPP 620

Query: 266 ATSPPAPTPA----STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             SP  P+PA    + PS  P       PP+P P S  P PS A  PPSP
Sbjct: 621 PPSPAPPSPAPPSPAPPSPQPPSPVPPQPPSPVPPSPKP-PSPA--PPSP 667

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 38/100 (38%), Positives = 52/100 (52%), Gaps = 5/100 (5%)
 Frame = -3

Query: 410  APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPA----SSPATSPPAP 246
            +P  P  A P+P    PA   PP+  PP+  PP+  P +PA P+PA    + P+ +PP+P
Sbjct: 719  SPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSP 778

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             P + PS  P      SP  P+P    P P   + PPSPS
Sbjct: 779  APPAPPSPEPPSPAPPSPEPPSPAPPSPAPPSPE-PPSPS 817

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 38/104 (36%), Positives = 50/104 (48%), Gaps = 4/104 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV----PAPATPAPASSPATSPP 252
            P+  P  PP+  P     P  A +PP  TPPT+ PP       P P +PAP   P+  PP
Sbjct: 1009 PSPVPPTPPSPGPPSPEPPSPAPSPPPPTPPTSPPPPPPEPPSPEPPSPAPPLPPSPEPP 1068

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            +P P S    +P P +  +PP+P P S  P      +P  PS A
Sbjct: 1069 SPAPPSPAPPSPQPPSP-APPSPAPPSPAPPSPAPPSPEPPSPA 1111

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 42/106 (39%), Positives = 55/106 (51%), Gaps = 8/106 (7%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTA------TPPAAVPAPATPAPASS--PA 264
            P   PT PP+  P P   PP+   PP+  PP+       +P    PAP +PAP S   P+
Sbjct: 1148 PPPLPTSPPSPEPVPPTPPPSPPAPPSPAPPSPQPLEPPSPEPPSPAPPSPAPPSPAPPS 1207

Query: 263  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              PP+P P S    +P P +  +PP+P P S  P PS A  PPSP+
Sbjct: 1208 PEPPSPEPPSPEPPSPAPPSP-APPSPAPPSPAP-PSPA--PPSPA 1249

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 39/100 (39%), Positives = 53/100 (53%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
            + P+  P  P   +PAP +  P +  PP+  PP+  PP+  PAP +PAP  SPA   PAP
Sbjct: 1184 EPPSPEPPSPAPPSPAPPSPAPPSPEPPSPEPPSPEPPS--PAPPSPAP-PSPAPPSPAP 1240

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
               + PS AP      SP  P+P+   P P  +  PPSP+
Sbjct: 1241 PSPAPPSPAPPSPQPPSPAPPSPEPPSPAPP-SPAPPSPA 1279

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 37/100 (37%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS-SPATSPPA 249
            + P+ AP      +PAP +  P +  PP+  PP+  PP+  P P +P P S  P + PP 
Sbjct: 875  EPPSPAPPSLEPPSPAPPSPAPPSPEPPSPAPPSPAPPS--PQPPSPEPPSPEPPSPPPP 932

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P+PA      P+P     PP P+P    P P  + TPPSP
Sbjct: 933  PSPAPPSPAPPSPEPPSPPPPPSPAPPSPAPP-SPTPPSP 971

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 42/106 (39%), Positives = 54/106 (50%), Gaps = 7/106 (6%)
 Frame = -3

Query: 425  QAPTAAPTKP-PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS------SP 267
            + P+ AP  P P A P+P    PA   PP+  PP+  PP+ +P P   +P S      +P
Sbjct: 1106 EPPSPAPPSPSPPAPPSPEPPSPAPLLPPSPDPPSPAPPSPMPPPLPTSPPSPEPVPPTP 1165

Query: 266  ATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              SPPAP   + PS  P    +  PP+P P S  P PS A  PPSP
Sbjct: 1166 PPSPPAPPSPAPPSPQPLEPPSPEPPSPAPPSPAP-PSPA--PPSP 1208

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 44/128 (34%), Positives = 59/128 (46%), Gaps = 3/128 (2%)
 Frame = -3

Query: 503 LHPKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATP-PTATPP 327
           L P   S   V   + +G +  S     P+  P +PP+  P P   PP A  P P   PP
Sbjct: 526 LPPSPPSPTPVARCIQVGGICDSPSPMPPSPRPPQPPSPPPPPPRPPPRAPRPSPPFHPP 585

Query: 326 TATPPAAVPAPATPAPAS--SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 153
           +   P A   P +P P S   P+ +PP+P P S P  +P P +  +PP+P P S  P   
Sbjct: 586 SPDSPPASSVPPSPEPPSPKPPSPAPPSPAPPSPPPPSPAPPSP-APPSPAPPSPQPPSP 644

Query: 152 GADTPPSP 129
               PPSP
Sbjct: 645 VPPQPPSP 652

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 40/104 (38%), Positives = 56/104 (53%), Gaps = 6/104 (5%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS--PATSPPA 249
            +P     +PP+  P P+  PP+ A PP+  PP+  PP + PAP +PAP S   P+  PP+
Sbjct: 918  SPEPPSPEPPSPPPPPSPAPPSPA-PPSPEPPSPPPPPS-PAPPSPAPPSPTPPSPVPPS 975

Query: 248  PTPASTPSTAPTPST----AGSPPAPTPDSLGPGPSGADTPPSP 129
            P P S    +P P +    + +PP+P P S  P      TPPSP
Sbjct: 976  PAPPSPDPPSPAPPSPDPPSPAPPSPAPPSPNPPSPVPPTPPSP 1019

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 34/98 (34%), Positives = 50/98 (51%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  P   +P P +  P +  PP+  PP+  PP+  PAP  P     P+ +PP+P P
Sbjct: 698 PSPEPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPS--PAPPAPPSPEPPSPAPPSPEP 755

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S    +P P +  +PP+P P S  P    +  PPSP+
Sbjct: 756 PSPAPPSPAPPSP-APPSPAPPSPAPPAPPSPEPPSPA 792

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 37/102 (36%), Positives = 53/102 (51%), Gaps = 2/102 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS--SPATSPPAP 246
            P+  P  P   +P P +  P +  PP+  PP+  PP+  PAP +PAP S   P+ +PP+P
Sbjct: 1206 PSPEPPSPEPPSPEPPSPAPPSPAPPSPAPPSPAPPS--PAPPSPAPPSPQPPSPAPPSP 1263

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
             P S    +P P +  +PP+P P S  P      +P  PS A
Sbjct: 1264 EPPSPAPPSPAPPSP-APPSPAPPSPAPPSPAPPSPEPPSPA 1304

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 34/98 (34%), Positives = 49/98 (50%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  P   +P P +  P +  PP+  PP   PP+  PAP  P     P+ +PP+P P
Sbjct: 655 PSPKPPSPAPPSPVPPSPAPPSPAPPSPAPPNPAPPS--PAPPLPPSPEPPSPAPPSPEP 712

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            S    +P P +  +PP+P P S  P    +  PPSP+
Sbjct: 713 PSPAPPSPAPPSP-APPSPAPPSPAPPAPPSPEPPSPA 749

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 42/99 (42%), Positives = 55/99 (55%), Gaps = 5/99 (5%)
 Frame = -3

Query: 410  APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV---PAPATPAPAS--SPATSPPAP 246
            AP  P   +PAP +  P +  PP+  PP+  PP+ V   PAP +PAP S   P+  PP+P
Sbjct: 820  APPSPEPPSPAPPSPFPPSPQPPSPEPPSPAPPSPVPPSPAPPSPAPPSPEPPSPEPPSP 879

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             P S    +P P +  +PP+P P S  P PS A  PPSP
Sbjct: 880  APPSLEPPSPAPPSP-APPSPEPPSPAP-PSPA--PPSP 914

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 39/99 (39%), Positives = 53/99 (53%), Gaps = 1/99 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP-APATPAPASSPATSPPAPT 243
           P+ AP  P    PAP +  PA   PP+  PP+  PP+  P +PA P+PA  P+ +PP+P 
Sbjct: 675 PSPAPPSPAPPNPAPPS--PAPPLPPSPEPPSPAPPSPEPPSPAPPSPAP-PSPAPPSPA 731

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P S    AP      SP  P+P+   P P  +  PPSP+
Sbjct: 732 PPSPAPPAPPSPEPPSPAPPSPEPPSPAPP-SPAPPSPA 769

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 5/100 (5%)
 Frame = -3

Query: 410 APTKPPTATPAPTAQPPA----AATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAP 246
           +P  PP ++  P+ +PP+    +  PP+  PP+  PP+ A P+PA P+PA  P+  PP+P
Sbjct: 586 SPDSPPASSVPPSPEPPSPKPPSPAPPSPAPPSPPPPSPAPPSPAPPSPAP-PSPQPPSP 644

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P   PS  P      SP  P+P    P P  +  PPSP+
Sbjct: 645 VPPQPPSPVPPSPKPPSPAPPSPVPPSPAPP-SPAPPSPA 683

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 39/102 (38%), Positives = 52/102 (50%), Gaps = 4/102 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQP---PAAATPPTATPPTATPPA-AVPAPATPAPASSPATSPP 252
           P+ AP  P   +P P   P   P +  PP+  PP+  PP+ A P+PA P+PA  P  +PP
Sbjct: 632 PSPAPPSPQPPSPVPPQPPSPVPPSPKPPSPAPPSPVPPSPAPPSPAPPSPA-PPNPAPP 690

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           +P P   PS  P      SP  P+P    P P  +  PPSP+
Sbjct: 691 SPAPPLPPSPEPPSPAPPSPEPPSPAPPSPAPP-SPAPPSPA 731

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 42/111 (37%), Positives = 56/111 (50%), Gaps = 11/111 (9%)
 Frame = -3

Query: 419  PTAAPTK---PPTATPAPTAQP------PAAATPPTATPPTATPPAAVPAPATPAPAS-- 273
            PT+ P+    PPT  P+P A P      P    PP+  PP+  PP+  PAP +PAP S  
Sbjct: 1152 PTSPPSPEPVPPTPPPSPPAPPSPAPPSPQPLEPPSPEPPSPAPPS--PAPPSPAPPSPE 1209

Query: 272  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
             P+  PP+P P S    +P P +  +PP+P P S  P      +P  PS A
Sbjct: 1210 PPSPEPPSPEPPSPAPPSPAPPSP-APPSPAPPSPAPPSPAPPSPQPPSPA 1259

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 39/105 (37%), Positives = 54/105 (51%), Gaps = 5/105 (4%)
 Frame = -3

Query: 425  QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTA-TPPAAVPAPATPAPASS--PATSP 255
            + P+ AP  P   +PAP +  P +  PP+ +PP   +P    PAP +P P S   P+  P
Sbjct: 787  EPPSPAPPSPEPPSPAPPSPAPPSPEPPSPSPPAPPSPEPPSPAPPSPFPPSPQPPSPEP 846

Query: 254  PAPTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P+P P S   PS AP      SP  P+P+   P P   + PPSP+
Sbjct: 847  PSPAPPSPVPPSPAPPSPAPPSPEPPSPEPPSPAPPSLE-PPSPA 890

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 42/101 (41%), Positives = 54/101 (53%), Gaps = 3/101 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQP---PAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
            P+ AP  P   +P+P A P   P +  PP+  PP+  PP+  P P +PAP S    SP  
Sbjct: 804  PSPAPPSPEPPSPSPPAPPSPEPPSPAPPSPFPPSPQPPS--PEPPSPAPPSPVPPSPAP 861

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P+PA      P+P     PP+P P SL P PS A  PPSP+
Sbjct: 862  PSPAPPSPEPPSPE----PPSPAPPSLEP-PSPA--PPSPA 895

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419  PTAAPTKPPTA---TPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
            P+ AP  PP+    +PAP +  P +  PP+  PP+  PP+  P+P  P     P+ +PP+
Sbjct: 776  PSPAPPAPPSPEPPSPAPPSPEPPSPAPPSPAPPSPEPPS--PSPPAPPSPEPPSPAPPS 833

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P P S    +P P +  +PP+P P S  P PS A  PPSP
Sbjct: 834  PFPPSPQPPSPEPPSP-APPSPVPPSPAP-PSPA--PPSP 869

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 39/100 (39%), Positives = 49/100 (49%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+ AP  P    P PT+ P     PPT  P    PP+  PAP +P P   P+  PP+P P
Sbjct: 1139 PSPAPPSP-MPPPLPTSPPSPEPVPPTPPPSPPAPPS--PAPPSPQPLEPPSPEPPSPAP 1195

Query: 239  AS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             S   PS AP      SP  P+P+   P P  +  PPSP+
Sbjct: 1196 PSPAPPSPAPPSPEPPSPEPPSPEPPSPAPP-SPAPPSPA 1234

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 43/130 (33%), Positives = 53/130 (40%), Gaps = 19/130 (14%)
 Frame = -3

Query: 434 CLAQAPTAAPT--KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP-- 267
           CLA  P  +P   +PP   P P + PP    P    PP + P    P P+ P P S P  
Sbjct: 467 CLAPPPPPSPPSPRPPRPPPLPPSPPPPLLPPSPPVPPPSPPSPPSPPPSPPEPPSPPPL 526

Query: 266 ATSPPAPTPAS---------------TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
             SPP+PTP +                PS  P    +  PP P P    P PS    PPS
Sbjct: 527 PPSPPSPTPVARCIQVGGICDSPSPMPPSPRPPQPPSPPPPPPRPPPRAPRPSPPFHPPS 586

Query: 131 PSAAFSYSKP 102
           P +  + S P
Sbjct: 587 PDSPPASSVP 596

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 37/103 (35%), Positives = 52/103 (50%), Gaps = 5/103 (4%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV---PAPATPAPAS--SPATSP 255
           P+  P  P   +PAP +  P +  PP+  PP   PP+ V   P P +PAP S   P+ +P
Sbjct: 617 PSPPPPSPAPPSPAPPSPAPPSPQPPSPVPP--QPPSPVPPSPKPPSPAPPSPVPPSPAP 674

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P+P P S     P P +   P  P+P+   P P   + PPSP+
Sbjct: 675 PSPAPPSPAPPNPAPPSPAPPLPPSPEPPSPAPPSPE-PPSPA 716

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 37/100 (37%), Positives = 50/100 (50%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+ AP  P    P P+ +PP+ A PP+  PP+  PP+  P    P     P+ +PP+P P
Sbjct: 1173 PSPAPPSPQPLEP-PSPEPPSPA-PPSPAPPSPAPPSPEPPSPEPPSPEPPSPAPPSPAP 1230

Query: 239  AS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
             S   PS AP      SP  P+P    P P   + PPSP+
Sbjct: 1231 PSPAPPSPAPPSPAPPSPAPPSPQPPSPAPPSPE-PPSPA 1269

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 43/119 (36%), Positives = 55/119 (46%), Gaps = 21/119 (17%)
 Frame = -3

Query: 422 APTAAPTKPPTATP------------APTAQPPAAATP--PTATPPTATPPAAVPAPA-- 291
           +P   P  PP+ TP            +P+  PP+   P  P+  PP   PP   P P+  
Sbjct: 522 SPPPLPPSPPSPTPVARCIQVGGICDSPSPMPPSPRPPQPPSPPPPPPRPPPRAPRPSPP 581

Query: 290 --TPAPASSPATS-PPAPTPAS--TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
              P+P S PA+S PP+P P S   PS AP      SPP P+P    P P  +  PPSP
Sbjct: 582 FHPPSPDSPPASSVPPSPEPPSPKPPSPAPPSPAPPSPPPPSPAPPSPAPP-SPAPPSP 639

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 33/98 (33%), Positives = 43/98 (43%), Gaps = 3/98 (3%)
 Frame = -3

Query: 410  APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT---PAPASSPATSPPAPTP 240
            +P  P    P+P    P +  PP+  PP+  P    P P T   P P   P+  PP+P P
Sbjct: 1000 SPAPPSPNPPSPVPPTPPSPGPPSPEPPSPAPSPPPPTPPTSPPPPPPEPPSPEPPSPAP 1059

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
               PS  P      SP  P+P    P P  +  PPSP+
Sbjct: 1060 PLPPSPEPPSPAPPSPAPPSPQPPSPAPP-SPAPPSPA 1096

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 37/137 (27%), Positives = 51/137 (37%), Gaps = 37/137 (27%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS----------S 270
           P+  P   P + P P   PP+  +PP + P   +PP   P+P +P P +          S
Sbjct: 489 PSPPPPLLPPSPPVPPPSPPSPPSPPPSPPEPPSPPPLPPSPPSPTPVARCIQVGGICDS 548

Query: 269 PATSPPAPTPASTPSTAPTPST---------------------------AGSPPAPTPDS 171
           P+  PP+P P   PS  P P                             +  PP+P P S
Sbjct: 549 PSPMPPSPRPPQPPSPPPPPPRPPPRAPRPSPPFHPPSPDSPPASSVPPSPEPPSPKPPS 608

Query: 170 LGPGPSGADTPPSPSAA 120
             P      +PP PS A
Sbjct: 609 PAPPSPAPPSPPPPSPA 625

[195][TOP]
>UniRef100_B6SZD0 Transcriptional regulatory protein algP n=1 Tax=Zea mays
           RepID=B6SZD0_MAIZE
          Length = 225

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 71/168 (42%), Positives = 84/168 (50%), Gaps = 29/168 (17%)
 Frame = -3

Query: 491 MASSAAVQI---FLILGLLATSCLAQAPTAAPTKPPT-----ATPAPTAQP--------- 363
           MA+ A V +   FL+L L ATS LAQ+P AAP K P      ATPA    P         
Sbjct: 1   MAARATVVLCAAFLVL-LSATSSLAQSPAAAPAKAPPKSSSKATPAAAPAPKSSSKASPL 59

Query: 362 -PAAA--TP-PTATPPTATPPAAVPAPATPAPASSPATSPPAPTP-ASTP--STAPTPST 204
            PAAA  TP P A P T  P A  PAPAT A A +PAT  P  TP A+TP  + AP P+ 
Sbjct: 60  APAAAPTTPAPAAAPATPKPKAPAPAPATKAAAPAPATPAPVATPPAATPPAAEAPVPAA 119

Query: 203 AGSP-----PAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSA 75
           A +P      AP P    P P+    P SPS+     K   +A A +A
Sbjct: 120 APAPETKPVEAPAP---APAPAKKKKPSSPSSKDKKKKKGASAPAPAA 164

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 62/157 (39%), Positives = 73/157 (46%), Gaps = 35/157 (22%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPT----AQPPAAATP-PTATPPTATPPAA-------VPAPAT--- 288
           AP AAP  P    PAP     A  PA ATP P ATPP ATPPAA        PAP T   
Sbjct: 69  APAAAPATPKPKAPAPAPATKAAAPAPATPAPVATPPAATPPAAEAPVPAAAPAPETKPV 128

Query: 287 --PAPASSPA-----TSP-----------PAPTPASTPSTAPTPSTAGSPPAPTPDSLGP 162
             PAPA +PA     +SP            AP PA+    A  P TA    APT  +  P
Sbjct: 129 EAPAPAPAPAKKKKPSSPSSKDKKKKKGASAPAPAADAPVAKKPRTA---DAPTSAAEAP 185

Query: 161 GPSGADTPPSPSAAFSYSKP--IIAATALSAALFAIA 57
           GPSG       + A +   P  +IA++A++  L A A
Sbjct: 186 GPSGDAAAADTARAAARRTPAGVIASSAVAVLLGAAA 222

[196][TOP]
>UniRef100_A8JFD4 Glyoxal or galactose oxidase (Fragment) n=1 Tax=Chlamydomonas
           reinhardtii RepID=A8JFD4_CHLRE
          Length = 898

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 41/100 (41%), Positives = 52/100 (52%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP  +P P + PP +  PP+ +PPT +PP   P P+T   + SP  SPP P P
Sbjct: 264 PSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPTPSPP---PPPSTVLTSPSPPPSPPPPRP 320

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            S P   P P     P  P P + GP PSG   PP+P  A
Sbjct: 321 PSPPPPRPPP-----PRPPLPGTGGPKPSGDAFPPTPPDA 355

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 38/110 (34%), Positives = 57/110 (51%), Gaps = 4/110 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS--PATSPPAP 246
           P+ +P  P   +P+P +  P + +PP+  PP+  PP+  P+P +P+P S   P+  PP+P
Sbjct: 204 PSPSPPSPSPPSPSPPSPSPPSPSPPSPRPPSPRPPS--PSPPSPSPPSPRPPSPRPPSP 261

Query: 245 TPASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            P S P  +P P +    SPP P+P    P P     PP PS   +   P
Sbjct: 262 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPTPSPPPPPSTVLTSPSP 311

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 36/99 (36%), Positives = 51/99 (51%), Gaps = 2/99 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT- 243
           P+ +P  P   +P P +  P + +PP+  PP+  PP+  P P +P P S P  SPP P+ 
Sbjct: 224 PSPSPPSPRPPSPRPPSPSPPSPSPPSPRPPSPRPPS--PPPPSPPPPSPPPPSPPPPSP 281

Query: 242 -PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P S P  +P+P T   PP P+     P P  +  PP P
Sbjct: 282 PPPSPPPPSPSPPTPSPPPPPSTVLTSPSPPPSPPPPRP 320

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 41/110 (37%), Positives = 51/110 (46%), Gaps = 10/110 (9%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPP-----TATPPAAVPAPATPAPASSPATSP 255
           P+  P  PP  +P P + PP + +PPT +PP       T P+  P+P  P P S P   P
Sbjct: 269 PSPPPPSPPPPSPPPPSPPPPSPSPPTPSPPPPPSTVLTSPSPPPSPPPPRPPSPPPPRP 328

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDS-----LGPGPSGADTPPSPSAA 120
           P P P    +  P PS    PP P PD+     L P P     PPSP  A
Sbjct: 329 PPPRPPLPGTGGPKPSGDAFPPTP-PDAPLFPPLSPSPPALMRPPSPPLA 377

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 38/98 (38%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  P   +P+P +  P +  PP+  PP+  PP+  P P +P P S P  SPP P+P
Sbjct: 234 PSPRPPSPSPPSPSPPSPRPPSPRPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSP 291

Query: 239 A-STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           +  TPS  P PST  + P+P P    P P    +PP P
Sbjct: 292 SPPTPSPPPPPSTVLTSPSPPP---SPPPPRPPSPPPP 326

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 40/103 (38%), Positives = 54/103 (52%), Gaps = 5/103 (4%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQP---PAAATPPTATPPTATPPAAVPAPATPAPASS--PATSP 255
           P   P+ PP   P P   P   PA ++PP   PP   PP   P+P +P+P S   P+ SP
Sbjct: 166 PRPPPSPPPPRPPPPVVTPASRPADSSPPL--PPRPPPPPPSPSPPSPSPPSPSPPSPSP 223

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P+P+P S    +P P +  SPP+P+P S  P      +PP PS
Sbjct: 224 PSPSPPSPRPPSPRPPSP-SPPSPSPPSPRPPSPRPPSPPPPS 265

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 39/104 (37%), Positives = 56/104 (53%), Gaps = 8/104 (7%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS--PATSPPAPTP 240
           ++P  PP   P P +  P + +PP+ +PP+ +PP+  P+P +P P S   P+ SPP+P+P
Sbjct: 191 SSPPLPPRPPPPPPSPSPPSPSPPSPSPPSPSPPS--PSPPSPRPPSPRPPSPSPPSPSP 248

Query: 239 AS--TPSTAPTPSTAGSPPAPTPDSLGPGPSG----ADTPPSPS 126
            S   PS  P      SPP P+P    P P      +  PPSPS
Sbjct: 249 PSPRPPSPRPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPS 292

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 40/115 (34%), Positives = 55/115 (47%), Gaps = 9/115 (7%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAAT-------PPTATPPTATPPAAVPAPATP 285
           A S ++ +P   P  PP   P P    PA+         PP   PP  +P    P+P +P
Sbjct: 157 AQSPMSPSPPRPPPSPPPPRPPPPVVTPASRPADSSPPLPPRPPPPPPSPSPPSPSPPSP 216

Query: 284 APASS--PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           +P S   P+ SPP+P P S    +P+P +  SPP+P P S  P      +PP PS
Sbjct: 217 SPPSPSPPSPSPPSPRPPSPRPPSPSPPSP-SPPSPRPPSPRPPSPPPPSPPPPS 270

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 41/101 (40%), Positives = 52/101 (51%), Gaps = 7/101 (6%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPP----TATPPTATPPAAVPA--PATPAPASSPATSPPAP 246
           P +P T  P P AQ P + +PP    +  PP   PP   PA  PA  +P   P   PP P
Sbjct: 145 PPRPQTPPPPPPAQSPMSPSPPRPPPSPPPPRPPPPVVTPASRPADSSPPLPPRPPPPPP 204

Query: 245 TPASTPSTAPTPSTAG-SPPAPTPDSLGPGPSGADTPPSPS 126
           +P+    + P+PS    SPP+P+P S  P PS    PPSPS
Sbjct: 205 SPSPPSPSPPSPSPPSPSPPSPSPPSPRP-PS--PRPPSPS 242

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 41/108 (37%), Positives = 56/108 (51%), Gaps = 6/108 (5%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATP-APTAQPPAAATPPTATPPTATPPAAVPAPATPA-----PASS 270
           L   P   P  PP  +P +P+   P  + PP   PP    PA+ PA ++P      P   
Sbjct: 144 LPPRPQTPPPPPPAQSPMSPSPPRPPPSPPPPRPPPPVVTPASRPADSSPPLPPRPPPPP 203

Query: 269 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P+ SPP+P+P S    +P+P +  SPP+P P S  P PS   +PPSPS
Sbjct: 204 PSPSPPSPSPPSPSPPSPSPPSP-SPPSPRPPSPRP-PS--PSPPSPS 247

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 42/126 (33%), Positives = 54/126 (42%), Gaps = 25/126 (19%)
 Frame = -3

Query: 428 AQAPTAA----------PTKPPTATPAPTAQ------------PPAAATPP-TATPPTAT 318
           A APTAA          P +PP   P+P  +            PP    PP    P T  
Sbjct: 93  ADAPTAALIGGGNPSPRPPRPPPKPPSPPKKKKKKVKVKKRPPPPGPPLPPLPPRPQTPP 152

Query: 317 PPAAVPAPATPAPASSPATSPP--APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
           PP    +P +P+P   P + PP   P P  TP++ P  S+   PP P P    P P  + 
Sbjct: 153 PPPPAQSPMSPSPPRPPPSPPPPRPPPPVVTPASRPADSSPPLPPRPPPPPPSPSPP-SP 211

Query: 143 TPPSPS 126
           +PPSPS
Sbjct: 212 SPPSPS 217

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 42/105 (40%), Positives = 51/105 (48%), Gaps = 8/105 (7%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATP-------APASSPAT 261
           P   P  PP   P P   PP    PP  +P + +PP   P+P  P        PAS PA 
Sbjct: 135 PPPGPPLPPLP-PRPQTPPPP---PPAQSPMSPSPPRPPPSPPPPRPPPPVVTPASRPAD 190

Query: 260 SPPAPTPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSGADTPPSP 129
           S P P P   P   P+PS  + SPP+P+P S  P PS   +PPSP
Sbjct: 191 SSP-PLPPRPPPPPPSPSPPSPSPPSPSPPSPSP-PS--PSPPSP 231

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 37/117 (31%), Positives = 48/117 (41%), Gaps = 8/117 (6%)
 Frame = -3

Query: 455 LGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPA 276
           L L++   LA    A+P+  P   P  TA  P +  P    PP   PP    + AT  P 
Sbjct: 1   LSLMSCLGLAAGQQASPSPSPAPAPTATAPRPPSPAPVAPRPPLPRPPIGGASNATAVPR 60

Query: 275 SSPATSPPAPTP--ASTPSTAPTP---STAGSPPAPTPDSLG---PGPSGADTPPSP 129
             P  + P P+P   +TP   P P    +  S  APT   +G   P P     PP P
Sbjct: 61  PPPLLATPPPSPLTVATPGPVPAPMPGDSTDSADAPTAALIGGGNPSPRPPRPPPKP 117

 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 48/124 (38%), Positives = 57/124 (45%), Gaps = 15/124 (12%)
 Frame = -3

Query: 455 LGLLATSCLAQAPTAAPTKPPTAT-PAPTAQPPAAATPPTATPPT--ATPPAAVPAP--- 294
           LGL A    + +P+ AP   PTAT P P +  P A  PP   PP   A+   AVP P   
Sbjct: 7   LGLAAGQQASPSPSPAPA--PTATAPRPPSPAPVAPRPPLPRPPIGGASNATAVPRPPPL 64

Query: 293 -ATPAPASSPAT-SPPAPTPASTP----STAPTPSTA---GSPPAPTPDSLGPGPSGADT 141
            ATP P  SP T + P P PA  P     +A  P+ A   G  P+P P      P     
Sbjct: 65  LATPPP--SPLTVATPGPVPAPMPGDSTDSADAPTAALIGGGNPSPRP------PRPPPK 116

Query: 140 PPSP 129
           PPSP
Sbjct: 117 PPSP 120

[197][TOP]
>UniRef100_A8I1E4 Hydroxyproline-rich cell wall protein n=1 Tax=Chlamydomonas
           reinhardtii RepID=A8I1E4_CHLRE
          Length = 398

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 44/108 (40%), Positives = 65/108 (60%), Gaps = 7/108 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATP-PTATPPTATPPAAVPAP-----ATPAPASSPAT 261
           +P A+P+  P+ TP+P A P  + TP P A+P  +  P A P+P     A+P+P  SP  
Sbjct: 271 SPKASPS--PSPTPSPKASPSPSPTPSPKASPSPSPSPKASPSPTPSPKASPSPTPSPKA 328

Query: 260 SP-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
           SP P+P+P+++P  +PTPS AG+ P P P +  P P+  + PP P  A
Sbjct: 329 SPSPSPSPSTSPKVSPTPSPAGTAPKPAP-TPSPSPTKKNKPPPPEDA 375

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 49/138 (35%), Positives = 70/138 (50%), Gaps = 12/138 (8%)
 Frame = -3

Query: 479 AAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVP 300
           A V+      L A       PT +PT  P A+P+PT  P    +P  +  P+ +P A+  
Sbjct: 218 ATVKTIFTDALYAAIANTPIPTPSPTPSPKASPSPTPTPSPTPSPKASPSPSPSPKASPS 277

Query: 299 APATPAPASSPATSP-------PAPTPASTPSTAPTPSTAGSP-PAPTPD-SLGPGPSGA 147
              TP+P +SP+ SP       P+P+P+   S +PTPS   SP P P+P  S  P PS +
Sbjct: 278 PSPTPSPKASPSPSPTPSPKASPSPSPSPKASPSPTPSPKASPSPTPSPKASPSPSPSPS 337

Query: 146 DTP---PSPSAAFSYSKP 102
            +P   P+PS A +  KP
Sbjct: 338 TSPKVSPTPSPAGTAPKP 355

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 53/141 (37%), Positives = 74/141 (52%), Gaps = 8/141 (5%)
 Frame = -3

Query: 506 SLHPKMASSAAVQIFLIL---GLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTA 336
           S+H   A    + +FL     G    +    A  AA    P  TP+PT  P A+ + PT 
Sbjct: 197 SIHQFAAGQGTI-VFLAASFEGATVKTIFTDALYAAIANTPIPTPSPTPSPKASPS-PTP 254

Query: 335 TPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSP-PAPTP---DSL 168
           TP     P A P+P +P+P +SP+ S P P+P ++PS +PTPS   SP P+P+P    S 
Sbjct: 255 TPSPTPSPKASPSP-SPSPKASPSPS-PTPSPKASPSPSPTPSPKASPSPSPSPKASPSP 312

Query: 167 GPGPSGADTP-PSPSAAFSYS 108
            P P  + +P PSP A+ S S
Sbjct: 313 TPSPKASPSPTPSPKASPSPS 333

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 35/103 (33%), Positives = 52/103 (50%), Gaps = 7/103 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAP 246
           +P+ +PT  P A+P+P+  P   A+P  +  P A+P       A+P+P  SP  SP P+P
Sbjct: 275 SPSPSPTPSPKASPSPSPTPSPKASPSPSPSPKASPSPTPSPKASPSPTPSPKASPSPSP 334

Query: 245 TPAS------TPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           +P++      TPS A T       P+P+P      P   D PP
Sbjct: 335 SPSTSPKVSPTPSPAGTAPKPAPTPSPSPTKKNKPPPPEDAPP 377

[198][TOP]
>UniRef100_Q5NW24 Alkaline serine protease n=2 Tax=Archaea RepID=Q5NW24_9ARCH
          Length = 795

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 43/100 (43%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP- 255
           L   PT  PT  PTATP PT  P A  T      PT TP   V    TP P ++P  +P 
Sbjct: 396 LQVTPTPTPTPTPTATPTPTPTPTATPTATPTATPTPTPTPTVTPTVTPTPTATPTPTPT 455

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           P PTP  TP+  PTP+   +P A TP +  P P+   TPP
Sbjct: 456 PTPTPTVTPTVTPTPTPTATPTA-TPTAT-PTPTPTPTPP 493

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 43/100 (43%), Positives = 50/100 (50%), Gaps = 6/100 (6%)
 Frame = -3

Query: 458 ILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATP---PTATPPTATPPAAVPAPAT 288
           +L +  T      PTA PT  PT T  PTA P A  TP   PT TP     P A P P T
Sbjct: 395 VLQVTPTPTPTPTPTATPTPTPTPTATPTATPTATPTPTPTPTVTPTVTPTPTATPTP-T 453

Query: 287 PAPASSPATSP---PAPTPASTPSTAPTPSTAGSPPAPTP 177
           P P  +P  +P   P PTP +TP+  PT +T    P PTP
Sbjct: 454 PTPTPTPTVTPTVTPTPTPTATPTATPT-ATPTPTPTPTP 492

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 37/88 (42%), Positives = 43/88 (48%), Gaps = 3/88 (3%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           AT      PTA PT  PTATP PT   P     PT TP     P   P P TP P  +P 
Sbjct: 410 ATPTPTPTPTATPTATPTATPTPT---PTPTVTPTVTPTPTATPTPTPTP-TPTPTVTPT 465

Query: 263 TSP---PAPTPASTPSTAPTPSTAGSPP 189
            +P   P  TP +TP+  PTP+   +PP
Sbjct: 466 VTPTPTPTATPTATPTATPTPTPTPTPP 493

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 31/79 (39%), Positives = 36/79 (45%), Gaps = 3/79 (3%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
           T+     PTA PT  PT T  PT  P   ATP     PT TP        TP P ++P  
Sbjct: 419 TATPTATPTATPTPTPTPTVTPTVTPTPTATPTPTPTPTPTPTVTPTVTPTPTPTATPTA 478

Query: 260 SP---PAPTPASTPSTAPT 213
           +P   P PTP  TP  + T
Sbjct: 479 TPTATPTPTPTPTPPVSKT 497

[199][TOP]
>UniRef100_UPI00019857B8 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019857B8
          Length = 232

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 49/117 (41%), Positives = 65/117 (55%), Gaps = 5/117 (4%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           PTA+P  PP+ATPA    P    + P  +P + TPP+A P+     PA++PATSP A TP
Sbjct: 86  PTASPVTPPSATPA--VSPTTQVSSPVPSPESTTPPSASPSAT---PAATPATSPEASTP 140

Query: 239 ASTPSTAPTPSTAGSP-----PAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATA 84
           ++TP  A TP TA SP      A TP++ G  PS + TP      F  S P   A++
Sbjct: 141 SATPPEASTP-TAESPAEVPATATTPEAPGSIPSSSATPAESPEIFPSSSPPTPASS 196

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 11/116 (9%)
 Frame = -3

Query: 422 APTAAPTKPPTATP------APTAQPPAAA--TPPTATP---PTATPPAAVPAPATPAPA 276
           +P  +P  PP A+P      +P++ PP A+  TPP+ATP   PT    + VP+P +  P 
Sbjct: 60  SPVKSPVSPPAASPVQSPSESPSSSPPTASPVTPPSATPAVSPTTQVSSPVPSPESTTPP 119

Query: 275 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYS 108
           S+  ++ PA TPA++P  +   +T      PT +S    P+ A TP +P +  S S
Sbjct: 120 SASPSATPAATPATSPEASTPSATPPEASTPTAESPAEVPATATTPEAPGSIPSSS 175

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 46/129 (35%), Positives = 68/129 (52%), Gaps = 15/129 (11%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPA--------AATPPTATP--PTATPPAAVPAPA-TPA 282
           A AP  +P  P   +P+P + PPA        A TP +A+P     +PPAA P  + + +
Sbjct: 23  ANAPAPSPKSP--TSPSPASTPPAKSPESASPAKTPESASPVKSPVSPPAASPVQSPSES 80

Query: 281 PASSPATSPPAPTPASTPSTAPTPSTAGSPPAP---TPDSLGPGPSGADTP-PSPSAAFS 114
           P+SSP T+ P   P++TP+ +PT   +   P+P   TP S  P  + A TP  SP A+  
Sbjct: 81  PSSSPPTASPVTPPSATPAVSPTTQVSSPVPSPESTTPPSASPSATPAATPATSPEASTP 140

Query: 113 YSKPIIAAT 87
            + P  A+T
Sbjct: 141 SATPPEAST 149

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 43/145 (29%), Positives = 68/145 (46%), Gaps = 15/145 (10%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATP----PTATPPAAVP-- 300
           L++  L   C++ A        P  +P     P  A+TPP  +P    P  TP +A P  
Sbjct: 4   LVVVALLVLCVSGAGVVHGANAPAPSPKSPTSPSPASTPPAKSPESASPAKTPESASPVK 63

Query: 299 APATP-------APASSPATSPPAPTPASTPSTAP--TPSTAGSPPAPTPDSLGPGPSGA 147
           +P +P       +P+ SP++SPP  +P + PS  P  +P+T  S P P+P+S  P  +  
Sbjct: 64  SPVSPPAASPVQSPSESPSSSPPTASPVTPPSATPAVSPTTQVSSPVPSPESTTPPSASP 123

Query: 146 DTPPSPSAAFSYSKPIIAATALSAA 72
              P+ + A S      +AT   A+
Sbjct: 124 SATPAATPATSPEASTPSATPPEAS 148

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 40/118 (33%), Positives = 57/118 (48%), Gaps = 2/118 (1%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPA 237
           T  P+  P+ATPA T      A+ P+ATPP A+ P A      PA A++P      P+ +
Sbjct: 116 TTPPSASPSATPAATPATSPEASTPSATPPEASTPTAESPAEVPATATTPEAPGSIPSSS 175

Query: 236 STPSTAPTPSTAGSPPAPTPDS--LGPGPSGADTPPSPSAAFSYSKPIIAATALSAAL 69
           +TP+ +P    + SPP P   S     GP   D+   P      +  I++  AL AAL
Sbjct: 176 ATPAESPEIFPSSSPPTPASSSPETAEGPVNDDSGSEP---VYRTGVILSGLALLAAL 230

[200][TOP]
>UniRef100_Q65553 UL36 n=3 Tax=Bovine herpesvirus 1 RepID=Q65553_9ALPH
          Length = 3247

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 55/134 (41%), Positives = 63/134 (47%), Gaps = 15/134 (11%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATP-PTATPPAAVPAPATPAPASSPATSP 255
            L  AP   P  PP   PAP   PPA   PP A P P   PP   PAP+T AP  +P   P
Sbjct: 2621 LPPAPPLPPPAPPLPPPAPPLPPPAPPLPPPAPPLPPPAPPLPPPAPST-APVPAPPLPP 2679

Query: 254  PAPTPASTPSTAPTPSTAGSPPAPTPDSL-----------GPGPSGADTP---PSPSAAF 117
            PA TPA TP  APTP+   +PP P P  +            P P+ A TP   P+P+   
Sbjct: 2680 PALTPALTP--APTPAPTPAPPLPLPAPITVLVPAPVPAPAPIPAPAPTPAPAPTPAPPL 2737

Query: 116  SYSKPIIAATALSA 75
                P  A  ALSA
Sbjct: 2738 PPPAPDGAMGALSA 2751

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 48/103 (46%), Positives = 52/103 (50%), Gaps = 3/103 (2%)
 Frame = -3

Query: 428  AQAPTAAPTKPP--TATPAPTAQPPAAATPPTATP-PTATPPAAVPAPATPAPASSPATS 258
            A   +AAP  PP     PAP   PPA   PP A P P   PP   PAP  P PA      
Sbjct: 2606 ASLVSAAPPVPPGPRLPPAPPLPPPAPPLPPPAPPLPPPAPPLPPPAPPLPPPA------ 2659

Query: 257  PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            PP P PA  PSTAP P+    PPA TP +L P P+ A TP  P
Sbjct: 2660 PPLPPPA--PSTAPVPAPPLPPPALTP-ALTPAPTPAPTPAPP 2699

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 37/116 (31%), Positives = 48/116 (41%), Gaps = 4/116 (3%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAP-TAQPPAAATPPT---ATPPTATPPAAVPAPATPAPASSPA 264
            L   P+  P++PP+  P P    PP+    P    A PP    PA  PAP  PAP  +P 
Sbjct: 2799 LGSPPSFVPSRPPSLEPVPGLPLPPSRVQAPVDAPAPPPAPERPAPPPAPERPAPPPAPE 2858

Query: 263  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPII 96
               P P P   P+  P P     PPAP   +     SG+  P   +A      P +
Sbjct: 2859 RPAPPPAP-ERPAPPPAPERPAPPPAPERPATAV-QSGSKIPAPSNALVGQVAPAL 2912

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 41/91 (45%), Positives = 47/91 (51%), Gaps = 8/91 (8%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATP-APTAQPPAAATPPTATPPTATP--PAAVPAPATPAPA- 276
            A + L   P A P  PP A P AP   PP A  PP A PP A P  P A+PAP + APA 
Sbjct: 2999 AAASLPAPPIAPPIAPPIAPPIAPPIAPPIA--PPIA-PPIAPPIAPPAMPAPPSAAPAT 3055

Query: 275  ---SSPATSPPA-PTPASTPSTAPTPSTAGS 195
               S+P  +PPA P P   P  AP P   G+
Sbjct: 3056 AGSSAPPIAPPATPAPLIAPLAAPVPRLVGA 3086

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 45/114 (39%), Positives = 55/114 (48%), Gaps = 1/114 (0%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
            AP AAP  P +A PAP  + PAAA+ P   PP A PP A P     AP  +P  +PP   
Sbjct: 2979 APLAAPPAP-SALPAPRLEAPAAASLPA--PPIA-PPIAPPIAPPIAPPIAPPIAPPIAP 3034

Query: 242  PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP-SPSAAFSYSKPIIAATA 84
            P + P  AP       P  P P S  P  +G+  PP +P A      P+IA  A
Sbjct: 3035 PIA-PPIAP-------PAMPAPPSAAPATAGSSAPPIAPPAT---PAPLIAPLA 3077

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 46/130 (35%), Positives = 51/130 (39%), Gaps = 8/130 (6%)
 Frame = -3

Query: 497  PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT 318
            P    S    +  + GL       QAP  AP  PP   P   A PPA   P  A PP   
Sbjct: 2803 PSFVPSRPPSLEPVPGLPLPPSRVQAPVDAPAPPPA--PERPAPPPAPERP--APPPAPE 2858

Query: 317  PPAAVPAPATPAPASSPATSPPAPTPASTPSTA-------PTPSTA-GSPPAPTPDSLGP 162
             PA  PAP  PAP  +P    P P P   P+TA       P PS A     AP     GP
Sbjct: 2859 RPAPPPAPERPAPPPAPERPAPPPAP-ERPATAVQSGSKIPAPSNALVGQVAPALLRRGP 2917

Query: 161  GPSGADTPPS 132
             P G    P+
Sbjct: 2918 SPRGKPGAPA 2927

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 36/119 (30%), Positives = 52/119 (43%), Gaps = 9/119 (7%)
 Frame = -3

Query: 404  TKPPTATPAPTAQ---PP---AAATPPTATPPTATPPAAVPAPATPAPAS---SPATSPP 252
            ++ P + PAP ++   PP   A  +PP+  P  + PP+  P P  P P S   +P  +P 
Sbjct: 2777 SRSPASVPAPGSELVPPPSGGALGSPPSFVP--SRPPSLEPVPGLPLPPSRVQAPVDAPA 2834

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSA 75
             P     P+  P P     PPAP   +  P P     PP+P        P   ATA+ +
Sbjct: 2835 PPPAPERPAPPPAPERPAPPPAPERPAPPPAPERPAPPPAPERPAPPPAPERPATAVQS 2893

 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 58/164 (35%), Positives = 61/164 (37%), Gaps = 40/164 (24%)
 Frame = -3

Query: 503  LHPKMASSAAVQIFLILGLLATSCLAQAPTAAPTK-PPTATPAP-TAQPPAAATPPTATP 330
            L P   S+A V    +     T  L  APT APT  PP   PAP T   PA    P   P
Sbjct: 2662 LPPPAPSTAPVPAPPLPPPALTPALTPAPTPAPTPAPPLPLPAPITVLVPAPVPAPAPIP 2721

Query: 329  -PTATP-PAAVPAPATPAPA----------------------SSPATSP---------PA 249
             P  TP PA  PAP  P PA                      S PA  P         PA
Sbjct: 2722 APAPTPAPAPTPAPPLPPPAPDGAMGALSATRRPTRRAGARKSLPAAQPRQRLLRSRSPA 2781

Query: 248  PTPASTPSTAPTPS--TAGSPPA---PTPDSLGPGPSGADTPPS 132
              PA      P PS    GSPP+     P SL P P G   PPS
Sbjct: 2782 SVPAPGSELVPPPSGGALGSPPSFVPSRPPSLEPVP-GLPLPPS 2824

[201][TOP]
>UniRef100_Q2JUL3 Putative lipoprotein n=1 Tax=Synechococcus sp. JA-3-3Ab
           RepID=Q2JUL3_SYNJA
          Length = 221

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 53/163 (32%), Positives = 73/163 (44%), Gaps = 5/163 (3%)
 Frame = -3

Query: 527 FLSKF*ISLHPKMASSAAVQIFLILGLLATSCLAQA---PTAAPTKPPTATPAPTAQPPA 357
           F + + +SL   + ++A   + +  G  +   L  A   PT  PT  P  TP PT  P  
Sbjct: 6   FPTNWRVSLVSSVLAAALAGLVVACGSSSRDPLTVATPTPTPTPTPTPVPTPTPTPTPTP 65

Query: 356 AATPPTATPPTATP-PAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSP-PAP 183
             TP     PTATP P   P P TP P  +P T  P PTP  TP+  PTP+   +P P P
Sbjct: 66  TPTPTPTPTPTATPTPTPTPTP-TPTPTPTP-TPTPTPTPTPTPTPTPTPTPTPTPTPTP 123

Query: 182 TPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAALFAIAF 54
           TP   GP  +    P   +     +   + AT+ S +   + F
Sbjct: 124 TPTPAGPRITIPGLPAGATVTIRQADGTVIATSTSVSGDVVIF 166

[202][TOP]
>UniRef100_C5BJL6 Conserved repeat domain protein n=1 Tax=Teredinibacter turnerae T7901
            RepID=C5BJL6_TERTT
          Length = 3228

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 57/128 (44%), Positives = 68/128 (53%), Gaps = 7/128 (5%)
 Frame = -3

Query: 488  ASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP 315
            A++AAV I   +   AT      P+ +P+  PT TP PTA P   ATP PT TP PT TP
Sbjct: 1989 ATNAAVNI--AIAPAATPTPTPVPSPSPSATPTTTPIPTATPAPTATPVPTVTPAPTVTP 2046

Query: 314  -PAAVPAP-ATPAPASSPATS--PPA-PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG 150
             P A P P ATP P  +P  S  P A PTP +TPS   TP  + +P      S  P PS 
Sbjct: 2047 SPTATPVPSATPTPTVTPVPSVVPSATPTPTTTPSPTATPVPSATPTVTPVPSATPSPS- 2105

Query: 149  ADTPPSPS 126
              TP SP+
Sbjct: 2106 -PTPVSPN 2112

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 54/127 (42%), Positives = 71/127 (55%), Gaps = 14/127 (11%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQP-----PAAATPPTATP-PTATP-PAAVPAP-ATPAPA 276
            +A AP A PT  P  +P+P+A P     P A   PTATP PT TP P   P+P ATP P+
Sbjct: 1996 IAIAPAATPTPTPVPSPSPSATPTTTPIPTATPAPTATPVPTVTPAPTVTPSPTATPVPS 2055

Query: 275  SSPATSPPAPTPASTPSTAPTPSTAGSP-----PAPTPDSLGPGPSGADTP-PSPSAAFS 114
            ++P T    P P+  PS  PTP+T  SP     P+ TP ++ P PS   +P P+P    S
Sbjct: 2056 ATP-TPTVTPVPSVVPSATPTPTTTPSPTATPVPSATP-TVTPVPSATPSPSPTP---VS 2110

Query: 113  YSKPIIA 93
             +KP +A
Sbjct: 2111 PNKPPVA 2117

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 48/96 (50%), Positives = 56/96 (58%), Gaps = 3/96 (3%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATPPAAVPAPATPAPASSPATSPPA 249
            APTA P   PT TPAPT  P   ATP P+ATP PT TP  +V   ATP P ++P  SP A
Sbjct: 2029 APTATPV--PTVTPAPTVTPSPTATPVPSATPTPTVTPVPSVVPSATPTPTTTP--SPTA 2084

Query: 248  -PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
             P P++TP+  P PS   S P+PTP S    P   D
Sbjct: 2085 TPVPSATPTVTPVPSATPS-PSPTPVSPNKPPVAQD 2119

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 51/127 (40%), Positives = 59/127 (46%), Gaps = 16/127 (12%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTK---PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP-ATPAPAS 273
            T  LA A T A       P ATP PT   P  +  P+ATP T   P A PAP ATP P  
Sbjct: 1982 TDGLAYAATNAAVNIAIAPAATPTPT---PVPSPSPSATPTTTPIPTATPAPTATPVPTV 2038

Query: 272  SPA-TSPPAPTPASTPSTAPTPSTAGSP---PAPTP-DSLGPGPSGADTP-------PSP 129
            +PA T  P+PT    PS  PTP+    P   P+ TP  +  P P+    P       P P
Sbjct: 2039 TPAPTVTPSPTATPVPSATPTPTVTPVPSVVPSATPTPTTTPSPTATPVPSATPTVTPVP 2098

Query: 128  SAAFSYS 108
            SA  S S
Sbjct: 2099 SATPSPS 2105

[203][TOP]
>UniRef100_A3NTR5 Putative lipoprotein n=2 Tax=Burkholderia pseudomallei
           RepID=A3NTR5_BURP0
          Length = 468

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 60/172 (34%), Positives = 82/172 (47%), Gaps = 25/172 (14%)
 Frame = -3

Query: 497 PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPT--ATPAPT-----AQPPAAATPPT 339
           P  ASSAA        + A +     P A+    P   A PAP      A  P AA+ P 
Sbjct: 224 PVPASSAAPGTSASSAVAAPAAAGSGPAASAPAAPVRHAAPAPASATAAASAPTAASAPA 283

Query: 338 ATPPTATPPAAVPAPAT-PAPASSPATSP---------PAPTPASTPSTAPTPSTAGSP- 192
            TP +A  PA+ PAPA+ P PAS+P  +P         PAP PAS P++ P P++A +P 
Sbjct: 284 PTPASAPAPASTPAPASAPTPASAPTPTPASAPTPASIPAPAPASAPASTPAPASAPAPA 343

Query: 191 --PAPTP-----DSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAALFAIA 57
             PAP P      S+ P  +   +   P+ A  ++  + A TA SA+  A A
Sbjct: 344 SAPAPAPTTNPASSIAPAAAPFASAIPPARAEKFAPAVTATTAGSASTPASA 395

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 47/120 (39%), Positives = 61/120 (50%), Gaps = 6/120 (5%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPPAAATPPTATP------PTATPPAAVPAPATPAPASSPATSPP 252
           AAPT P    PA +A P  +A+   A P      P A+ PAA    A PAPAS+ A +  
Sbjct: 216 AAPTPPAAPVPASSAAPGTSASSAVAAPAAAGSGPAASAPAAPVRHAAPAPASATAAAS- 274

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
           APT AS P  APTP++A +P +    +  P P+ A TP   SA    S P  A  +  A+
Sbjct: 275 APTAASAP--APTPASAPAPASTPAPASAPTPASAPTPTPASAPTPASIPAPAPASAPAS 332

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 49/131 (37%), Positives = 68/131 (51%), Gaps = 12/131 (9%)
 Frame = -3

Query: 428 AQAPTAAPTKPPT-ATPAPTAQP-PAAATPP--TATPPTATPPAAVPAPATPAPASSPAT 261
           A+    AP K  T A P P A P PA++  P  +A+   A P AA   PA  APA+    
Sbjct: 202 AETAEGAPMKLKTPAAPTPPAAPVPASSAAPGTSASSAVAAPAAAGSGPAASAPAAPVRH 261

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSL-----GPGPSGADTP---PSPSAAFSYSK 105
           + PAP  A+  ++APT ++A   PAPTP S       P P+ A TP   P+P+ A + + 
Sbjct: 262 AAPAPASATAAASAPTAASA---PAPTPASAPAPASTPAPASAPTPASAPTPTPASAPTP 318

Query: 104 PIIAATALSAA 72
             I A A ++A
Sbjct: 319 ASIPAPAPASA 329

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 43/126 (34%), Positives = 58/126 (46%), Gaps = 4/126 (3%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           AP +AP       PAPT  P ++  P  A   +A PPA        A   +PA +     
Sbjct: 335 APASAPAPASAPAPAPTTNPASSIAPAAAPFASAIPPAR-------AEKFAPAVTATTAG 387

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPII----AATALSA 75
            ASTP++A  PS+  SP +P    L P P  +   PSP A  + + P+      ATA +A
Sbjct: 388 SASTPASAAAPSSPSSPSSPWLPPLLP-PLLSPDAPSPPADTARTAPLAPAASPATAAAA 446

Query: 74  ALFAIA 57
           A  A A
Sbjct: 447 ATNATA 452

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 43/119 (36%), Positives = 55/119 (46%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           A AP +AP   PT  PA ++  PAAA   +A PP      A    AT A ++S   S  A
Sbjct: 339 APAPASAPAPAPTTNPA-SSIAPAAAPFASAIPPARAEKFAPAVTATTAGSASTPASAAA 397

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
           P+  S+PS+   P     PP  +PD+  P    A T P   AA     P  AA A + A
Sbjct: 398 PSSPSSPSSPWLPPLL--PPLLSPDAPSPPADTARTAPLAPAA----SPATAAAAATNA 450

[204][TOP]
>UniRef100_B1HHR0 Putative lipoprotein n=1 Tax=Burkholderia pseudomallei S13
           RepID=B1HHR0_BURPS
          Length = 515

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 60/172 (34%), Positives = 82/172 (47%), Gaps = 25/172 (14%)
 Frame = -3

Query: 497 PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPT--ATPAPT-----AQPPAAATPPT 339
           P  ASSAA        + A +     P A+    P   A PAP      A  P AA+ P 
Sbjct: 271 PVPASSAAPGTSASSAVAAPAAAGSGPAASAPAAPVRHAAPAPASATAAASAPTAASAPA 330

Query: 338 ATPPTATPPAAVPAPAT-PAPASSPATSP---------PAPTPASTPSTAPTPSTAGSP- 192
            TP +A  PA+ PAPA+ P PAS+P  +P         PAP PAS P++ P P++A +P 
Sbjct: 331 PTPASAPAPASTPAPASAPTPASAPTPTPASAPTPASIPAPAPASAPASTPAPASAPAPA 390

Query: 191 --PAPTP-----DSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAALFAIA 57
             PAP P      S+ P  +   +   P+ A  ++  + A TA SA+  A A
Sbjct: 391 SAPAPAPTTNPASSIAPAAAPFASAIPPARAEKFAPAVTATTAGSASTPASA 442

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 47/120 (39%), Positives = 61/120 (50%), Gaps = 6/120 (5%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPPAAATPPTATP------PTATPPAAVPAPATPAPASSPATSPP 252
           AAPT P    PA +A P  +A+   A P      P A+ PAA    A PAPAS+ A +  
Sbjct: 263 AAPTPPAAPVPASSAAPGTSASSAVAAPAAAGSGPAASAPAAPVRHAAPAPASATAAAS- 321

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
           APT AS P  APTP++A +P +    +  P P+ A TP   SA    S P  A  +  A+
Sbjct: 322 APTAASAP--APTPASAPAPASTPAPASAPTPASAPTPTPASAPTPASIPAPAPASAPAS 379

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 49/131 (37%), Positives = 68/131 (51%), Gaps = 12/131 (9%)
 Frame = -3

Query: 428 AQAPTAAPTKPPT-ATPAPTAQP-PAAATPP--TATPPTATPPAAVPAPATPAPASSPAT 261
           A+    AP K  T A P P A P PA++  P  +A+   A P AA   PA  APA+    
Sbjct: 249 AETAEGAPMKLKTPAAPTPPAAPVPASSAAPGTSASSAVAAPAAAGSGPAASAPAAPVRH 308

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAPTPDSL-----GPGPSGADTP---PSPSAAFSYSK 105
           + PAP  A+  ++APT ++A   PAPTP S       P P+ A TP   P+P+ A + + 
Sbjct: 309 AAPAPASATAAASAPTAASA---PAPTPASAPAPASTPAPASAPTPASAPTPTPASAPTP 365

Query: 104 PIIAATALSAA 72
             I A A ++A
Sbjct: 366 ASIPAPAPASA 376

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 43/126 (34%), Positives = 58/126 (46%), Gaps = 4/126 (3%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           AP +AP       PAPT  P ++  P  A   +A PPA        A   +PA +     
Sbjct: 382 APASAPAPASAPAPAPTTNPASSIAPAAAPFASAIPPAR-------AEKFAPAVTATTAG 434

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPII----AATALSA 75
            ASTP++A  PS+  SP +P    L P P  +   PSP A  + + P+      ATA +A
Sbjct: 435 SASTPASAAAPSSPSSPSSPWLPPLLP-PLLSPDAPSPPADTARTAPLAPAASPATAAAA 493

Query: 74  ALFAIA 57
           A  A A
Sbjct: 494 ATNATA 499

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 43/119 (36%), Positives = 55/119 (46%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           A AP +AP   PT  PA ++  PAAA   +A PP      A    AT A ++S   S  A
Sbjct: 386 APAPASAPAPAPTTNPA-SSIAPAAAPFASAIPPARAEKFAPAVTATTAGSASTPASAAA 444

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
           P+  S+PS+   P     PP  +PD+  P    A T P   AA     P  AA A + A
Sbjct: 445 PSSPSSPSSPWLPPLL--PPLLSPDAPSPPADTARTAPLAPAA----SPATAAAAATNA 497

[205][TOP]
>UniRef100_Q39353 Cell wall-plasma membrane linker protein n=1 Tax=Brassica napus
           RepID=Q39353_BRANA
          Length = 376

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 43/98 (43%), Positives = 49/98 (50%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           PT  P   PT TP P   PP   TPPT TPP  TPP   P   TP   + P  +PP PTP
Sbjct: 167 PTVCPPPTPTPTP-PVVTPP---TPPTPTPPVVTPPTPAPPVVTPPTPTPPVVTPPTPTP 222

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
                T PTP    +PP PTP  + P      TPP+P+
Sbjct: 223 PVV--TPPTPPVV-TPPTPTPPVVTPPTPPVVTPPTPT 257

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 40/104 (38%), Positives = 46/104 (44%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA--- 249
           PT  PT P    P P    P   TPPT  PP  TPP   P   TP   + P  +PP    
Sbjct: 173 PTPTPTPPVVTPPTPPTPTPPVVTPPTPAPPVVTPPTPTPPVVTPPTPTPPVVTPPTPPV 232

Query: 248 ---PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
              PTP     T PTP    +PP PTP  + P      TPP+P+
Sbjct: 233 VTPPTPTPPVVTPPTPPVV-TPPTPTPPVVTPPTPPVVTPPTPT 275

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 39/95 (41%), Positives = 46/95 (48%), Gaps = 1/95 (1%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATP-PTATPPAAVPAPATPAPASSPATSPPAPTPAST 231
           PTKPPT  P P+   P    PPT  P PT TP   V  P TP   + P  +PP P P   
Sbjct: 146 PTKPPTVKPPPSTPKPPTHKPPTVCPPPTPTPTPPVVTPPTPPTPTPPVVTPPTPAPPVV 205

Query: 230 PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
               PTP    +PP PTP  + P      TPP+P+
Sbjct: 206 TPPTPTPPVV-TPPTPTPPVVTPPTPPVVTPPTPT 239

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 44/102 (43%), Positives = 53/102 (51%), Gaps = 4/102 (3%)
 Frame = -3

Query: 419 PTAAPT-KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS-SPATSPPAP 246
           PT  PT KPP +TP P  +PP    PP+   P   PP   P P+TP P +  P T  P P
Sbjct: 114 PTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTHKPPTVCPPP 173

Query: 245 TPASTPS--TAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           TP  TP   T PTP T  +PP  TP +  P      TPP+P+
Sbjct: 174 TPTPTPPVVTPPTPPTP-TPPVVTPPTPAP---PVVTPPTPT 211

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 39/102 (38%), Positives = 48/102 (47%), Gaps = 7/102 (6%)
 Frame = -3

Query: 419 PTAAP---TKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           PT  P    KPPT  P P  +PP    PP+   P   PP   P P+TP P + P T  P 
Sbjct: 81  PTVRPHPHPKPPTK-PHPIPKPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPP 139

Query: 248 PT----PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           P+    P   P+  P PST   PP   P ++ P P+   TPP
Sbjct: 140 PSTPKPPTKPPTVKPPPSTP-KPPTHKPPTVCPPPTPTPTPP 180

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 42/91 (46%), Positives = 47/91 (51%), Gaps = 10/91 (10%)
 Frame = -3

Query: 419 PTAAP--TKPPTATPA----PTAQPPAAA--TPPTATPPTATPPAAVPAPATPAPASSPA 264
           PT AP    PPT TP     PT  PP     TPP  TPPT TPP  V  P TP   + P 
Sbjct: 198 PTPAPPVVTPPTPTPPVVTPPTPTPPVVTPPTPPVVTPPTPTPP--VVTPPTPPVVTPPT 255

Query: 263 TSPPAPTPASTP-STAPTPS-TAGSPPAPTP 177
            +PP  TP + P  T PTP+    +PP PTP
Sbjct: 256 PTPPVVTPPTPPVVTPPTPTPPVVTPPTPTP 286

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 34/82 (41%), Positives = 36/82 (43%), Gaps = 2/82 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAA--TPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           P   P  PP  TP PT  PP     TPP  TPPT TPP   P    P P   P  +PP P
Sbjct: 223 PVVTPPTPPVVTP-PTPTPPVVTPPTPPVVTPPTPTPPVVTP----PTP---PVVTPPTP 274

Query: 245 TPASTPSTAPTPSTAGSPPAPT 180
           TP       PTP    + P  T
Sbjct: 275 TPPVVTPPTPTPPKPETCPIDT 296

[206][TOP]
>UniRef100_Q1EP18 Protein kinase family protein n=1 Tax=Musa balbisiana
           RepID=Q1EP18_MUSBA
          Length = 637

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 45/106 (42%), Positives = 54/106 (50%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P  +P    T  P P+A PP AA PP   PP ATPP     P  P+    P  SPP P  
Sbjct: 87  PALSPPPASTPPPPPSASPPPAAAPPP--PPFATPPPTNSPPPPPSATPPPTISPPPPGS 144

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            S P+ AP+ ST G+PPAP      P P    +PPSPS + S+  P
Sbjct: 145 QSPPARAPSNSTGGTPPAP------PKP---PSPPSPSPSASHRAP 181

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 48/122 (39%), Positives = 58/122 (47%), Gaps = 13/122 (10%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV----PAPATPAPASSP-- 267
           + +P  AP  PP   P P + PPA++ PPT  PP   PP  V    P P  P P+ SP  
Sbjct: 29  SNSPPPAPNAPPP--PTPPSPPPASSPPPTPPPPADVPPPPVVTSPPPPDPPPPSVSPPP 86

Query: 266 --ATSPPAPTPASTPSTAPTPSTAGSPP---APTPDSLGPGPSGADTPP--SPSAAFSYS 108
              + PPA TP   PS +P P+ A  PP    P P +  P P  A  PP  SP    S S
Sbjct: 87  PALSPPPASTPPPPPSASPPPAAAPPPPPFATPPPTNSPPPPPSATPPPTISPPPPGSQS 146

Query: 107 KP 102
            P
Sbjct: 147 PP 148

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 46/112 (41%), Positives = 59/112 (52%), Gaps = 13/112 (11%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPP---TATPPTATPPAAV--PAPA-TPAPASSP 267
           A  P   P+ PP ++P PT  PPA   PP   T+ PP   PP +V  P PA +P PAS+P
Sbjct: 38  APPPPTPPSPPPASSPPPTPPPPADVPPPPVVTSPPPPDPPPPSVSPPPPALSPPPASTP 97

Query: 266 ATSPPA-PTPASTPSTAP--TPSTAGSPPAPT----PDSLGPGPSGADTPPS 132
              P A P PA+ P   P  TP    SPP P     P ++ P P G+ +PP+
Sbjct: 98  PPPPSASPPPAAAPPPPPFATPPPTNSPPPPPSATPPPTISPPPPGSQSPPA 149

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 44/107 (41%), Positives = 53/107 (49%), Gaps = 9/107 (8%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQ--PPAAATPPTATPPTATPPAAVPAPATPAPASSP---- 267
           A  P+ +P  P + +P P +   PPA   PP  TPP+  PPA+ P P  P PA  P    
Sbjct: 10  ATPPSTSPPPPSSLSPPPASNSPPPAPNAPPPPTPPSP-PPASSPPPTPPPPADVPPPPV 68

Query: 266 ATSPPAPTPASTPSTAPTPSTAGSPPA---PTPDSLGPGPSGADTPP 135
            TSPP P P   PS +P P     PPA   P P S  P P+ A  PP
Sbjct: 69  VTSPPPPDP-PPPSVSPPPPALSPPPASTPPPPPSASPPPAAAPPPP 114

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 41/98 (41%), Positives = 53/98 (54%), Gaps = 2/98 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPP--TATPPAAVPAPATPAPASSPATSPPAP 246
           P AAP  PP ATP PT  PP    PP+ATPP   + PP    +P   AP++S   +PPAP
Sbjct: 107 PAAAPPPPPFATPPPTNSPP---PPPSATPPPTISPPPPGSQSPPARAPSNSTGGTPPAP 163

Query: 245 TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
                P + P+PS + S  AP  D + P  +G+  P S
Sbjct: 164 ---PKPPSPPSPSPSASHRAPA-DPISPSSNGSGIPTS 197

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 40/104 (38%), Positives = 51/104 (49%), Gaps = 6/104 (5%)
 Frame = -3

Query: 413 AAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAS 234
           ++P   P+ATP  T+ PP ++  P   P + +PP A  AP  P P S P  S P PTP  
Sbjct: 2   SSPPPSPSATPPSTSPPPPSSLSPP--PASNSPPPAPNAPPPPTPPSPPPASSPPPTPPP 59

Query: 233 TPSTAPTP-STAGSPPAPTPDSLGP-----GPSGADTPPSPSAA 120
                P P  T+  PP P P S+ P      P  A TPP P +A
Sbjct: 60  PADVPPPPVVTSPPPPDPPPPSVSPPPPALSPPPASTPPPPPSA 103

[207][TOP]
>UniRef100_C3Z6S3 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae
           RepID=C3Z6S3_BRAFL
          Length = 192

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 49/125 (39%), Positives = 51/125 (40%), Gaps = 27/125 (21%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAA-------TPPTATPPTATPPAAVPAPATPAPASSPA- 264
           P  AP  PP A P P A PP  A        PP A PP   PP A PAP  PAP  +PA 
Sbjct: 30  PPIAPPPPPIAPPPPIAPPPPIAPPPPMDPPPPMAPPPPPPPPPAAPAPPVPAPVPTPAP 89

Query: 263 -------------TSPPAPTPASTPSTAPTP---STAGSP---PAPTPDSLGPGPSGADT 141
                          PP P P   P   P P   S  G P   PAP PD   P P   D 
Sbjct: 90  PSITPVPPPPPPVAPPPLPPPLMPPPLPPAPNQDSRKGKPSPVPAPPPDPPAPAPPDPDP 149

Query: 140 PPSPS 126
           PP P+
Sbjct: 150 PPPPA 154

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 44/103 (42%), Positives = 47/103 (45%), Gaps = 2/103 (1%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAP--ASSPATS 258
           +A APTA P  PP A P P A PP    PP A PP   PP A P P  P P  A  P   
Sbjct: 4   VAPAPTAPP--PPIAPPPPIAPPPMDPPPPIAPPP---PPIAPPPPIAPPPPIAPPPPMD 58

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           P  P P + P   P P  A +PP P P      PS    PP P
Sbjct: 59  P--PPPMAPPPPPPPPPAAPAPPVPAPVPTPAPPSITPVPPPP 99

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 35/88 (39%), Positives = 39/88 (44%), Gaps = 4/88 (4%)
 Frame = -3

Query: 419 PTAAPTKP---PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           P AAP  P   P  TPAP +  P    PP   PP   PP  +P P  PAP        P+
Sbjct: 72  PPAAPAPPVPAPVPTPAPPSITPVPPPPPPVAPP-PLPPPLMPPPLPPAPNQDSRKGKPS 130

Query: 248 PTPASTPS-TAPTPSTAGSPPAPTPDSL 168
           P PA  P   AP P     PP P P S+
Sbjct: 131 PVPAPPPDPPAPAPPDPDPPPPPAPISI 158

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 37/96 (38%), Positives = 41/96 (42%), Gaps = 3/96 (3%)
 Frame = -3

Query: 374 TAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP--ASTPSTAPTPSTA 201
           T   PA   PP   PP A PP   P P  P P  +P   P AP P  A  P  AP P   
Sbjct: 2   TIVAPAPTAPP---PPIAPPPPIAPPPMDPPPPIAPPPPPIAPPPPIAPPPPIAPPPPMD 58

Query: 200 GSPP-APTPDSLGPGPSGADTPPSPSAAFSYSKPII 96
             PP AP P    P P  A  PP P+   + + P I
Sbjct: 59  PPPPMAPPPPP--PPPPAAPAPPVPAPVPTPAPPSI 92

[208][TOP]
>UniRef100_C3YC75 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae
            RepID=C3YC75_BRAFL
          Length = 2187

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 48/100 (48%), Positives = 52/100 (52%), Gaps = 8/100 (8%)
 Frame = -3

Query: 410  APTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT----PAPASS--PATSPPA 249
            +P  PP A P P A PP A  PP A  P   PPAA P+PA     P PAS   PA  PP 
Sbjct: 1924 SPGPPPAAGPPPAAGPPPAVGPPPAAGPPGPPPAAEPSPAAGPPGPPPASGPPPAAGPPG 1983

Query: 248  PTPASTPSTAPTPSTAGSPPA--PTPDSLGPGPSGADTPP 135
            P PAS P  A  P   G PPA  P+P +  PGP  A  PP
Sbjct: 1984 PPPASGPPPAAGP--PGPPPAAEPSPAAGPPGPPPASGPP 2021

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 46/110 (41%), Positives = 54/110 (49%), Gaps = 11/110 (10%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP--AP 246
            P A P  PP   P P A PP AA PP+A  P   PPA+ P PA   P   PA  PP  A 
Sbjct: 1851 PVAGP--PPATGPPPAAGPPPAAGPPSAVDPLGPPPASGPPPAAGPPGPLPAAGPPPAAG 1908

Query: 245  TPASTPSTAPTPS--------TAGSPPAP-TPDSLGPGPSGADTPPSPSA 123
            TP   PS+ P P+         AG PPA   P ++GP P+     P P+A
Sbjct: 1909 TPGPPPSSGPPPAAGSPGPPPAAGPPPAAGPPPAVGPPPAAGPPGPPPAA 1958

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 51/110 (46%), Positives = 55/110 (50%), Gaps = 8/110 (7%)
 Frame = -3

Query: 428  AQAPTAA--PTKPPTATPAPTA----QPPAAATPPTATPPTAT--PPAAVPAPATPAPAS 273
            A  P AA  P  PP++ P P A     PPAA  PP A PP A   PPAA P    PA   
Sbjct: 1901 AGPPPAAGTPGPPPSSGPPPAAGSPGPPPAAGPPPAAGPPPAVGPPPAAGPPGPPPAAEP 1960

Query: 272  SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
            SPA  PP P PAS P     P  AG PP P P S GP P+     P P+A
Sbjct: 1961 SPAAGPPGPPPASGP-----PPAAG-PPGPPPAS-GPPPAAGPPGPPPAA 2003

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 44/107 (41%), Positives = 46/107 (42%), Gaps = 4/107 (3%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTA----QPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT 261
            A  P  A   PP   P P A     PPAA   P A PP   PPA+ P PA   P   PA+
Sbjct: 1930 AAGPPPAAGPPPAVGPPPAAGPPGPPPAAEPSPAAGPP-GPPPASGPPPAAGPPGPPPAS 1988

Query: 260  SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
             PP       P  A  PS A  PP P P S   GP  A  PP P  A
Sbjct: 1989 GPPPAAGPPGPPPAAEPSPAAGPPGPPPAS---GPPPAAGPPGPPPA 2032

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 46/99 (46%), Positives = 50/99 (50%), Gaps = 4/99 (4%)
 Frame = -3

Query: 419  PTAA--PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
            P AA  P  PP A P+P A PP    PP A+ P   PPAA P    PA    PA  PP P
Sbjct: 1946 PPAAGPPGPPPAAEPSPAAGPPG---PPPASGP---PPAAGPPGPPPASGPPPAAGPPGP 1999

Query: 245  TPASTPSTAPTPSTAGSPPA--PTPDSLGPGPSGADTPP 135
             PA+ PS A  P   G PPA  P P +  PGP  A  PP
Sbjct: 2000 PPAAEPSPAAGP--PGPPPASGPPPAAGPPGPPPASGPP 2036

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 50/115 (43%), Positives = 52/115 (45%), Gaps = 16/115 (13%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAP------------TAQPPAAATPPTATPPTAT--PPAAVPAPATPA 282
            P A P  P   TP P               PPAA  PP A PP A   PPAA P    PA
Sbjct: 1899 PAAGPP-PAAGTPGPPPSSGPPPAAGSPGPPPAAGPPPAAGPPPAVGPPPAAGPPGPPPA 1957

Query: 281  PASSPATSPPAPTPASTPSTAPTPSTAGSPPA--PTPDSLGPGPSGADTPPSPSA 123
               SPA  PP P PAS P  A  P   G PPA  P P +  PGP  A   PSP+A
Sbjct: 1958 AEPSPAAGPPGPPPASGPPPAAGP--PGPPPASGPPPAAGPPGPPPA-AEPSPAA 2009

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 47/105 (44%), Positives = 51/105 (48%), Gaps = 10/105 (9%)
 Frame = -3

Query: 419  PTAAPTKP-PTATPAPTA----QPPAAATPPTATPPTATPPAAVPAPAT---PAPASSPA 264
            P A P  P P A P P A     PP++  PP A  P   PPAA P PA    PA    PA
Sbjct: 1890 PAAGPPGPLPAAGPPPAAGTPGPPPSSGPPPAAGSP-GPPPAAGPPPAAGPPPAVGPPPA 1948

Query: 263  TSPPAPTPASTPSTAPTPSTAGSPPA--PTPDSLGPGPSGADTPP 135
              PP P PA+ PS A  P   G PPA  P P +  PGP  A  PP
Sbjct: 1949 AGPPGPPPAAEPSPAAGP--PGPPPASGPPPAAGPPGPPPASGPP 1991

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 44/103 (42%), Positives = 49/103 (47%), Gaps = 8/103 (7%)
 Frame = -3

Query: 419  PTAAPTKPPTAT---PAPTA-QPPAAATPPTATPPTATPPAAVPAPATPAPASS--PATS 258
            P A    PP+A    P P A  PPA   PP A PP A  P +   P  P PAS   PA  
Sbjct: 1834 PAAGSPGPPSAGSPGPPPVAGPPPATGPPPAAGPPPAAGPPSAVDPLGPPPASGPPPAAG 1893

Query: 257  PPAPTPASTPSTAPTPSTAGSPPA--PTPDSLGPGPSGADTPP 135
            PP P PA+ P   P   T G PP+  P P +  PGP  A  PP
Sbjct: 1894 PPGPLPAAGP--PPAAGTPGPPPSSGPPPAAGSPGPPPAAGPP 1934

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 43/99 (43%), Positives = 46/99 (46%), Gaps = 10/99 (10%)
 Frame = -3

Query: 419  PTAAPTKPPTAT----------PAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
            P A P  PP A           P P + PP AA PP   P +  PPAA P    PA   S
Sbjct: 1947 PAAGPPGPPPAAEPSPAAGPPGPPPASGPPPAAGPPGPPPASGPPPAAGPPGPPPAAEPS 2006

Query: 269  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPS 153
            PA  PP P PAS P     P  AG PP P P S GP P+
Sbjct: 2007 PAAGPPGPPPASGP-----PPAAG-PPGPPPAS-GPPPA 2038

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 44/125 (35%), Positives = 56/125 (44%), Gaps = 10/125 (8%)
 Frame = -3

Query: 464  FLILGLLATSCLAQAPTAAPTKP-PTATPAPTAQPPAAA--TPPTATPPTATPPAAVPAP 294
            FLI     T   ++  ++ P  P P +   P + PPA+     P   PP A PP   PA 
Sbjct: 1777 FLISSPSTTPLQSRVSSSVPASPEPFSISTPGSSPPASPEKAKPGEPPPAAGPPGPTPAA 1836

Query: 293  ATPAPASSPATSPP---APTPASTPSTAPTPSTAGSPPAPTPDSLGP----GPSGADTPP 135
             +P P S+ +  PP    P PA+ P  A  P  A  PP+   D LGP    GP  A  PP
Sbjct: 1837 GSPGPPSAGSPGPPPVAGPPPATGPPPAAGPPPAAGPPSAV-DPLGPPPASGPPPAAGPP 1895

Query: 134  SPSAA 120
             P  A
Sbjct: 1896 GPLPA 1900

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 42/108 (38%), Positives = 47/108 (43%), Gaps = 15/108 (13%)
 Frame = -3

Query: 398  PPTATPAPTAQPPA---AATPPTATPPTATPPAAVPAPATPAPASSPATSPP-------- 252
            PP + P P A PP    AA PP A      PP++ P PA  +P   PA  PP        
Sbjct: 1883 PPASGPPPAAGPPGPLPAAGPPPAAGTPGPPPSSGPPPAAGSPGPPPAAGPPPAAGPPPA 1942

Query: 251  -APTPASTPSTAP---TPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
              P PA+ P   P    PS A  PP P P S   GP  A  PP P  A
Sbjct: 1943 VGPPPAAGPPGPPPAAEPSPAAGPPGPPPAS---GPPPAAGPPGPPPA 1987

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 40/109 (36%), Positives = 47/109 (43%), Gaps = 9/109 (8%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAAT------PPTATPPTATPPAAVPAPAT---PAPASS 270
            +P A+P K     P P A PP          PP+A  P   PP A P PAT   PA    
Sbjct: 1810 SPPASPEKAKPGEPPPAAGPPGPTPAAGSPGPPSAGSP-GPPPVAGPPPATGPPPAAGPP 1868

Query: 269  PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
            PA  PP+      P  A  P  A  PP P P + GP P+     P PS+
Sbjct: 1869 PAAGPPSAVDPLGPPPASGPPPAAGPPGPLP-AAGPPPAAGTPGPPPSS 1916

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 38/89 (42%), Positives = 44/89 (49%), Gaps = 4/89 (4%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQ----PPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP 255
            +P A P  PP A+  P A     PP A+ PP A  P   PPAA P+PA   P   PA+ P
Sbjct: 1961 SPAAGPPGPPPASGPPPAAGPPGPPPASGPPPAAGPPGPPPAAEPSPAAGPPGPPPASGP 2020

Query: 254  PAPTPASTPSTAPTPSTAGSPPAPTPDSL 168
            P   PA+ P   P  S  G PPA  P  L
Sbjct: 2021 P---PAAGPPGPPPAS--GPPPAAGPHLL 2044

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 46/112 (41%), Positives = 52/112 (46%), Gaps = 13/112 (11%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP---PTATPPTAT--PPAAVPAPATPAPASSPATSP 255
            P A P  P  A  +P   PP+A +P   P A PP AT  PPAA P PA   P+   A  P
Sbjct: 1825 PAAGPPGPTPAAGSPG--PPSAGSPGPPPVAGPPPATGPPPAAGPPPAAGPPS---AVDP 1879

Query: 254  PAPTPASTPSTAPTP----STAGSPPAP----TPDSLGPGPSGADTPPSPSA 123
              P PAS P  A  P      AG PPA      P S GP P+     P P+A
Sbjct: 1880 LGPPPASGPPPAAGPPGPLPAAGPPPAAGTPGPPPSSGPPPAAGSPGPPPAA 1931

[209][TOP]
>UniRef100_B5E0E8 GA24203 n=1 Tax=Drosophila pseudoobscura pseudoobscura
           RepID=B5E0E8_DROPS
          Length = 139

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
           PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 18  PTPTPTPTPTPTPTPTPNPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 76

Query: 251 APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 77  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 117

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/104 (47%), Positives = 57/104 (54%), Gaps = 6/104 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
           PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 10  PTPTPTPTPTPTPTPTPTPTPTPTPNPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 68

Query: 251 APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 69  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 109

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 47/99 (47%), Positives = 53/99 (53%), Gaps = 5/99 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
           PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 38  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 96

Query: 251 APTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP 138
            PTP  TP+  PTP+   +P P PTP    P P+   TP
Sbjct: 97  TPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTRTRTP 132

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 48/103 (46%), Positives = 56/103 (54%), Gaps = 6/103 (5%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-PA 249
           T  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P 
Sbjct: 5   TCTPTPTPTPTPTPTPTPTPTPTPTPTPTPNPTPTPTPTPTPTP-TPTPTPTPTPTPTPT 63

Query: 248 PTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
           PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 64  PTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 103

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 37/75 (49%), Positives = 41/75 (54%), Gaps = 4/75 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-P 252
           PT  PT  PT TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P P
Sbjct: 60  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTPTPTPTPTP 118

Query: 251 APTPASTPSTAPTPS 207
            PTP  TP+   TP+
Sbjct: 119 TPTPTPTPTRTRTPT 133

[210][TOP]
>UniRef100_A4H6K8 Tubulin-tyrsoine ligase-like protein (Fragment) n=1 Tax=Leishmania
           braziliensis RepID=A4H6K8_LEIBR
          Length = 742

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 54/131 (41%), Positives = 67/131 (51%), Gaps = 9/131 (6%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTA--TPPAAVP--APATPAPAS 273
           T   A  PTAA T     TPA    P AA TP  AT PTA  TP AA    A  TPA A+
Sbjct: 390 TPTAATTPTAATTPMAATTPAAATTPAAATTPAAATTPTAATTPTAATTPMAATTPAAAT 449

Query: 272 SPA--TSPPA---PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYS 108
           +PA  T+P A   PT A+TP+ A TP  A +P A T  +    P+ A TP + +   + +
Sbjct: 450 TPAAVTTPAAATTPTAATTPTAATTPMAATTPAAATTPAAATTPTAATTPTAATTPMAAT 509

Query: 107 KPIIAATALSA 75
            P  A T  +A
Sbjct: 510 TPAAATTPTAA 520

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 52/128 (40%), Positives = 67/128 (52%), Gaps = 5/128 (3%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTA--TPPTATPPAAVPAPA---TPAP 279
           AT+ +A    AA T P  AT    A  P AAT PTA  TP  AT PAA   PA   TPA 
Sbjct: 400 ATTPMAATTPAAATTPAAATTPAAATTPTAATTPTAATTPMAATTPAAATTPAAVTTPAA 459

Query: 278 ASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPI 99
           A++P T+   PT A+TP  A TP+ A +P A T  +    P+ A TP + +   + + P 
Sbjct: 460 ATTP-TAATTPTAATTPMAATTPAAATTPAAATTPTAATTPTAATTPMAATTPAAATTPT 518

Query: 98  IAATALSA 75
            A T  +A
Sbjct: 519 AATTPTAA 526

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 51/126 (40%), Positives = 63/126 (50%), Gaps = 4/126 (3%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTA--TPPAAVP--APATPAPAS 273
           T   A  PTAA T     TPA    P A  TP  AT PTA  TP AA    A  TPA A+
Sbjct: 426 TPTAATTPTAATTPMAATTPAAATTPAAVTTPAAATTPTAATTPTAATTPMAATTPAAAT 485

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
           +PA +   PT A+TP+ A TP  A +P A T  +    P+ A TP + +   + + P  A
Sbjct: 486 TPAAAT-TPTAATTPTAATTPMAATTPAAATTPTAATTPTAATTPTAATTPMAATTPAAA 544

Query: 92  ATALSA 75
            T  SA
Sbjct: 545 TTPTSA 550

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 62/177 (35%), Positives = 84/177 (47%), Gaps = 14/177 (7%)
 Frame = -3

Query: 545 SFTHTTFLSKF*ISLHPKMASSAAVQIFL--ILGLLATSCLAQAPT--------AAPTKP 396
           SF H+        S +P  AS+A  ++ +    G+L     A +PT        AA T  
Sbjct: 315 SFPHSPTTGGSPQSQNPDAASTAQSKVVVGGDEGVLLQEVEAASPTVSDPALETAATTPA 374

Query: 395 PTATPAPTAQPPAAATPPTATPPTA-TPPAAVPAPA---TPAPASSPATSPPAPTPASTP 228
              TPA    P AA TP  AT PTA T P A   PA   TPA A++PA +   PT A+TP
Sbjct: 375 AATTPAAVTTPAAATTPTAATTPTAATTPMAATTPAAATTPAAATTPAAAT-TPTAATTP 433

Query: 227 STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSAALFAIA 57
           + A TP  A +P A T  +    P+ A TP + +   + + P+ A T  +A   A A
Sbjct: 434 TAATTPMAATTPAAATTPAAVTTPAAATTPTAATTPTAATTPMAATTPAAATTPAAA 490

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 45/121 (37%), Positives = 60/121 (49%), Gaps = 2/121 (1%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTA--TPPAAVPAPATPAPAS 273
           + T   A  PTAA T     TP     P AA TP  AT PTA  TP AA     TP  A+
Sbjct: 454 VTTPAAATTPTAATTPTAATTPMAATTPAAATTPAAATTPTAATTPTAA----TTPMAAT 509

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
           +PA +   PT A+TP+ A TP+ A +P A T  +    P+ A+     ++A  +   I+ 
Sbjct: 510 TPAAA-TTPTAATTPTAATTPTAATTPMAATTPAAATTPTSANAKSPVTSAGQHKGVIMT 568

Query: 92  A 90
           A
Sbjct: 569 A 569

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 55/150 (36%), Positives = 69/150 (46%), Gaps = 21/150 (14%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPP-TATPPAAVPAPA---TPAPA 276
           A    A  P AA T     TPA    P AA TP  AT P  AT PAA   PA   TPA A
Sbjct: 365 ALETAATTPAAATTPAAVTTPAAATTPTAATTPTAATTPMAATTPAAATTPAAATTPAAA 424

Query: 275 SSP--ATSPPA---PTPASTPSTAPTPS-----------TAG-SPPAPTPDSLGPGPSGA 147
           ++P  AT+P A   P  A+TP+ A TP+           TA  +P A T       P+ A
Sbjct: 425 TTPTAATTPTAATTPMAATTPAAATTPAAVTTPAAATTPTAATTPTAATTPMAATTPAAA 484

Query: 146 DTPPSPSAAFSYSKPIIAATALSAALFAIA 57
            TP + +   + + P  A T ++A   A A
Sbjct: 485 TTPAAATTPTAATTPTAATTPMAATTPAAA 514

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 44/116 (37%), Positives = 55/116 (47%), Gaps = 7/116 (6%)
 Frame = -3

Query: 449 LLATSCLAQAPTAAPTKP-----PTATPAPTA--QPPAAATPPTATPPTATPPAAVPAPA 291
           + AT+  A    AA T P     PTA   PTA   P AA TP  AT P A   A  P  A
Sbjct: 440 MAATTPAAATTPAAVTTPAAATTPTAATTPTAATTPMAATTPAAATTPAA---ATTPTAA 496

Query: 290 TPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
           T   A++   +   P  A+TP+ A TP+ A +P A T       P+ A TP S +A
Sbjct: 497 TTPTAATTPMAATTPAAATTPTAATTPTAATTPTAATTPMAATTPAAATTPTSANA 552

 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 43/138 (31%), Positives = 63/138 (45%), Gaps = 21/138 (15%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPT----------------ATPPTATPPAAVPAP 294
           Q  ++ P  P T     +  P AA+T  +                A  PT + PA   A 
Sbjct: 311 QLASSFPHSPTTGGSPQSQNPDAASTAQSKVVVGGDEGVLLQEVEAASPTVSDPALETAA 370

Query: 293 ATPAPASSPA--TSPPA---PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            TPA A++PA  T+P A   PT A+TP+ A TP  A +P A T  +    P+ A TP + 
Sbjct: 371 TTPAAATTPAAVTTPAAATTPTAATTPTAATTPMAATTPAAATTPAAATTPAAATTPTAA 430

Query: 128 SAAFSYSKPIIAATALSA 75
           +   + + P+ A T  +A
Sbjct: 431 TTPTAATTPMAATTPAAA 448

[211][TOP]
>UniRef100_Q6AHW2 Protease-1 (PRT1),, putative (Fragment) n=1 Tax=Pneumocystis
           carinii RepID=Q6AHW2_PNECA
          Length = 619

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 45/110 (40%), Positives = 52/110 (47%), Gaps = 5/110 (4%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           +TS    +P + P  P  A PAP   PPA A  P A PP   PPA  PAP  P P  +PA
Sbjct: 413 STSSSEPSPPSPPPAPAPAPPAPPP-PPAPAPAPPAPPP---PPAPAPAPPAPPPPPAPA 468

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPD-----SLGPGPSGADTPPSP 129
            +PPAP P   P+ AP P     PP P P+        P P     PP P
Sbjct: 469 PAPPAPPPPPAPAPAPAPPPPPPPPPPRPELEPEPEPEPEPEPEPQPPQP 518

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 41/93 (44%), Positives = 48/93 (51%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTP 228
           PT   ++ P+P + PPA A  P A PP   PPA  PAP  P P  +PA +PPAP P   P
Sbjct: 411 PTSTSSSEPSPPSPPPAPAPAPPAPPP---PPAPAPAPPAPPPPPAPAPAPPAPPP--PP 465

Query: 227 STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           + AP P     PPAP P    P P     PP P
Sbjct: 466 APAPAPPAPPPPPAPAP---APAPPPPPPPPPP 495

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 45/111 (40%), Positives = 48/111 (43%), Gaps = 13/111 (11%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATP-PTATPPAAVPAPATPA----PASSPATS 258
           AP  AP  PP   PAP   PPA   PP   P P A PP   PAPA PA    PA +PA +
Sbjct: 427 APAPAPPAPPPP-PAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPA 485

Query: 257 PPAPTP--------ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           PP P P           P   P P     PP P P+   P P     PP P
Sbjct: 486 PPPPPPPPPPRPELEPEPEPEPEPEPEPQPPQPQPEPPVPPPKPQPPPPPP 536

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 40/101 (39%), Positives = 40/101 (39%), Gaps = 1/101 (0%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-TPAPASSPATSPP 252
           A  P  AP   P A P P A  PA   PP    P   PPA  P PA  PAPA  P   PP
Sbjct: 434 APPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPP 493

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P P   P   P P     P  P P    P P     PP P
Sbjct: 494 PPRPELEPEPEPEPEPEPEPQPPQPQPEPPVPPPKPQPPPP 534

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 34/98 (34%), Positives = 44/98 (44%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P   P++   P     +  T  +++ P+   P   PAPA PAP   PA +P  P P
Sbjct: 389 PDLNPPSDPSSQQDPDTSLSSNPTSTSSSEPSPPSPPPAPAPAPPAPPPPPAPAPAPPAP 448

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSP 129
              P+ AP P     PPAP P    P P  A  P P+P
Sbjct: 449 PPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAP 486

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 44/133 (33%), Positives = 60/133 (45%), Gaps = 33/133 (24%)
 Frame = -3

Query: 419 PTAAPTKPPTATPA------PTAQPPAAATPPT--------------------ATPPTAT 318
           P++ P  PP++ P       P  QPP+   PP+                    ++ PT+T
Sbjct: 355 PSSDPESPPSSEPGYQPPSKPGPQPPSEPQPPSKPDLNPPSDPSSQQDPDTSLSSNPTST 414

Query: 317 ------PPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPA-PTPDSLGPG 159
                 PP+  PAPA   PA  P   PPAP PA  P+  P P+ A +PPA P P +  P 
Sbjct: 415 SSSEPSPPSPPPAPAPAPPAPPP---PPAPAPA-PPAPPPPPAPAPAPPAPPPPPAPAPA 470

Query: 158 PSGADTPPSPSAA 120
           P     PP+P+ A
Sbjct: 471 PPAPPPPPAPAPA 483

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 38/124 (30%), Positives = 53/124 (42%), Gaps = 27/124 (21%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTA---TPPAAVPA-----------PATPA 282
           PT AP   P ATP P         P   +PP++   +PP++ P            P+ P 
Sbjct: 325 PTTAPPPDPGATPPPDLDANPQPQPDPGSPPSSDPESPPSSEPGYQPPSKPGPQPPSEPQ 384

Query: 281 PASSPATSPP-------------APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 141
           P S P  +PP             +  P ST S+ P+P +    PAP P +  P P+ A  
Sbjct: 385 PPSKPDLNPPSDPSSQQDPDTSLSSNPTSTSSSEPSPPSPPPAPAPAPPAPPPPPAPAPA 444

Query: 140 PPSP 129
           PP+P
Sbjct: 445 PPAP 448

[212][TOP]
>UniRef100_Q6AHS6 Protease-1 (PRT1) protein, putative n=1 Tax=Pneumocystis carinii
            RepID=Q6AHS6_PNECA
          Length = 947

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 45/110 (40%), Positives = 52/110 (47%), Gaps = 5/110 (4%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
            +TS    +P + P  P  A PAP   PPA A  P A PP   PPA  PAP  P P  +PA
Sbjct: 741  STSSSEPSPPSPPPAPAPAPPAPPP-PPAPAPAPPAPPP---PPAPAPAPPAPPPPPAPA 796

Query: 263  TSPPAPTPASTPSTAPTPSTAGSPPAPTPD-----SLGPGPSGADTPPSP 129
             +PPAP P   P+ AP P     PP P P+        P P     PP P
Sbjct: 797  PAPPAPPPPPAPAPAPAPPPPPPPPPPRPELEPEPEPEPEPEPEPQPPQP 846

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 41/93 (44%), Positives = 48/93 (51%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTP 228
           PT   ++ P+P + PPA A  P A PP   PPA  PAP  P P  +PA +PPAP P   P
Sbjct: 739 PTSTSSSEPSPPSPPPAPAPAPPAPPP---PPAPAPAPPAPPPPPAPAPAPPAPPP--PP 793

Query: 227 STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
           + AP P     PPAP P    P P     PP P
Sbjct: 794 APAPAPPAPPPPPAPAP---APAPPPPPPPPPP 823

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 45/111 (40%), Positives = 48/111 (43%), Gaps = 13/111 (11%)
 Frame = -3

Query: 422  APTAAPTKPPTATPAPTAQPPAAATPPTATP-PTATPPAAVPAPATPA----PASSPATS 258
            AP  AP  PP   PAP   PPA   PP   P P A PP   PAPA PA    PA +PA +
Sbjct: 755  APAPAPPAPPPP-PAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPA 813

Query: 257  PPAPTP--------ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            PP P P           P   P P     PP P P+   P P     PP P
Sbjct: 814  PPPPPPPPPPRPELEPEPEPEPEPEPEPQPPQPQPEPPVPPPKPQPPPPPP 864

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 40/101 (39%), Positives = 40/101 (39%), Gaps = 1/101 (0%)
 Frame = -3

Query: 428  AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-TPAPASSPATSPP 252
            A  P  AP   P A P P A  PA   PP    P   PPA  P PA  PAPA  P   PP
Sbjct: 762  APPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPP 821

Query: 251  APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             P P   P   P P     P  P P    P P     PP P
Sbjct: 822  PPRPELEPEPEPEPEPEPEPQPPQPQPEPPVPPPKPQPPPP 862

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 34/98 (34%), Positives = 44/98 (44%), Gaps = 1/98 (1%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P   P   P++   P     +  T  +++ P+   P   PAPA PAP   PA +P  P P
Sbjct: 717  PDLNPPSDPSSQQDPDTSLSSNPTSTSSSEPSPPSPPPAPAPAPPAPPPPPAPAPAPPAP 776

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSP 129
               P+ AP P     PPAP P    P P  A  P P+P
Sbjct: 777  PPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAP 814

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 44/133 (33%), Positives = 60/133 (45%), Gaps = 33/133 (24%)
 Frame = -3

Query: 419  PTAAPTKPPTATPA------PTAQPPAAATPPT--------------------ATPPTAT 318
            P++ P  PP++ P       P  QPP+   PP+                    ++ PT+T
Sbjct: 683  PSSDPESPPSSEPGYQPPSKPGPQPPSEPQPPSKPDLNPPSDPSSQQDPDTSLSSNPTST 742

Query: 317  ------PPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPA-PTPDSLGPG 159
                  PP+  PAPA   PA  P   PPAP PA  P+  P P+ A +PPA P P +  P 
Sbjct: 743  SSSEPSPPSPPPAPAPAPPAPPP---PPAPAPA-PPAPPPPPAPAPAPPAPPPPPAPAPA 798

Query: 158  PSGADTPPSPSAA 120
            P     PP+P+ A
Sbjct: 799  PPAPPPPPAPAPA 811

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 38/124 (30%), Positives = 53/124 (42%), Gaps = 27/124 (21%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTA---TPPAAVPA-----------PATPA 282
            PT AP   P ATP P         P   +PP++   +PP++ P            P+ P 
Sbjct: 653  PTTAPPPDPGATPPPDLDANPQPQPDPGSPPSSDPESPPSSEPGYQPPSKPGPQPPSEPQ 712

Query: 281  PASSPATSPP-------------APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADT 141
            P S P  +PP             +  P ST S+ P+P +    PAP P +  P P+ A  
Sbjct: 713  PPSKPDLNPPSDPSSQQDPDTSLSSNPTSTSSSEPSPPSPPPAPAPAPPAPPPPPAPAPA 772

Query: 140  PPSP 129
            PP+P
Sbjct: 773  PPAP 776

[213][TOP]
>UniRef100_Q4WUE6 Cell wall protein, putative n=1 Tax=Aspergillus fumigatus
           RepID=Q4WUE6_ASPFU
          Length = 300

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 43/110 (39%), Positives = 59/110 (53%), Gaps = 5/110 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTATP---APTAQPPA--AATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           +P     + PT+TP    PT  PPA  ++ PP++ PP+A P    PAPA PAPA  PA++
Sbjct: 188 SPPTPTVETPTSTPPAHTPTCAPPAPPSSAPPSSAPPSAPPTPTPPAPAPPAPAP-PAST 246

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYS 108
           P AP P S P    +   A +PP   P S+   P  A  PP+P+    +S
Sbjct: 247 PSAPAPPSAPPAQTSEVPASAPPPAPPASVPEAPVAAPPPPAPAPPADHS 296

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 37/84 (44%), Positives = 43/84 (51%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           + AP +AP  P    PAP A  P     P +TP    PP+A PA  +  PAS+P   PPA
Sbjct: 220 SSAPPSAPPTPTPPAPAPPAPAP-----PASTPSAPAPPSAPPAQTSEVPASAP---PPA 271

Query: 248 PTPASTPSTAPTPSTAGSPPAPTP 177
           P PAS P     P  A  PPAP P
Sbjct: 272 P-PASVPE---APVAAPPPPAPAP 291

[214][TOP]
>UniRef100_C0SFQ9 Putative uncharacterized protein n=1 Tax=Paracoccidioides
           brasiliensis Pb03 RepID=C0SFQ9_PARBP
          Length = 675

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 47/119 (39%), Positives = 57/119 (47%), Gaps = 6/119 (5%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTA---TPPTATPPAAVPAPATPAPASS 270
           TS    AP  +P   P  +P+   QPP A+ PP A    PP + P    P P  P PA S
Sbjct: 443 TSGPVSAPPPSPPPRPHVSPSAIPQPPPASAPPPARQPPPPVSAPAPPPPPPPPPGPAPS 502

Query: 269 PATSPPAPTPASTPSTA---PTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            A  PP P P   PS +   P P  +GS P P P    P PS + +PP P +A S S P
Sbjct: 503 TAVPPPPPPPPPPPSGSAPPPPPPPSGSAPPPPPH---PAPSASHSPPPPLSAPSSSPP 558

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 48/128 (37%), Positives = 56/128 (43%), Gaps = 15/128 (11%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPA-----AATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           +P+A P  PP + P P  QPP      A  PP   PP   P  AVP P  P P     ++
Sbjct: 461 SPSAIPQPPPASAPPPARQPPPPVSAPAPPPPPPPPPGPAPSTAVPPPPPPPPPPPSGSA 520

Query: 257 PPAPTP----ASTPSTAPTPSTAGSPPAP--TPDSLGPGP----SGADTPPSPSAAFSYS 108
           PP P P    A  P   P PS + SPP P   P S  P P    SG   PP P  A S  
Sbjct: 521 PPPPPPPSGSAPPPPPHPAPSASHSPPPPLSAPSSSPPPPPPPASGVPPPPPPPPAGSGG 580

Query: 107 KPIIAATA 84
            P+ +  A
Sbjct: 581 APLPSVAA 588

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 45/114 (39%), Positives = 55/114 (48%), Gaps = 7/114 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAP-TAQPPAAATPPT----ATPPTATPP--AAVPAPATPAPASSPA 264
           AP   P  PP   PAP TA PP    PP     + PP   PP  +A P P  PAP++S +
Sbjct: 486 APAPPPPPPPPPGPAPSTAVPPPPPPPPPPPSGSAPPPPPPPSGSAPPPPPHPAPSASHS 545

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
             PP   P+S+P   P P++   PP P P    P  SG    PS +AA   S P
Sbjct: 546 PPPPLSAPSSSPPPPPPPASGVPPPPPPP----PAGSGGAPLPSVAAALPKSSP 595

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 43/109 (39%), Positives = 49/109 (44%), Gaps = 3/109 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP---PAAVPAPATPAPASSPATSPPA 249
           P   P K P  T  P + PP +  P     P+A P   PA+ P PA   P   P  S PA
Sbjct: 432 PPTLPHKVPHGTSGPVSAPPPSPPPRPHVSPSAIPQPPPASAPPPARQPP---PPVSAPA 488

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           P P   P   P PSTA  PP P P    P PSG+  PP P  + S   P
Sbjct: 489 PPPPPPPPPGPAPSTAVPPPPPPPP---PPPSGSAPPPPPPPSGSAPPP 534

[215][TOP]
>UniRef100_B0Y3X0 Cell wall protein, putative n=1 Tax=Aspergillus fumigatus A1163
           RepID=B0Y3X0_ASPFC
          Length = 300

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 43/110 (39%), Positives = 59/110 (53%), Gaps = 5/110 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTATP---APTAQPPA--AATPPTATPPTATPPAAVPAPATPAPASSPATS 258
           +P     + PT+TP    PT  PPA  ++ PP++ PP+A P    PAPA PAPA  PA++
Sbjct: 188 SPPTPTVETPTSTPPAHTPTCAPPAPPSSAPPSSAPPSAPPTPTPPAPAPPAPAP-PAST 246

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYS 108
           P AP P S P    +   A +PP   P S+   P  A  PP+P+    +S
Sbjct: 247 PSAPAPPSAPPAQTSEVPASAPPPAPPASVPEAPVAAPPPPAPAPPADHS 296

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 37/84 (44%), Positives = 43/84 (51%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           + AP +AP  P    PAP A  P     P +TP    PP+A PA  +  PAS+P   PPA
Sbjct: 220 SSAPPSAPPTPTPPAPAPPAPAP-----PASTPSAPAPPSAPPAQTSEVPASAP---PPA 271

Query: 248 PTPASTPSTAPTPSTAGSPPAPTP 177
           P PAS P     P  A  PPAP P
Sbjct: 272 P-PASVPE---APVAAPPPPAPAP 291

[216][TOP]
>UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes
           RepID=UPI00016E1896
          Length = 695

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 40/107 (37%), Positives = 44/107 (41%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
           A S + Q+P   P  PP   P P   PPA A PP   PP   PP   P P    P   P 
Sbjct: 591 AESMMPQSP--GPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPP 648

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
             PP P P   P+ AP P+    PP P      P P     PP P A
Sbjct: 649 APPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPPPPPA 695

[217][TOP]
>UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2U1_EHV86
          Length = 2873

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 40/100 (40%), Positives = 51/100 (51%), Gaps = 2/100 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPT--ATPPTATPPAAVPAPATPAPASSPATSPPAP 246
            P + P  PP  +P P + PP +  PP+   +PP  +PP   P P +P P S P  SPP P
Sbjct: 2686 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2745

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            +P   PS  P       PPAP+P    P PS   +PP PS
Sbjct: 2746 SP-PPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPS 2784

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 38/98 (38%), Positives = 49/98 (50%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P + P  PP + P P+  PP  + PP + PP + PP+  P P +P P S P  SPP P+P
Sbjct: 2682 PPSPPPSPPPSPPPPS--PPPPSPPPPSPPPPSPPPS--PPPPSPPPPSPPPPSPPPPSP 2737

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
                   P+P     PP   P  L P PS   +PP PS
Sbjct: 2738 PPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPS 2775

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 38/92 (41%), Positives = 47/92 (51%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  PP  +P P+  PP+   PP  +PP  +PP   P P +P P S P  SPP P+P
Sbjct: 2701 PSPPPPSPPPPSPPPSPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2757

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
               P   P PS   SPP P+P    P PS  D
Sbjct: 2758 --PPPLPPAPSPPPSPPPPSPPPSPPPPSPPD 2787

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 37/94 (39%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = -3

Query: 407  PTKPPTATPAPTAQPPAAA-TPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPAST 231
            P+ PP  +P P+  PP+   +PP + PP + PP + P P+ P P+  P+  PP+P P S 
Sbjct: 2668 PSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSP 2727

Query: 230  PSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            P  +P P    SPP P+P    P P  +  PPSP
Sbjct: 2728 PPPSPPPP---SPPPPSPPPPSP-PPPSPPPPSP 2757

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 35/92 (38%), Positives = 47/92 (51%)
 Frame = -3

Query: 401  KPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPST 222
            KPP+  P P+  P    +PP  +PP + PP+  P P +P P S P  SPP P+P  +P  
Sbjct: 2666 KPPSPPPPPSPPP----SPPPPSPPPSPPPS--PPPPSPPPPSPPPPSPPPPSPPPSPPP 2719

Query: 221  APTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
               P  +  PP+P P S  P      +PP PS
Sbjct: 2720 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 2751

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 42/124 (33%), Positives = 51/124 (41%), Gaps = 3/124 (2%)
 Frame = -3

Query: 398  PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTA 219
            PP + P P+  PP+   PP  +PP  +PP   P P+ P P   P T PP+P P S P  +
Sbjct: 2253 PPPSPPPPSPHPPS---PPPPSPPPPSPPPPTPPPSPPPP---PPTPPPSPPPPSPPPPS 2306

Query: 218  PTPSTAGSPPAPTPDS---LGPGPSGADTPPSPSAAFSYSKPIIAATALSAALFAIAF*D 48
            P P +   P  P P           G D P  P    SYS         SA  F     D
Sbjct: 2307 PPPPSPPPPSQPPPCHQVWFDTNLLGGDLPGYPVTEVSYSSCSYRCELESALFFTFRDND 2366

Query: 47   LSMW 36
             S W
Sbjct: 2367 DSCW 2370

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 34/90 (37%), Positives = 47/90 (52%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
            P+  P  PP  +P P + PP +  PP+  PP+  PP+  P P  PAP+  P+  PP+P P
Sbjct: 2720 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP-PPPLPPAPSPPPSPPPPSP-P 2777

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSG 150
             S P  +P   T+ S    T  S+  G SG
Sbjct: 2778 PSPPPPSPPDRTSTSGTKATIGSIAGGMSG 2807

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 31/90 (34%), Positives = 41/90 (45%), Gaps = 6/90 (6%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP   P P   PP  + PP + PP   PP   P P +P P   P+  PP P P
Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPPPPSPPP---PPPPSPPPPSPPPPPPPSPPPPPPPP 259

Query: 239 ASTP------STAPTPSTAGSPPAPTPDSL 168
             TP      S A  P T G+   P+ +++
Sbjct: 260 LPTPTGRSCFSYAIGPYTRGNSGTPSGENI 289

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 26/72 (36%), Positives = 38/72 (52%)
 Frame = -3

Query: 431  LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP 252
            ++  P + P+ PP   P+P   PP +  PP   PP+  PP+  P P +P P+  P + PP
Sbjct: 2522 ISSDPCSPPSPPP---PSPPPSPPPSPPPPLPPPPSPPPPS--PPPPSPPPSPPPPSPPP 2576

Query: 251  APTPASTPSTAP 216
            +P P S P   P
Sbjct: 2577 SPPPPSPPPYPP 2588

 Score = 57.0 bits (136), Expect = 9e-07
 Identities = 28/71 (39%), Positives = 38/71 (53%)
 Frame = -3

Query: 374  TAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGS 195
            ++ P +  +PP  +PP + PP+  P P  P P S P   PP+P P S P + P PS   S
Sbjct: 2523 SSDPCSPPSPPPPSPPPSPPPS--PPPPLPPPPSPP---PPSPPPPSPPPSPPPPSPPPS 2577

Query: 194  PPAPTPDSLGP 162
            PP P+P    P
Sbjct: 2578 PPPPSPPPYPP 2588

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 25/68 (36%), Positives = 35/68 (51%)
 Frame = -3

Query: 392  TATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPT 213
            ++ P     PP  + PP+  PP + PP   P P+ P P+  P + PP+P P S P + P 
Sbjct: 2523 SSDPCSPPSPPPPSPPPS--PPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPP 2580

Query: 212  PSTAGSPP 189
            PS    PP
Sbjct: 2581 PSPPPYPP 2588

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 29/67 (43%), Positives = 32/67 (47%)
 Frame = -3

Query: 350 TPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDS 171
           +PP   PP   P    P P  P P S P  SPP P P S P  +P P    SPP P P  
Sbjct: 204 SPPPPPPPPPLP----PPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPP 259

Query: 170 LGPGPSG 150
           L P P+G
Sbjct: 260 L-PTPTG 265

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 33/91 (36%), Positives = 40/91 (43%), Gaps = 7/91 (7%)
 Frame = -3

Query: 383 PAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPST 204
           P+P   PP    PP   PP   PP + P P +P P   P+  PP+P P   PS  P P  
Sbjct: 203 PSPPPPPPPPPLPPPPPPP---PPPSPP-PPSPPPPPPPSPPPPSPPPPPPPSPPPPP-- 256

Query: 203 AGSPPAPTPD-------SLGPGPSGADTPPS 132
              PP PTP        ++GP   G    PS
Sbjct: 257 --PPPLPTPTGRSCFSYAIGPYTRGNSGTPS 285

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 24/65 (36%), Positives = 31/65 (47%)
 Frame = -3

Query: 323  ATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
            ++ P + P+P  P+P  SP  SPP P P       P+P     PP+P P S  P P    
Sbjct: 2523 SSDPCSPPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPS 2582

Query: 143  TPPSP 129
             PP P
Sbjct: 2583 PPPYP 2587

 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 30/71 (42%), Positives = 36/71 (50%)
 Frame = -3

Query: 341  TATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP 162
            T   P + PP   P P +P P S P + PP+P P S P  +P P    SPP P+P    P
Sbjct: 2663 TCIKPPSPPPPPSP-PPSPPPPSPPPSPPPSPPPPSPPPPSPPPP---SPPPPSPPPSPP 2718

Query: 161  GPSGADTPPSP 129
             PS    PPSP
Sbjct: 2719 PPS--PPPPSP 2727

[218][TOP]
>UniRef100_Q8FM53 Putative uncharacterized protein n=1 Tax=Corynebacterium efficiens
           RepID=Q8FM53_COREF
          Length = 609

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 50/105 (47%), Positives = 61/105 (58%), Gaps = 3/105 (2%)
 Frame = -3

Query: 425 QAPTA-APTKPPTATPAPTAQPPAAATPPTATPPTA--TPPAAVPAPATPAPASSPATSP 255
           QAP A     P  ATP P A P +A   P A  PTA  TP AAVPAPATP P ++P ++ 
Sbjct: 56  QAPPAPGAAVPAPATPIPPAAPGSAIPAPGAVTPTAVPTPGAAVPAPATPTPPAAPGSAI 115

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
           PAP  A+TP+  PTP +A     PTP +  P P G  TP +P A+
Sbjct: 116 PAP-GAATPTAVPTPGSA----IPTPGAAVPAP-GVATPSAPGAS 154

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 51/109 (46%), Positives = 62/109 (56%), Gaps = 9/109 (8%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPT-AQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           PT +P  P +A PAP  A PP     PT   P A P AAVPAPATP P ++P ++ PAP 
Sbjct: 27  PTTSPPPPGSAVPAPGGAVPPTVTNGPTPQAPPA-PGAAVPAPATPIPPAAPGSAIPAP- 84

Query: 242 PASTPSTAPTPSTAGSPPA-PTPDSLGPGPS----GADTP---PSPSAA 120
            A TP+  PTP  A   PA PTP +  PG +    GA TP   P+P +A
Sbjct: 85  GAVTPTAVPTPGAAVPAPATPTPPA-APGSAIPAPGAATPTAVPTPGSA 132

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 51/123 (41%), Positives = 55/123 (44%), Gaps = 14/123 (11%)
 Frame = -3

Query: 428 AQAPTAAPTK----PPTATPAPTAQPPAAATPPTATPPTA---------TPPAAVPAPAT 288
           A  PTA PT     P  ATP P A P +A   P A  PTA         TP AAVPAP  
Sbjct: 86  AVTPTAVPTPGAAVPAPATPTPPAAPGSAIPAPGAATPTAVPTPGSAIPTPGAAVPAPGV 145

Query: 287 PAPASSPATSPPAPTPA-STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSY 111
             P S+P  S P P  A  TP TA     A +P A  P S  P P GA   P   AA   
Sbjct: 146 ATP-SAPGASIPTPGAAMPTPGTATPAPGAAAPGATIPGSAVPAPGGAPAAPGAPAAPGA 204

Query: 110 SKP 102
           + P
Sbjct: 205 AAP 207

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 48/123 (39%), Positives = 56/123 (45%), Gaps = 7/123 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P AA   P TATPAP A  P A  P +A P     PAA  APA P  A+    +P A  P
Sbjct: 158 PGAAMPTPGTATPAPGAAAPGATIPGSAVPAPGGAPAAPGAPAAPGAAAPRTPAPGAAIP 217

Query: 239 ASTP--STAPTPSTAGSP-PAPTPDSLGPGPSGA----DTPPSPSAAFSYSKPIIAATAL 81
            +    S  PTP    +P  AP P    PGP GA      P +P A  S + P   +   
Sbjct: 218 GAVAPGSAVPTPGAISAPGAAPPPGLPAPGPPGAPGAPGIPAAPGAPGSAAAPAPTSVPR 277

Query: 80  SAA 72
           SAA
Sbjct: 278 SAA 280

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 47/124 (37%), Positives = 53/124 (42%), Gaps = 21/124 (16%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQP--------PAAATPPTATPPTATPPAAVPAPATPAPA- 276
           A AP A  T P +A PAP   P        P AA P T  P  A P A  P  A P P  
Sbjct: 174 AAAPGA--TIPGSAVPAPGGAPAAPGAPAAPGAAAPRTPAPGAAIPGAVAPGSAVPTPGA 231

Query: 275 -SSPATSPP----APTPASTPSTAPTPSTAGSP-----PAPT--PDSLGPGPSGADTPPS 132
            S+P  +PP    AP P   P     P+  G+P     PAPT  P S  P  +  DT P 
Sbjct: 232 ISAPGAAPPPGLPAPGPPGAPGAPGIPAAPGAPGSAAAPAPTSVPRSAAPVAADTDTRPK 291

Query: 131 PSAA 120
            S A
Sbjct: 292 GSTA 295

[219][TOP]
>UniRef100_Q63P41 Putative uncharacterized protein n=1 Tax=Burkholderia pseudomallei
            RepID=Q63P41_BURPS
          Length = 899

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 49/109 (44%), Positives = 59/109 (54%), Gaps = 9/109 (8%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP---PTATP-PAAVPAPA-TPAPASSPATS 258
            PT  PT  PT TP PT  P    TP PT TP   PT TP P   P P  TP P  +P  +
Sbjct: 790  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPMPTPTPTPTPTPTPTPTPTPTPTPTPT 849

Query: 257  P-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPSAA 120
            P P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+++
Sbjct: 850  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT-PTPTPTPTPTPTPTSS 897

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 49/105 (46%), Positives = 57/105 (54%), Gaps = 7/105 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPA-TPAPASSPATSP- 255
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P  TP P  +P  +P 
Sbjct: 746  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT 805

Query: 254  PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 806  PTPTPTPTPTPTPTPTPMPTPTPTPTPT---PTPTPTPTPTPTPT 847

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 49/105 (46%), Positives = 57/105 (54%), Gaps = 7/105 (6%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPA-TPAPASSPATSP- 255
            PT  PT  PT TP PT  P    TP PT TP PT TP P   P P  TP P  +P  +P 
Sbjct: 768  PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPMPTPT 827

Query: 254  PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 828  PTPTPTPTPTPTPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 869

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 49/114 (42%), Positives = 60/114 (52%), Gaps = 9/114 (7%)
 Frame = -3

Query: 440  TSCLAQAPTAAPTK-PPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPAS 273
            T  +   P   PT+ PP  TP PT  P    TP PT TP PT TP P   P P TP P  
Sbjct: 726  TKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP-TPTPTP 784

Query: 272  SPATSP-PAPTPASTPSTAPTPSTAGSP---PAPTPDSLGPGPSGADTP-PSPS 126
            +P  +P P PTP  TP+  PTP+   +P   P PTP  + P P+   TP P+P+
Sbjct: 785  TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPM-PTPTPTPTPTPTPT 837

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 37/94 (39%), Positives = 46/94 (48%), Gaps = 3/94 (3%)
 Frame = -3

Query: 398 PPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP-PAPTPASTPST 222
           PP   P+          PP   PPT  PP   P P TP P  +P  +P P PTP  TP+ 
Sbjct: 714 PPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTP-TPTPTPTPTPTPTPTPTPTPTPTP 772

Query: 221 APTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
            PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 773 TPTPTPTPTPTPTPTPT---PTPTPTPTPTPTPT 803

[220][TOP]
>UniRef100_Q3M8E3 Putative uncharacterized protein n=1 Tax=Anabaena variabilis ATCC
           29413 RepID=Q3M8E3_ANAVT
          Length = 624

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 50/114 (43%), Positives = 61/114 (53%), Gaps = 12/114 (10%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATP-----PTATP-PTATP---PAAVPAPATPAP 279
           ++Q PT  PT  PT TP PT  P    TP     PT TP PT TP   P  +P P TP P
Sbjct: 288 VSQVPTPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTPTPIPTPTPIPTPTPIPTP-TPTP 346

Query: 278 ASSPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
             +P  +P P PTP  TP+  PTP+   +P P PTP    P P+   TP P+P+
Sbjct: 347 IPTPTPTPIPTPTPIPTPTPTPTPTPTPTPTPTPTPIPT-PTPTPTPTPIPTPT 399

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 51/124 (41%), Positives = 63/124 (50%), Gaps = 13/124 (10%)
 Frame = -3

Query: 458 ILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATP---PTATP-PTATP-----PAA 306
           I+  + T      PT  PT  PT TP PT  P    TP   PT TP PT TP     P  
Sbjct: 287 IVSQVPTPTPTPTPTPTPTPTPTPTPTPTPTPTPIPTPTPIPTPTPIPTPTPIPTPTPTP 346

Query: 305 VPAPA-TPAPASSPATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP- 138
           +P P  TP P  +P  +P P PTP  TP+  PTP+   +P P PTP  + P P+   TP 
Sbjct: 347 IPTPTPTPIPTPTPIPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTPTPI-PTPTPTPTPT 405

Query: 137 PSPS 126
           P+P+
Sbjct: 406 PTPT 409

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 48/105 (45%), Positives = 54/105 (51%), Gaps = 8/105 (7%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP-PTATP-PTATP-PAAVPAPATPAPASSPATSP-- 255
           PT  PT  P  TP PT  P    TP PT TP PT TP P   P P TP P  +P  +P  
Sbjct: 330 PTPIPTPTPIPTPTPTPIPTPTPTPIPTPTPIPTPTPTPTPTPTP-TPTPTPTPIPTPTP 388

Query: 254 -PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSP 129
            P PTP  TP+  PTP+   +P P PTP    P P+   TP P P
Sbjct: 389 TPTPTPIPTPTPTPTPTPTPTPTPTPTPT---PTPTPIPTPTPKP 430

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 48/111 (43%), Positives = 56/111 (50%), Gaps = 13/111 (11%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATP---PTATP---PTATP---PAAVPAPA-TPAPASS 270
           PT  PT  PT TP PT  P    TP   PT TP   PT TP   P  +P P  TP P  +
Sbjct: 314 PTPTPTPIPTPTPIPTPTPIPTPTPIPTPTPTPIPTPTPTPIPTPTPIPTPTPTPTPTPT 373

Query: 269 PATSP-PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTP-PSPS 126
           P  +P P P P  TP+  PTP    +P P PTP    P P+   TP P+P+
Sbjct: 374 PTPTPTPTPIPTPTPTPTPTPIPTPTPTPTPTPT---PTPTPTPTPTPTPT 421

[221][TOP]
>UniRef100_C3PK29 Putative Fe-S oxidoreductase n=1 Tax=Corynebacterium aurimucosum ATCC
            700975 RepID=C3PK29_CORA7
          Length = 877

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 53/120 (44%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = -3

Query: 416  TAAPTKPPTATPAPTAQP--PAAATPPTATPPTATPPAAVPAPATPAPASSPA--TSPPA 249
            TAA + P ++  APTA P  P+AA+ P A P   TPPAA  APA P    +P+  T P A
Sbjct: 696  TAAQSAPTSSPQAPTAAPSAPSAASAPQA-PAAPTPPAAPSAPAAPTAPQAPSAPTVPTA 754

Query: 248  PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS--AAFSYSKPIIAATALSA 75
            P   STPS    PST   P APT  +    PS    P +PS  AA S  KP+ A +A +A
Sbjct: 755  PAVPSTPSAPAAPSTPQVPAAPTAPAAPTAPSAPQAPAAPSAPAAPSTPKPLTAPSAPAA 814

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 51/121 (42%), Positives = 65/121 (53%), Gaps = 3/121 (2%)
 Frame = -3

Query: 425  QAPTAAPTKP--PTATPAPTA-QPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP 255
            QAP AAPT P  P+A  APTA Q P+A T PTA P   + P+A  AP+TP   ++P T+P
Sbjct: 723  QAP-AAPTPPAAPSAPAAPTAPQAPSAPTVPTA-PAVPSTPSAPAAPSTPQVPAAP-TAP 779

Query: 254  PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALSA 75
             APT  S P     PS   +P  P P +    P+    P +PSA  +   P  AA +  A
Sbjct: 780  AAPTAPSAPQAPAAPSAPAAPSTPKPLTAPSAPAAPKAPAAPSAPAAPKAP--AAPSAPA 837

Query: 74   A 72
            A
Sbjct: 838  A 838

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 47/131 (35%), Positives = 63/131 (48%), Gaps = 18/131 (13%)
 Frame = -3

Query: 425  QAPTA--APTKP-----PTATPAP-TAQPPAAATPPTATPPTATP-----PAAVPAPATP 285
            QAP+A   PT P     P+A  AP T Q PAA T P A    + P     P+A  AP+TP
Sbjct: 744  QAPSAPTVPTAPAVPSTPSAPAAPSTPQVPAAPTAPAAPTAPSAPQAPAAPSAPAAPSTP 803

Query: 284  APASSPAT-----SPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
             P ++P+      +P AP+  + P     PS   +P AP   S    PS  D P +PSA 
Sbjct: 804  KPLTAPSAPAAPKAPAAPSAPAAPKAPAAPSAPAAPKAPAAPSAPQAPSVPDAPAAPSAP 863

Query: 119  FSYSKPIIAAT 87
             +   P  +A+
Sbjct: 864  AAPKAPGASAS 874

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 45/127 (35%), Positives = 56/127 (44%), Gaps = 16/127 (12%)
 Frame = -3

Query: 428  AQAPTAAPTKP--PTATPAPTAQ-----------PPAAATPPTATPPTA-TPPAAVPAPA 291
            A  P AAP+ P  PTA  AP+A            P A A P T   P A T PAA  AP+
Sbjct: 727  APTPPAAPSAPAAPTAPQAPSAPTVPTAPAVPSTPSAPAAPSTPQVPAAPTAPAAPTAPS 786

Query: 290  TP-APAS-SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAF 117
             P APA+ S   +P  P P + PS    P    +P AP        PS    P +P+A  
Sbjct: 787  APQAPAAPSAPAAPSTPKPLTAPSAPAAPKAPAAPSAPAAPKAPAAPSAPAAPKAPAAPS 846

Query: 116  SYSKPII 96
            +   P +
Sbjct: 847  APQAPSV 853

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 39/111 (35%), Positives = 48/111 (43%), Gaps = 11/111 (9%)
 Frame = -3

Query: 443  ATSCLAQAPTA--APTKP--------PTATPAPTAQPPAAATPPTATPPTATPPAAVPAP 294
            +T  +  APTA  APT P        P+A  AP+   P  A    A P     P+A  AP
Sbjct: 768  STPQVPAAPTAPAAPTAPSAPQAPAAPSAPAAPSTPKPLTAPSAPAAPKAPAAPSAPAAP 827

Query: 293  ATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAP-TPDSLGPGPSGAD 144
              PA  S+PA +P AP   S P     P    +P AP  P + G   S  D
Sbjct: 828  KAPAAPSAPA-APKAPAAPSAPQAPSVPDAPAAPSAPAAPKAPGASASKGD 877

[222][TOP]
>UniRef100_B7J8P1 Outer membrane autotransporter TapA n=1 Tax=Acidithiobacillus
           ferrooxidans ATCC 23270 RepID=B7J8P1_ACIF2
          Length = 991

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 51/126 (40%), Positives = 65/126 (51%), Gaps = 2/126 (1%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP- 255
           L  A    PT  P   PAP A  PA A  P   P  A  PA  PAPA PAPA +PA +P 
Sbjct: 575 LKMAVAGTPTPAPAPAPAP-APAPAPAPAPAPAPAPAPAPAPAPAPA-PAPAPAPAPAPA 632

Query: 254 PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALS 78
           PAP PA  P+ AP P+ A +P PAP P    P P+     P+P    S +    +  A++
Sbjct: 633 PAPAPAPAPAPAPAPAPAPAPAPAPAP---APAPA-----PAPGVTLSNAPAFHSGRAVA 684

Query: 77  AALFAI 60
           A+ +A+
Sbjct: 685 ASTYAV 690

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 55/139 (39%), Positives = 69/139 (49%), Gaps = 2/139 (1%)
 Frame = -3

Query: 497 PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQP-PAAATPPTATPPTA 321
           P+M+ SA     L + +  T   A AP  AP   P   PAP   P PA A  P   P  A
Sbjct: 564 PQMSYSAT-DATLKMAVAGTPTPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPA 622

Query: 320 TPPAAVPAPATPAPASSPATSP-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
             PA  PAPA PAPA +PA +P PAP PA  P+ AP P+     PAP P    PG + ++
Sbjct: 623 PAPAPAPAPA-PAPAPAPAPAPAPAPAPAPAPAPAPAPA-----PAPAP---APGVTLSN 673

Query: 143 TPPSPSAAFSYSKPIIAAT 87
            P     AF   + + A+T
Sbjct: 674 AP-----AFHSGRAVAAST 687

[223][TOP]
>UniRef100_Q9F2B0 TapA protein n=1 Tax=Acidithiobacillus ferrooxidans
           RepID=Q9F2B0_THIFE
          Length = 875

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 51/126 (40%), Positives = 65/126 (51%), Gaps = 2/126 (1%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP- 255
           L  A    PT  P   PAP A  PA A  P   P  A  PA  PAPA PAPA +PA +P 
Sbjct: 575 LKMAVAGTPTPAPAPAPAP-APAPAPAPAPAPAPAPAPAPAPAPAPA-PAPAPAPAPAPA 632

Query: 254 PAPTPASTPSTAPTPSTAGSP-PAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATALS 78
           PAP PA  P+ AP P+ A +P PAP P    P P+     P+P    S +    +  A++
Sbjct: 633 PAPAPAPAPAPAPAPAPAPAPAPAPAP---APAPA-----PAPGVTLSNAPAFHSGRAVA 684

Query: 77  AALFAI 60
           A+ +A+
Sbjct: 685 ASTYAV 690

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 55/139 (39%), Positives = 69/139 (49%), Gaps = 2/139 (1%)
 Frame = -3

Query: 497 PKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQP-PAAATPPTATPPTA 321
           P+M+ SA     L + +  T   A AP  AP   P   PAP   P PA A  P   P  A
Sbjct: 564 PQMSYSAT-DATLKMAVAGTPTPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPA 622

Query: 320 TPPAAVPAPATPAPASSPATSP-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
             PA  PAPA PAPA +PA +P PAP PA  P+ AP P+     PAP P    PG + ++
Sbjct: 623 PAPAPAPAPA-PAPAPAPAPAPAPAPAPAPAPAPAPAPA-----PAPAP---APGVTLSN 673

Query: 143 TPPSPSAAFSYSKPIIAAT 87
            P     AF   + + A+T
Sbjct: 674 AP-----AFHSGRAVAAST 687

[224][TOP]
>UniRef100_Q9FM99 Similarity to carbonic anhydrase n=1 Tax=Arabidopsis thaliana
           RepID=Q9FM99_ARATH
          Length = 350

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 50/119 (42%), Positives = 59/119 (49%), Gaps = 5/119 (4%)
 Frame = -3

Query: 461 LILGLLATSCLAQAPTAAPTKPPTATPAPTA---QPPAAATPPTATP-PTATPPAAVPAP 294
           L+L  ++ + ++ AP   P KP  A PAPT    +P  A TPP   P P  TPP   PAP
Sbjct: 10  LVLIFISITIVSSAPAPKPPKPKPA-PAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAP 68

Query: 293 ATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSPSAA 120
           A   P   PA +P  P P   P  APTP      PAPTP    P P+ A TP P P  A
Sbjct: 69  APTPPKPKPAPAPTPPKP--KPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPA 125

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 39/87 (44%), Positives = 44/87 (50%), Gaps = 8/87 (9%)
 Frame = -3

Query: 419 PTAAPTKP-PTATPAPTA---QPPAAATPPTATP---PTATPPAAVPAPATPAPASSPAT 261
           PT APT P P   PAPT    +P  A TPP   P   PT   P   PAP  P P  +PA 
Sbjct: 44  PTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAP 103

Query: 260 SPPAPTPASTPSTAPTPSTAGSP-PAP 183
           +PP P PA  P+  P P    +P PAP
Sbjct: 104 TPPKPKPAPAPAPTPAPKPKPAPKPAP 130

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 34/83 (40%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPATSPPAPT 243
           P  APT PP   PAP   PP     P  TPP   P PA  P    P PA +P    PAP 
Sbjct: 55  PKPAPT-PPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPA 113

Query: 242 PASTPSTAPTPSTAGSPPAPTPD 174
           PA TP+  P P+   +P     D
Sbjct: 114 PAPTPAPKPKPAPKPAPGGEVED 136

[225][TOP]
>UniRef100_Q7XV47 OSJNBa0086B14.8 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q7XV47_ORYSJ
          Length = 131

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 62/147 (42%), Positives = 80/147 (54%), Gaps = 4/147 (2%)
 Frame = -3

Query: 485 SSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAA 306
           +++ + +  +L LLA +  AQAP ++P           A PP AATP    PPT  P   
Sbjct: 2   AASHLAVLSVLALLAVAATAQAPASSPG----------AAPPQAATP----PPTVAP--- 44

Query: 305 VPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDS-LGPGPSGADTPPSP 129
           VPAP  PAPA   A   PAP  A+TP  APTP+ A    AP PDS + P PS +D  PSP
Sbjct: 45  VPAPKAPAPAPKVAAPAPAPKAAATP--APTPAAA----APAPDSAVSPSPS-SDVSPSP 97

Query: 128 SA-AFSYSKPIIAATAL--SAALFAIA 57
           +A   S + P  AA  L  + A+FA+A
Sbjct: 98  AAEPPSTTSPTGAAAGLRPAFAMFAVA 124

[226][TOP]
>UniRef100_Q7XUL1 Os04g0498700 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q7XUL1_ORYSJ
          Length = 508

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 48/111 (43%), Positives = 62/111 (55%), Gaps = 4/111 (3%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQP--PAAATPPTATPPT-ATPPAAVPAPATPAPASSPATSPP 252
           A + + ++PP+++PAP A    PAA  P   TPPT ATP  A   PAT + +S    + P
Sbjct: 31  AGSGSSSQPPSSSPAPAASSATPAARAPSQRTPPTPATPAKAASPPATNSSSSPRTPAAP 90

Query: 251 APTPASTP-STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           AP P   P +T+P P+   SPPAP P S  P PS + TP SP A    S P
Sbjct: 91  APRPPQPPPATSPAPTKPSSPPAPKPPS-PPAPSPSTTPSSPPAPKPSSPP 140

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 50/128 (39%), Positives = 63/128 (49%), Gaps = 25/128 (19%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAAT----------------PPTATPPTATPPAAVPA 297
           A+AP+   T P  ATPA  A PPA  +                PP AT P  T P++ PA
Sbjct: 55  ARAPSQR-TPPTPATPAKAASPPATNSSSSPRTPAAPAPRPPQPPPATSPAPTKPSSPPA 113

Query: 296 PATPA---------PASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGAD 144
           P  P+         P+S PA  P +P PA+TP+T P+P  + SPPAP P    P P    
Sbjct: 114 PKPPSPPAPSPSTTPSSPPAPKPSSPPPAATPTTKPSPPPS-SPPAPRPSP--PLPPRTP 170

Query: 143 TPPSPSAA 120
            PP P+AA
Sbjct: 171 PPPPPAAA 178

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 42/112 (37%), Positives = 60/112 (53%), Gaps = 5/112 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTAT-PAPT--AQPPAAATPPTATPPTATPPAAVPAP--ATPAPASSPATS 258
           AP   P +PP AT PAPT  + PPA   P    P  +T P++ PAP  ++P PA++P T 
Sbjct: 89  APAPRPPQPPPATSPAPTKPSSPPAPKPPSPPAPSPSTTPSSPPAPKPSSPPPAATPTTK 148

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
           P +P P+S P+  P+P      P P P +  P PS +  P   ++  + S P
Sbjct: 149 P-SPPPSSPPAPRPSPPLPPRTPPPPPPAAAPKPSPSPPPAPTNSTTNSSSP 199

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 42/115 (36%), Positives = 54/115 (46%), Gaps = 14/115 (12%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATP-APTAQPPAAATPPT-ATPPTATPPAAVPAPATPAPASSPA--- 264
           A + T A   P   TP  P     AA+ P T ++    TP A  P P  P PA+SPA   
Sbjct: 48  ASSATPAARAPSQRTPPTPATPAKAASPPATNSSSSPRTPAAPAPRPPQPPPATSPAPTK 107

Query: 263 ---------TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
                     SPPAP+P++TPS+ P P  +  PPA TP +    P  +   P PS
Sbjct: 108 PSSPPAPKPPSPPAPSPSTTPSSPPAPKPSSPPPAATPTTKPSPPPSSPPAPRPS 162

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 38/93 (40%), Positives = 51/93 (54%), Gaps = 4/93 (4%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPP- 252
           A +P+  P+ PP   P P++ PPAA      +PP ++PPA  P P+ P P  +P   PP 
Sbjct: 121 APSPSTTPSSPPA--PKPSSPPPAATPTTKPSPPPSSPPA--PRPSPPLPPRTPPPPPPA 176

Query: 251 -APTPASTPSTAPTPST--AGSPPAPTPDSLGP 162
            AP P+ +P  APT ST  + SP   TP  L P
Sbjct: 177 AAPKPSPSPPPAPTNSTTNSSSPSTSTPVQLSP 209

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 39/106 (36%), Positives = 52/106 (49%), Gaps = 2/106 (1%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPT--ATPPAAVPAPATPAPASSPATSP 255
           A  P + P   P+ TP+    P  ++ PP ATP T  + PP++ PAP  P+P   P T P
Sbjct: 113 APKPPSPPAPSPSTTPSSPPAPKPSSPPPAATPTTKPSPPPSSPPAPR-PSPPLPPRTPP 171

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAF 117
           P P PA+ P  +P+P     PPAPT  +         TP   S  F
Sbjct: 172 PPP-PAAAPKPSPSP-----PPAPTNSTTNSSSPSTSTPVQLSPNF 211

[227][TOP]
>UniRef100_Q41645 Extensin (Fragment) n=1 Tax=Volvox carteri RepID=Q41645_VOLCA
          Length = 464

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 41/108 (37%), Positives = 55/108 (50%)
 Frame = -3

Query: 416 TAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPA 237
           TA+P  P T+ P P   PP+   PP A+PP   PP   P+P  P P SSP   PP P P 
Sbjct: 262 TASPPLPKTSPPPPPRVPPSPP-PPVASPPPPPPPRVSPSPPPPQPVSSP---PPPPPPR 317

Query: 236 STPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
            +PS  P  S+   PP   P    P P  + +PP P ++ S   P+++
Sbjct: 318 PSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVS 365

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 37/101 (36%), Positives = 53/101 (52%), Gaps = 1/101 (0%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAA-TPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           P ++P  PP   P+P+  PP ++ +PP  +PP  +PP   P+P+ P P SSP+  PP  +
Sbjct: 306 PVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVS 365

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
           P   P  A  P    S P P P    P P  +  PP+ +AA
Sbjct: 366 PPPPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAA 406

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 37/102 (36%), Positives = 46/102 (45%), Gaps = 1/102 (0%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAP-ATPAPASSPATSP 255
           L  +P    T PP     P + PP  A+PP   PP  +P    P P ++P P   P  SP
Sbjct: 261 LTASPPLPKTSPPPPPRVPPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSP 320

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
             P P S+PS  P      SPP P P    P P  + +PP P
Sbjct: 321 SPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPP 362

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 37/100 (37%), Positives = 50/100 (50%), Gaps = 3/100 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P+  P  PP   P+P+  PP ++  P+  PP  +PP   P  + P P +S    PP P P
Sbjct: 334 PSPPPPSPPPPRPSPSPPPPRSS--PSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPP 391

Query: 239 ASTPSTAPTPST-AGSPPAPTP--DSLGPGPSGADTPPSP 129
            S P + P P+T A +PP+P P     G  P G   PP P
Sbjct: 392 PSPPPSPPPPATAAANPPSPAPSRSRAGGPPLGTRPPPPP 431

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 40/108 (37%), Positives = 53/108 (49%), Gaps = 11/108 (10%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P A+P  PP    +P+  PP     P ++PP   PP   P+P+ P P SSP+  PP+P P
Sbjct: 285 PVASPPPPPPPRVSPSPPPPQ----PVSSPPPPPPPR--PSPSPPPPRSSPSPPPPSPPP 338

Query: 239 ASTPSTAPTPS-----TAGSPPAPT------PDSLGPGPSGADTPPSP 129
            S P   P+PS     ++ SPP P       P    P P  A +PP P
Sbjct: 339 PSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPP 386

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 41/113 (36%), Positives = 52/113 (46%), Gaps = 13/113 (11%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P ++P+ PP    +P   PP A+ PP   PP ++PP   P P  P P+  P+  PPA   
Sbjct: 353 PRSSPSPPPPVV-SPPPPPPRASPPP---PPASSPP---PPPRPPPPSPPPSPPPPATAA 405

Query: 239 ASTPSTAPTPSTAGSPP-------------APTPDSLGPGPSGADTPPSPSAA 120
           A+ PS AP+ S AG PP             AP PD   P P     PP    A
Sbjct: 406 ANPPSPAPSRSRAGGPPLGTRPPPPPPEDDAPPPDYYFPPPQDMSPPPPKKKA 458

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 43/109 (39%), Positives = 51/109 (46%), Gaps = 8/109 (7%)
 Frame = -3

Query: 431 LAQAPTAAPTKPP-----TATPAPTAQPPAAAT---PPTATPPTATPPAAVPAPATPAPA 276
           ++ +P  A   PP     + +P  TA PP   T   PP   PP+  PP A P P  P P 
Sbjct: 238 VSSSPPPATRSPPPRRITSPSPVLTASPPLPKTSPPPPPRVPPSPPPPVASPPPPPP-PR 296

Query: 275 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
            SP  SPP P P S+P   P P  + SPP P      P PS    PPSP
Sbjct: 297 VSP--SPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPS--PPPPSP 341

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 4/111 (3%)
 Frame = -3

Query: 419 PTAAPTKPP---TATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           P  +P+ PP   + +P P + PP +  PP    P+ +PP    +P+ P P  SP   PP 
Sbjct: 316 PRPSPSPPPPRSSPSPPPPSPPPPSPPPPR---PSPSPPPPRSSPSPPPPVVSPPPPPPR 372

Query: 248 PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTP-PSPSAAFSYSKPI 99
            +P   P+++P P     PP+P P    P  + A+ P P+PS + +   P+
Sbjct: 373 ASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPL 423

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 7/108 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPT 243
           +P+  P +P ++ P P    P+ + PP  + P+  PP+  P P+ P P  SP+  PP  +
Sbjct: 298 SPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSP-PPPSPPPPRPSPSPPPPRSS 356

Query: 242 PASTP---STAPTPSTAGSPP----APTPDSLGPGPSGADTPPSPSAA 120
           P+  P   S  P P  A  PP    +P P    P PS   +PP P+ A
Sbjct: 357 PSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATA 404

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 33/97 (34%), Positives = 46/97 (47%), Gaps = 4/97 (4%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATP---PTATPPAAVPAPATPAPAS-SPATSPPAPTP 240
           P  PP  +P+P    P ++ PP   P   P+  PP + P+P  P+P   SP    P+P+P
Sbjct: 291 PPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSP 350

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSP 129
               S+   P    SPP P P +  P P  +  PP P
Sbjct: 351 PPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPP 387

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 38/128 (29%), Positives = 54/128 (42%), Gaps = 10/128 (7%)
 Frame = -3

Query: 455 LGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAV--PAPATPA 282
           + L+  + +    T +P  PP  + +P      +++PP AT   + PP  +  P+P   A
Sbjct: 206 VALVTAAAVVVQTTPSPPPPPRVSTSPPPPARVSSSPPPAT--RSPPPRRITSPSPVLTA 263

Query: 281 PASSPATSPP--------APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
               P TSPP         P P ++P   P P  + SPP P P S  P P      PSP 
Sbjct: 264 SPPLPKTSPPPPPRVPPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPP 323

Query: 125 AAFSYSKP 102
              S   P
Sbjct: 324 PPRSSPSP 331

[228][TOP]
>UniRef100_C6TAX2 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TAX2_SOYBN
          Length = 269

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 47/109 (43%), Positives = 57/109 (52%), Gaps = 2/109 (1%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTATP--APTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
           A+S  A  P   P +PP  +P  APT  PP    PP ATPP   PP   P PA  +PA +
Sbjct: 88  ASSPKAPTPQTPPPQPPKVSPVAAPTLPPPLPP-PPVATPPPLPPPKIAPTPAKTSPAPA 146

Query: 269 PATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
           PA + PAP PA T   APTP+     P P P +L P P      P+PS+
Sbjct: 147 PAKATPAPAPAPT-KPAPTPA-----PIPPPPTLAPTPIVEVPAPAPSS 189

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 45/108 (41%), Positives = 55/108 (50%), Gaps = 7/108 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQP--PAAATPPTATPPTATPPAA--VPAPATPAPASSPATSP 255
           AP  AP  PP    AP + P  P   TPP   PP  +P AA  +P P  P P ++P   P
Sbjct: 72  APKPAPVTPPAPKVAPASSPKAPTPQTPP-PQPPKVSPVAAPTLPPPLPPPPVATPPPLP 130

Query: 254 P---APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
           P   APTPA    T+P P+ A + PAP P    P P+ A  PP P+ A
Sbjct: 131 PPKIAPTPA---KTSPAPAPAKATPAPAPAPTKPAPTPAPIPPPPTLA 175

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 61/156 (39%), Positives = 76/156 (48%), Gaps = 29/156 (18%)
 Frame = -3

Query: 467 IFLILGLLATSCL----AQAPTAAPTKPPTATPAPTAQ----PPA---AATPPTAT-PPT 324
           +F  L L++  C     AQAP + P   P  T A T+     PPA   AA+PPT + PPT
Sbjct: 4   VFWALALVSLCCQLPSNAQAPASVPANSPPTTLAATSPSSGTPPAVTQAASPPTTSNPPT 63

Query: 323 ATPPAAV----PAPATP-----APASSP-ATSPPAPTPAS---TPSTAPT-PSTAGSPPA 186
            + P A+    PAP TP     APASSP A +P  P P     +P  APT P     PP 
Sbjct: 64  ISQPPAIVAPKPAPVTPPAPKVAPASSPKAPTPQTPPPQPPKVSPVAAPTLPPPLPPPPV 123

Query: 185 PTPDSLGP---GPSGADTPPSPSAAFSYSKPIIAAT 87
            TP  L P    P+ A T P+P+ A +   P  A T
Sbjct: 124 ATPPPLPPPKIAPTPAKTSPAPAPAKATPAPAPAPT 159

[229][TOP]
>UniRef100_C5YBI1 Putative uncharacterized protein Sb06g021550 n=1 Tax=Sorghum
           bicolor RepID=C5YBI1_SORBI
          Length = 498

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 54/141 (38%), Positives = 68/141 (48%), Gaps = 22/141 (15%)
 Frame = -3

Query: 419 PTAAPTKPPTATPA----PTAQP---PAAATPPTATPPT---ATPPAAVPAPATPA-PAS 273
           P A P+ PP A PA    PT  P   P  + PP ATPP    + PP A PAP  P+ PA 
Sbjct: 64  PAAKPSSPPPAAPAGKSSPTPSPRPAPTRSPPPVATPPVPRASPPPGASPAPRPPSRPAM 123

Query: 272 SPATSP-----PAPTPASTPSTAPT----PSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
           +PA  P     PAP P+S P   P     P TA  P  P      P P+ +  PP+P   
Sbjct: 124 APAPKPSPSVAPAPRPSSPPPATPAPPAPPRTAPKPSPPLAPRQSPTPAASPPPPAPPQP 183

Query: 119 FSYSKPIIAAT--ALSAALFA 63
            S S P +++T   LS + +A
Sbjct: 184 PSKSTPTMSSTLGQLSPSFYA 204

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 49/131 (37%), Positives = 62/131 (47%), Gaps = 11/131 (8%)
 Frame = -3

Query: 479 AAVQIFLILGLLATSCLAQAPTA------APTKPPTATPA--PTAQPPAAATPPTATPPT 324
           A V   L+L  L     +Q+P+       + ++PPTA  A  P+   PAA  P  + PPT
Sbjct: 4   AVVCSMLVLSALLALAASQSPSTVLSPAQSASRPPTAPAAARPSFPSPAAPAPRLSRPPT 63

Query: 323 ATPPAAVPAPATPAPASSPATSP-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPG-PSG 150
                + P PA PA  SSP  SP PAPT +  P   P    A  PP  +P    P  P+ 
Sbjct: 64  PAAKPSSPPPAAPAGKSSPTPSPRPAPTRSPPPVATPPVPRASPPPGASPAPRPPSRPAM 123

Query: 149 ADTP-PSPSAA 120
           A  P PSPS A
Sbjct: 124 APAPKPSPSVA 134

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 40/104 (38%), Positives = 51/104 (49%), Gaps = 2/104 (1%)
 Frame = -3

Query: 431 LAQAPTAAPTKPPTATPAP-TAQPPAAATPPTATPPTA-TPPAAVPAPATPAPASSPATS 258
           +A  P    + PP A+PAP     PA A  P  +P  A  P  + P PATPAP + P T+
Sbjct: 97  VATPPVPRASPPPGASPAPRPPSRPAMAPAPKPSPSVAPAPRPSSPPPATPAPPAPPRTA 156

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
            P P+P   P  +PTP+ +  PPAP      P P    TP   S
Sbjct: 157 -PKPSPPLAPRQSPTPAASPPPPAP------PQPPSKSTPTMSS 193

[230][TOP]
>UniRef100_C5X8F7 Putative uncharacterized protein Sb02g032910 n=1 Tax=Sorghum
           bicolor RepID=C5X8F7_SORBI
          Length = 493

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 45/111 (40%), Positives = 64/111 (57%), Gaps = 12/111 (10%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPT--ATPPTATPPAA--VPAPAT-----PAPASSP 267
           P ++P +PP+  PA +   P AA+PP   +TPP A+PP +  VP P +     P PA +P
Sbjct: 366 PASSPPEPPSTPPATSPPEPPAASPPEPPSTPPAASPPESPSVPPPESQSTPPPTPAMAP 425

Query: 266 ATSPPAPTPASTPSTAP-TP--STAGSPPAPTPDSLGPGPSGADTPPSPSA 123
             SPP+  P  +PST P TP  S   +PP  +P +  P  S +D PP+P+A
Sbjct: 426 PESPPSTPPPESPSTPPRTPPESPPSTPPPESPSTTPPPESPSDPPPTPAA 476

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 43/104 (41%), Positives = 55/104 (52%), Gaps = 4/104 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPA-PTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPPA- 249
           PT +P+ PP A+P  P + PP A+ P P +TPP A+PP     P   +P   P+T P A 
Sbjct: 286 PTPSPSTPPAASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEAS 345

Query: 248 -PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            P P STP  A  P    +PPA +P    P    A +PP P AA
Sbjct: 346 PPEPPSTPPEASPPEPPSTPPASSPPE-PPSTPPATSPPEPPAA 388

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 45/107 (42%), Positives = 59/107 (55%), Gaps = 1/107 (0%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS-PATSPPAPT 243
           P A+P +PP +TP   + P   +TPP A+PP   PP+  PA + P P S+ PATSPP P 
Sbjct: 330 PEASPPEPP-STPPEASPPEPPSTPPEASPP--EPPSTPPASSPPEPPSTPPATSPPEPP 386

Query: 242 PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            AS P    TP  A  P +P   S+ P  S +  PP+P+ A   S P
Sbjct: 387 AASPPEPPSTPPAASPPESP---SVPPPESQSTPPPTPAMAPPESPP 430

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 50/118 (42%), Positives = 61/118 (51%), Gaps = 12/118 (10%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPT--ATPPAAVPAPATPAPASSPATSPPAP 246
           P A+P +PP+ TP P A PP   TPP A+PP   +TPP  VP P TP+P++ PA SPP P
Sbjct: 186 PEASPPEPPS-TP-PEASPPEPLTPPEASPPEPPSTPPP-VPEP-TPSPSTPPAASPPEP 241

Query: 245 T----------PASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
                      P STP  AP P     P A  P+     PS  +  PSPS   + S P
Sbjct: 242 PSTPPEASPPEPPSTPPEAPPPEPLTPPEASPPEPPSTPPSVPEPTPSPSTPPAASPP 299

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 53/123 (43%), Positives = 64/123 (52%), Gaps = 17/123 (13%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQP-PAAATPPTATP--PTATPPAAVP--APAT------PAPAS 273
           P A+P +PP+ TP P  +P P+ +TPP A+P  P +TPP A P   P+T      P P +
Sbjct: 209 PEASPPEPPS-TPPPVPEPTPSPSTPPAASPPEPPSTPPEASPPEPPSTPPEAPPPEPLT 267

Query: 272 SPATSPPAP--TPASTPSTAPTPST--AGSPPAP--TPDSLGPGPSGADTPPSPSAAFSY 111
            P  SPP P  TP S P   P+PST  A SPP P  TP    P P    TPP  S     
Sbjct: 268 PPEASPPEPPSTPPSVPEPTPSPSTPPAASPPEPPSTPPEASP-PEPPSTPPEASPPEPP 326

Query: 110 SKP 102
           S P
Sbjct: 327 STP 329

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 42/108 (38%), Positives = 58/108 (53%), Gaps = 6/108 (5%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATP--APTAQPPAAATPPTATPPTATP--PAAVPAPATPA-PASSPA 264
           A +P   P+ PP A+P  +P+  PP + + P  TP  A P  P + P P +P+ P  +P 
Sbjct: 387 AASPPEPPSTPPAASPPESPSVPPPESQSTPPPTPAMAPPESPPSTPPPESPSTPPRTPP 446

Query: 263 TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGP-GPSGADTPPSPSA 123
            SPP+  P  +PST P P +   PP PTP +  P  PS     PSPS+
Sbjct: 447 ESPPSTPPPESPSTTPPPESPSDPP-PTPAATSPESPSDPPATPSPSS 493

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 47/117 (40%), Positives = 58/117 (49%), Gaps = 8/117 (6%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPA------PTAQPPAAATPPTATPPT--ATPPAAVPAPATPAPAS 273
           A +P   P+ PP A+P       P A PP   TPP A+PP   +TPP+ VP P TP+P++
Sbjct: 235 AASPPEPPSTPPEASPPEPPSTPPEAPPPEPLTPPEASPPEPPSTPPS-VPEP-TPSPST 292

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            PA SP  P P STP  A  P    +PP  +P      P  A  P  PS     S P
Sbjct: 293 PPAASP--PEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPP 347

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 43/99 (43%), Positives = 54/99 (54%), Gaps = 4/99 (4%)
 Frame = -3

Query: 419 PTAAPTKPPTATPA-PTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPPAP 246
           PT +P+ PP A+P  P + PP A+ P P +TPP A+PP  +  P   +P   P+T PP P
Sbjct: 166 PTPSPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPLTPPEA-SPPEPPSTPPPVP 224

Query: 245 TPASTPSTAPTPSTAGSPPAP--TPDSLGPGPSGADTPP 135
            P  +PST P    A SPP P  TP    P P    TPP
Sbjct: 225 EPTPSPSTPP----AASPPEPPSTPPEASP-PEPPSTPP 258

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 43/113 (38%), Positives = 56/113 (49%), Gaps = 4/113 (3%)
 Frame = -3

Query: 428 AQAPTAAPTKPPTATPA-PTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSP 255
           A +P   P+ PP A+P  P + PP A+ P P +TPP A+PP     P   +P   P+T P
Sbjct: 295 AASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPP 354

Query: 254 PA--PTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            A  P P STP  +  P    +PPA +P    P P  A  P  PS   + S P
Sbjct: 355 EASPPEPPSTPPASSPPEPPSTPPATSP----PEPPAASPPEPPSTPPAASPP 403

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 46/118 (38%), Positives = 65/118 (55%), Gaps = 8/118 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTATPA-PTAQPPAAATP-PTATPPTATPPA--AVPAPATPA--PASSPAT 261
           +P   P+ PP A+P  P + PP A+ P P +TPP A+PP   + P  A+P   P++ PA+
Sbjct: 309 SPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPAS 368

Query: 260 SPPAPTPASTPSTAPTPSTAGSPPAP--TPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
           SPP P P++ P+T+P    A SPP P  TP +  P P     PP  S +     P +A
Sbjct: 369 SPPEP-PSTPPATSPPEPPAASPPEPPSTPPAASP-PESPSVPPPESQSTPPPTPAMA 424

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 38/106 (35%), Positives = 52/106 (49%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P A+P +PP+  P+     P+ +TPP A+PP   PP+  P  + P P S+P  + P P P
Sbjct: 269 PEASPPEPPSTPPSVPEPTPSPSTPPAASPP--EPPSTPPEASPPEPPSTPPEASP-PEP 325

Query: 239 ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            STP  A  P    +PP  +P      P  A  P  PS   + S P
Sbjct: 326 PSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPASSPP 371

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 38/104 (36%), Positives = 49/104 (47%), Gaps = 5/104 (4%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPA--P 246
           P + P   P  TP+P+  P A+   P +TPP A+PP     P   +P   P+T P A  P
Sbjct: 276 PPSTPPSVPEPTPSPSTPPAASPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPP 335

Query: 245 TPASTPSTAPTPSTAGSPP---APTPDSLGPGPSGADTPPSPSA 123
            P STP  A  P    +PP    P P S  P  S  + P +P A
Sbjct: 336 EPPSTPPEASPPEPPSTPPEASPPEPPSTPPASSPPEPPSTPPA 379

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 41/106 (38%), Positives = 57/106 (53%), Gaps = 7/106 (6%)
 Frame = -3

Query: 422 APTAAPTKPPTATPA-PTAQPPAAATP-PTATPPTATPPAAVPAPATPAPASSPATSPPA 249
           +P   P+ PP A+P  P + PP A+ P P +TPP ++PP     P   +P   PA SPP 
Sbjct: 333 SPPEPPSTPPEASPPEPPSTPPEASPPEPPSTPPASSPPEPPSTPPATSPPEPPAASPPE 392

Query: 248 P---TPASTPSTAPT--PSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P    PA++P  +P+  P  + S P PTP ++ P  S   TPP  S
Sbjct: 393 PPSTPPAASPPESPSVPPPESQSTPPPTP-AMAPPESPPSTPPPES 437

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 39/103 (37%), Positives = 50/103 (48%), Gaps = 5/103 (4%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPP---AAVPAPATPAPASSPATSPPA 249
           P + P   P  TP+P+  P A+   P +TPP A+PP   +  P  + P P + P  SPP 
Sbjct: 156 PPSTPPPVPEPTPSPSTPPEASPPEPPSTPPEASPPEPPSTPPEASPPEPLTPPEASPPE 215

Query: 248 P--TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPS 126
           P  TP   P   P+PST   PPA +P      P  A  P  PS
Sbjct: 216 PPSTPPPVPEPTPSPST---PPAASPPEPPSTPPEASPPEPPS 255

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 39/107 (36%), Positives = 48/107 (44%), Gaps = 7/107 (6%)
 Frame = -3

Query: 389 ATPAPTA---QPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAP---TPASTP 228
           A P P A   Q      PP   PP+  PP  VP P TP+P++ P  SPP P    P ++P
Sbjct: 134 AVPFPRATLRQCIRGPVPPMNPPPSTPPP--VPEP-TPSPSTPPEASPPEPPSTPPEASP 190

Query: 227 STAPTPSTAGSPPAP-TPDSLGPGPSGADTPPSPSAAFSYSKPIIAA 90
              P+     SPP P TP    P    +  PP P    S S P  A+
Sbjct: 191 PEPPSTPPEASPPEPLTPPEASPPEPPSTPPPVPEPTPSPSTPPAAS 237

[231][TOP]
>UniRef100_C1ECP1 Resistance-nodulation-cell division superfamily n=1 Tax=Micromonas
            sp. RCC299 RepID=C1ECP1_9CHLO
          Length = 1523

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 40/99 (40%), Positives = 45/99 (45%), Gaps = 1/99 (1%)
 Frame = -3

Query: 416  TAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPAT-PAPASSPATSPPAPTP 240
            T  P  PP  +P P   PP  A  P   PP + PPA  P P+  P P S PA SPP P P
Sbjct: 856  TVPPPPPPPPSPPPPPPPPFPANAPRPPPPPSPPPAIPPPPSPLPPPPSPPAPSPPPPAP 915

Query: 239  ASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
              TP + P P     PP   P  L P P    +PP   A
Sbjct: 916  VGTPPSPPAPFPPAPPPPSPPPPLPPAPPVPRSPPPKPA 954

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 44/118 (37%), Positives = 54/118 (45%), Gaps = 8/118 (6%)
 Frame = -3

Query: 452  GLLATSCLAQAPTAAPTKPP--------TATPAPTAQPPAAATPPTATPPTATPPAAVPA 297
            G L+T      P  +P  PP           P P + PPA   PP+  PP  +PPA  P+
Sbjct: 852  GWLSTVPPPPPPPPSPPPPPPPPFPANAPRPPPPPSPPPAIPPPPSPLPPPPSPPA--PS 909

Query: 296  PATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSA 123
            P  PAP  +P  SPPAP P + P  +P P    +PP P      P P  A  PP P A
Sbjct: 910  PPPPAPVGTP-PSPPAPFPPAPPPPSPPPPLPPAPPVPR----SPPPKPAWPPPFPRA 962

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 40/111 (36%), Positives = 49/111 (44%), Gaps = 12/111 (10%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPP-----AAVPAPATPAPASSPATSP 255
            P  AP  PP  +P P   PP +  PP  +PP  +PP        P+P  P P + P  SP
Sbjct: 876  PANAPRPPPPPSPPPAIPPPPSPLPPPPSPPAPSPPPPAPVGTPPSPPAPFPPAPPPPSP 935

Query: 254  PAPTPASTP-STAPTPSTAGSPPAPT----PD--SLGPGPSGADTPPSPSA 123
            P P P + P   +P P  A  PP P     PD     P P G   P +P A
Sbjct: 936  PPPLPPAPPVPRSPPPKPAWPPPFPRAPAFPDFPDAPPPPDGIPAPEAPPA 986

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 37/98 (37%), Positives = 45/98 (45%), Gaps = 2/98 (2%)
 Frame = -3

Query: 419  PTAAPTKPPTATPAPTAQPPA-AATPPTATPPTATPPA-AVPAPATPAPASSPATSPPAP 246
            P  +P  PP + PAP+  PPA   TPP  +PP   PPA   P+P  P P + P    P P
Sbjct: 894  PPPSPLPPPPSPPAPSPPPPAPVGTPP--SPPAPFPPAPPPPSPPPPLPPAPPVPRSPPP 951

Query: 245  TPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPS 132
             PA  P     P+    P AP P    P P     PP+
Sbjct: 952  KPAWPPPFPRAPAFPDFPDAPPPPDGIPAPEAPPAPPA 989

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 35/81 (43%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = -3

Query: 341  TATPPTATPPAAVPAPATPAPASSPATSPP-APTPASTPSTAPTPSTAGSPPAPTPDSLG 165
            T  PP   PP+  P P  P PA++P   PP +P PA  P  +P P    SPPAP+P    
Sbjct: 856  TVPPPPPPPPSPPPPPPPPFPANAPRPPPPPSPPPAIPPPPSPLPPPP-SPPAPSP---- 910

Query: 164  PGPSGADTPPSPSAAFSYSKP 102
            P P+   TPPSP A F  + P
Sbjct: 911  PPPAPVGTPPSPPAPFPPAPP 931

[232][TOP]
>UniRef100_B6UDU1 Transcriptional regulatory protein algP n=1 Tax=Zea mays
           RepID=B6UDU1_MAIZE
          Length = 232

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 52/132 (39%), Positives = 67/132 (50%), Gaps = 8/132 (6%)
 Frame = -3

Query: 491 MASSAAVQIF--LILGLLATSCLAQAPTAAPTKPPT--ATPAPTAQPPAAATPPTATPPT 324
           MA+ A V ++  L+  L ATS +AQ+P AAP K P   +   PTA P A    P      
Sbjct: 1   MAARATVVLYAALLCLLFATSSVAQSPAAAPAKAPPKPSKDTPTAAPSATPAAPAPKSSK 60

Query: 323 ATPPAAVPA--PATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG 150
           A+ P+A PA  P TPAPA++PA   P      T + AP P+ A   P  TP +  P  + 
Sbjct: 61  ASSPSAAPAAAPTTPAPAAAPAKPQPKAPAPHTKAAAPAPAAAAPAPVATPPAATPPAAA 120

Query: 149 --ADTPPSPSAA 120
             A  P  PSAA
Sbjct: 121 PPAPVPEVPSAA 132

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 59/154 (38%), Positives = 71/154 (46%), Gaps = 32/154 (20%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAP----TAQPPAAATP-PTATPPTATPPAA---VPAPATPAPASSP 267
           AP AAP KP    PAP     A  PAAA P P ATPP ATPPAA    P P  P+ A +P
Sbjct: 76  APAAAPAKPQPKAPAPHTKAAAPAPAAAAPAPVATPPAATPPAAAPPAPVPEVPSAAPAP 135

Query: 266 ATSP---PAPTP-------------------ASTPSTAPTPSTAGSPPAPTPDSLGPGPS 153
            T P   PAP P                   AS P+ AP      +  APT  +  PGPS
Sbjct: 136 ETKPAEAPAPAPAKKKKPSSSSKDKTKKKKGASAPAPAPVAKKPKTADAPTSAAEAPGPS 195

Query: 152 G--ADTPPSPSAAFSYSKPIIAATALSAALFAIA 57
           G  A    +  AA      ++ ++A++ AL A A
Sbjct: 196 GDAAAAADTAGAAGRTQAGVMVSSAVAVALGAAA 229

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 51/151 (33%), Positives = 60/151 (39%), Gaps = 29/151 (19%)
 Frame = -3

Query: 437 SCLAQAPTAAPTKPPTATPAPTAQP-------PAAATPPTATPPTATPPA--AVPAPATP 285
           S  A +P+AAP   PT TPAP A P       PA  T   A  P A  PA  A P  ATP
Sbjct: 58  SSKASSPSAAPAAAPT-TPAPAAAPAKPQPKAPAPHTKAAAPAPAAAAPAPVATPPAATP 116

Query: 284 APASSPATSPPAPTPASTPSTAPTPSTAGSP--------------------PAPTPDSLG 165
             A+ PA  P  P+ A  P T P  + A +P                     AP P  + 
Sbjct: 117 PAAAPPAPVPEVPSAAPAPETKPAEAPAPAPAKKKKPSSSSKDKTKKKKGASAPAPAPVA 176

Query: 164 PGPSGADTPPSPSAAFSYSKPIIAATALSAA 72
             P  AD P S + A   S    AA   + A
Sbjct: 177 KKPKTADAPTSAAEAPGPSGDAAAAADTAGA 207

 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 34/93 (36%), Positives = 45/93 (48%)
 Frame = -3

Query: 353 ATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPD 174
           AT   A  P A P  A P P+   P ++P+ +P AP P S  S A +PS A   PA  P 
Sbjct: 19  ATSSVAQSPAAAPAKAPPKPSKDTPTAAPSATPAAPAPKS--SKASSPSAA---PAAAPT 73

Query: 173 SLGPGPSGADTPPSPSAAFSYSKPIIAATALSA 75
           +  P P+ A   P P A   ++K    A A +A
Sbjct: 74  T--PAPAAAPAKPQPKAPAPHTKAAAPAPAAAA 104

[233][TOP]
>UniRef100_A9STR8 Predicted protein (Fragment) n=1 Tax=Physcomitrella patens subsp.
           patens RepID=A9STR8_PHYPA
          Length = 325

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 51/120 (42%), Positives = 60/120 (50%), Gaps = 11/120 (9%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPAS---SPATSPP--APT 243
           P  PP   PAP A PP   TPP   PP   PP   PAP+T  P S    PA SPP  +P 
Sbjct: 134 PILPPPPQPAPVAPPPIIVTPPPQVPPPVLPP---PAPSTAPPPSISPPPANSPPPWSPP 190

Query: 242 PASTPSTAPTPST--AGSPPAPTPDSLGPGPSGADTPP----SPSAAFSYSKPIIAATAL 81
           PAS P ++P P    +GSPP     S  P P+ A  PP     P++A   S PI  A A+
Sbjct: 191 PASPPQSSPPPPPPPSGSPPPSRESSPPPPPASAPAPPPTAVPPASAPRGSPPISLAPAV 250

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 44/113 (38%), Positives = 53/113 (46%), Gaps = 12/113 (10%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTA------TPPAAVPAPATPAPASSPAT 261
           +P   P +PP   P P   PP    PP    P A      TPP  VP P  P PA  P+T
Sbjct: 113 SPPPDPFQPPPFVPPPVESPPPILPPPPQPAPVAPPPIIVTPPPQVPPPVLPPPA--PST 170

Query: 260 SPP---APTPASTP---STAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
           +PP   +P PA++P   S  P      SPP P P S  P PS   +PP P A+
Sbjct: 171 APPPSISPPPANSPPPWSPPPASPPQSSPPPPPPPSGSPPPSRESSPPPPPAS 223

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 47/143 (32%), Positives = 63/143 (44%), Gaps = 23/143 (16%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPAT--SPPAP 246
           P   P   P+  P P+  PP A +PP  +PP A+PP + P P  P   S P +  S P P
Sbjct: 160 PPVLPPPAPSTAPPPSISPPPANSPPPWSPPPASPPQSSPPPPPPPSGSPPPSRESSPPP 219

Query: 245 TPASTPSTAPT---PSTA--GSPP----------------APTPDSLGPGPSGADTPPSP 129
            PAS P+  PT   P++A  GSPP                 P P +   GPS A  P  P
Sbjct: 220 PPASAPAPPPTAVPPASAPRGSPPISLAPAVIPRITQPDFTPPPSTNHSGPSSA-LPSPP 278

Query: 128 SAAFSYSKPIIAATALSAALFAI 60
           S+  S +  ++   A   A   +
Sbjct: 279 SSGVSNNSLVVGGAAGGIAALVV 301

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 44/128 (34%), Positives = 53/128 (41%), Gaps = 15/128 (11%)
 Frame = -3

Query: 422 APTAAPTKPP---TATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAP--------A 276
           +P   P+ PP   T+ P    QPP    PP  +PP   PP   PAP  P P         
Sbjct: 99  SPPPNPSPPPLDPTSPPPDPFQPPPFVPPPVESPPPILPPPPQPAPVAPPPIIVTPPPQV 158

Query: 275 SSPATSPPAPTPASTPSTAPTPSTA----GSPPAPTPDSLGPGPSGADTPPSPSAAFSYS 108
             P   PPAP+ A  PS +P P+ +      PPA  P S  P P      P PS   S  
Sbjct: 159 PPPVLPPPAPSTAPPPSISPPPANSPPPWSPPPASPPQSSPPPPPPPSGSPPPSRESSPP 218

Query: 107 KPIIAATA 84
            P  +A A
Sbjct: 219 PPPASAPA 226

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 39/105 (37%), Positives = 44/105 (41%), Gaps = 7/105 (6%)
 Frame = -3

Query: 428 AQAPTAA--PTKPPTATPAPTAQPPAAATPP--TATPPTATPPAAVPAPATPAPASSPAT 261
           AQAP     P  PP  T +P A PP    PP     PP   PP + P P  P+P     T
Sbjct: 54  AQAPFDGNNPAFPPAWTDSPPAPPPDTTAPPDPAGQPPPLLPPESSPPP-NPSPPPLDPT 112

Query: 260 SPPAPTPASTPSTAPTPSTAGS---PPAPTPDSLGPGPSGADTPP 135
           SPP P P   P   P P  +     PP P P  + P P     PP
Sbjct: 113 SPP-PDPFQPPPFVPPPVESPPPILPPPPQPAPVAPPPIIVTPPP 156

[234][TOP]
>UniRef100_A7PLL6 Chromosome chr7 scaffold_20, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PLL6_VITVI
          Length = 235

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 45/118 (38%), Positives = 62/118 (52%), Gaps = 3/118 (2%)
 Frame = -3

Query: 446 LATSCLAQAPTAAPTKPPTATP--APTAQPPAAATPPTATPPTATPPA-AVPAPATPAPA 276
           +AT   +    AAPTK  T  P  APT+ PP A + P A+ P ++PP  AVP PA+   A
Sbjct: 43  VATPPASSPAAAAPTKSKTPAPVTAPTSSPPTAVSSPPASSPVSSPPTPAVPTPASSPVA 102

Query: 275 SSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKP 102
            +P +SPPAP P S+P   P P+ +   PAP        P+   +PP+ + A     P
Sbjct: 103 VTPVSSPPAPVPVSSPPLLP-PAKSPPVPAPANPPAASPPAPVSSPPAETPAAEVPSP 159

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 46/101 (45%), Positives = 56/101 (55%), Gaps = 4/101 (3%)
 Frame = -3

Query: 425 QAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATP-PAAVPAPATPAPASSPAT---S 258
           Q+P A+PT  P    +P    PA ATPP ++P  A P  +  PAP T AP SSP T   S
Sbjct: 22  QSPAASPTATPVTAHSPAT--PAVATPPASSPAAAAPTKSKTPAPVT-APTSSPPTAVSS 78

Query: 257 PPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           PPA +P S+P T   P+ A SP A TP S  P P    +PP
Sbjct: 79  PPASSPVSSPPTPAVPTPASSPVAVTPVSSPPAPVPVSSPP 119

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 57/148 (38%), Positives = 67/148 (45%), Gaps = 43/148 (29%)
 Frame = -3

Query: 440 TSCLAQAPTAAPTK-PPTATPAPTAQPPAAATP----------PTATPPTATPPAAVP-- 300
           T     AP  APT  PPTA  +P A  P ++ P          P A  P ++PPA VP  
Sbjct: 57  TKSKTPAPVTAPTSSPPTAVSSPPASSPVSSPPTPAVPTPASSPVAVTPVSSPPAPVPVS 116

Query: 299 ---------APATPAPASSPATSPPAPT---PASTPSTAPTPSTAGS----------PPA 186
                    +P  PAPA+ PA SPPAP    PA TP+ A  PS A S           PA
Sbjct: 117 SPPLLPPAKSPPVPAPANPPAASPPAPVSSPPAETPA-AEVPSPAPSKKKTKKLKSPAPA 175

Query: 185 PTPDSL--------GPGPSGADTPPSPS 126
           P P++L         PGPS   T PSPS
Sbjct: 176 PAPEALSPPAPPTEAPGPSYDATSPSPS 203

[235][TOP]
>UniRef100_UPI0001983015 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983015
          Length = 469

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 41/100 (41%), Positives = 44/100 (44%), Gaps = 5/100 (5%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSP----- 255
           P   P  PP  TP P + PP    P  A PP  TPP   P PA P   + P T P     
Sbjct: 354 PVPGPAPPPKVTPPPPSPPPPPPAPIPAPPPKETPPPPAPVPAPPPKKTLPQTPPPPAPV 413

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           PAP P  TP  AP P+    PP  TP  L P P     PP
Sbjct: 414 PAPPPKETPPLAPVPA---PPPKETPPPLAPQPKETSPPP 450

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 49/122 (40%), Positives = 54/122 (44%), Gaps = 6/122 (4%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSP-ATSPPAP 246
           AP  AP    T  PAP   PP   TPP   P  A PP   P P TP PA  P  T PPAP
Sbjct: 159 APVPAPPPKETPPPAPVPAPPPKQTPPPPAPVPAPPPKETPPPPTPVPAPPPKETPPPAP 218

Query: 245 TPASTP-STAPTPSTAGSPP----APTPDSLGPGPSGADTPPSPSAAFSYSKPIIAATAL 81
            PA  P  T P PS   +PP     P P +  P P   + P   + A +     IA  A 
Sbjct: 219 VPAPPPKETPPPPSPVPAPPPKETRPPPPTPVPAPPPQEDPECSTPAPAPPPTNIATAAT 278

Query: 80  SA 75
           SA
Sbjct: 279 SA 280

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 43/103 (41%), Positives = 45/103 (43%), Gaps = 4/103 (3%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-TPAPASSPATSPPAP 246
           AP  AP    T  PAP   PP   TPP   P  A PP   P PA  PAP       PPAP
Sbjct: 130 APVPAPPPKETPPPAPVPAPPPKQTPPPPAPVPAPPPKETPPPAPVPAPPPKQTPPPPAP 189

Query: 245 TPASTPSTAPTPSTAGSPPAP---TPDSLGPGPSGADTPPSPS 126
            PA  P   P P T    P P    P +  P P   +TPP PS
Sbjct: 190 VPAPPPKETPPPPTPVPAPPPKETPPPAPVPAPPPKETPPPPS 232

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 44/104 (42%), Positives = 45/104 (43%), Gaps = 4/104 (3%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT----PPAAVPAPATPAPASSPATSPP 252
           P   P  PP  TP P A  P  A PP  TPP A     PP   P P  P PA  P  +PP
Sbjct: 143 PAPVPAPPPKQTPPPPA--PVPAPPPKETPPPAPVPAPPPKQTPPPPAPVPAPPPKETPP 200

Query: 251 APTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
            PTP   P    TP     PPAP P    P P     PPSP  A
Sbjct: 201 PPTPVPAPPPKETP-----PPAPVP---APPPKETPPPPSPVPA 236

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 42/107 (39%), Positives = 44/107 (41%), Gaps = 9/107 (8%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P   P  PP  TP P    P  A PP  TPP A  PA  P    P PA  PA  PP  TP
Sbjct: 83  PPPPPPPPPKVTPPPPPPVPVPAPPPKGTPPPAPVPAPPPKETPPPPAPVPAP-PPKETP 141

Query: 239 ASTPSTAPTPSTAGSPPAPT---------PDSLGPGPSGADTPPSPS 126
              P  AP P     PPAP          P +  P P    TPP P+
Sbjct: 142 PPAPVPAPPPKQTPPPPAPVPAPPPKETPPPAPVPAPPPKQTPPPPA 188

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 41/103 (39%), Positives = 46/103 (44%), Gaps = 4/103 (3%)
 Frame = -3

Query: 422 APTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPA-TPAPASSPATSPPAP 246
           AP    T PP   PA    PP   TPP   P  A PP   P PA  PAP       PPAP
Sbjct: 105 APPPKGTPPPAPVPA----PPPKETPPPPAPVPAPPPKETPPPAPVPAPPPKQTPPPPAP 160

Query: 245 TPASTPSTAPTPSTAGSPP---APTPDSLGPGPSGADTPPSPS 126
            PA  P   P P+   +PP    P P +  P P   +TPP P+
Sbjct: 161 VPAPPPKETPPPAPVPAPPPKQTPPPPAPVPAPPPKETPPPPT 203

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 46/111 (41%), Positives = 48/111 (43%), Gaps = 11/111 (9%)
 Frame = -3

Query: 419 PTAAPTKPPTATP--APTAQPPAAATPPT-----ATPPTATPP-AAVPAP---ATPAPAS 273
           P   P  PP  TP  AP   PP   TPP      A PP  TPP A VPAP    TP P +
Sbjct: 100 PVPVPAPPPKGTPPPAPVPAPPPKETPPPPAPVPAPPPKETPPPAPVPAPPPKQTPPPPA 159

Query: 272 SPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAA 120
                PP  TP   P  AP P     PPAP P    P P     PP+P  A
Sbjct: 160 PVPAPPPKETPPPAPVPAPPPKQTPPPPAPVP---APPPKETPPPPTPVPA 207

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 37/94 (39%), Positives = 41/94 (43%), Gaps = 3/94 (3%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTP 228
           P  PP   P     PP    P  A PP  TPP   PAP  PAP       PPAP PA  P
Sbjct: 82  PPPPPPPPPPKVTPPPPPPVPVPAPPPKGTPP---PAP-VPAPPPKETPPPPAPVPAPPP 137

Query: 227 STAPTPSTAGSPP---APTPDSLGPGPSGADTPP 135
              P P+   +PP    P P +  P P   +TPP
Sbjct: 138 KETPPPAPVPAPPPKQTPPPPAPVPAPPPKETPP 171

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 40/114 (35%), Positives = 48/114 (42%), Gaps = 5/114 (4%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTATPPTAT----PPAAVPAPATPAPASSPA-TSP 255
           P   P  PP  TP P    P  A PP  TPP A     PP   P P +P PA  P  T P
Sbjct: 187 PAPVPAPPPKETPPPPT--PVPAPPPKETPPPAPVPAPPPKETPPPPSPVPAPPPKETRP 244

Query: 254 PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSGADTPPSPSAAFSYSKPIIA 93
           P PTP   P     P  +   PAP P ++    + A T    S    Y+ P ++
Sbjct: 245 PPPTPVPAPPPQEDPECSTPAPAPPPTNIATAATSATT--RTSITLMYNTPAMS 296

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 36/94 (38%), Positives = 41/94 (43%), Gaps = 7/94 (7%)
 Frame = -3

Query: 395 PTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPA-----ST 231
           P   P P    P  A PP  TPP  +PP   PAP  PAP       PPAP PA     + 
Sbjct: 345 PCRPPPPPPPVPGPAPPPKVTPPPPSPPPPPPAPI-PAPPPKETPPPPAPVPAPPPKKTL 403

Query: 230 PSTAPTPSTAGSPPAPTPDSLG--PGPSGADTPP 135
           P T P P+   +PP      L   P P   +TPP
Sbjct: 404 PQTPPPPAPVPAPPPKETPPLAPVPAPPPKETPP 437

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 34/98 (34%), Positives = 40/98 (40%), Gaps = 7/98 (7%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQP-PAAATPPTA---TPPTATPPAAVPAPATPAPASSPATSPPAPTP 240
           P  PP +TP P     P    PP      PP    P   P P  P P  +P   PP P P
Sbjct: 45  PCSPPPSTPPPPRNSCPTQVCPPCVKGICPPCIGKPCPPPPPPPPPPKVTPPPPPPVPVP 104

Query: 239 ASTPSTAPTPSTAGSPP---APTPDSLGPGPSGADTPP 135
           A  P   P P+   +PP    P P +  P P   +TPP
Sbjct: 105 APPPKGTPPPAPVPAPPPKETPPPPAPVPAPPPKETPP 142

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 32/91 (35%), Positives = 38/91 (41%)
 Frame = -3

Query: 407 PTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTP 228
           P +PP         PP    P  A PP  TPP   P P  PAP  +P      P PA  P
Sbjct: 345 PCRPP---------PPPPPVPGPAPPPKVTPPPPSPPPPPPAPIPAPPPKETPPPPAPVP 395

Query: 227 STAPTPSTAGSPPAPTPDSLGPGPSGADTPP 135
           +  P  +   +PP P P    P P   +TPP
Sbjct: 396 APPPKKTLPQTPPPPAP---VPAPPPKETPP 423

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 38/82 (46%), Positives = 39/82 (47%), Gaps = 2/82 (2%)
 Frame = -3

Query: 419 PTAAPTKPPTATPAPTAQPPAAATPPTAT-PPTATPPAAVPAPATPAPASSPATSPPAPT 243
           P   P  PP  TP P A  P  A PP  T P T  PPA VPAP  P   + P    PAP 
Sbjct: 376 PAPIPAPPPKETPPPPA--PVPAPPPKKTLPQTPPPPAPVPAP--PPKETPPLAPVPAPP 431

Query: 242 PAST-PSTAPTPSTAGSPPAPT 180
           P  T P  AP P    SPP PT
Sbjct: 432 PKETPPPLAPQPKET-SPPPPT 452

 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 31/73 (42%), Positives = 35/73 (47%)
 Frame = -3

Query: 344 PTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLG 165
           P   PP   PP  VP PA P   + P  SPP P PA  P  AP P     PPAP P +  
Sbjct: 345 PCRPPP---PPPPVPGPAPPPKVTPPPPSPPPPPPAPIP--APPPKETPPPPAPVP-APP 398

Query: 164 PGPSGADTPPSPS 126
           P  +   TPP P+
Sbjct: 399 PKKTLPQTPPPPA 411

[236][TOP]
>UniRef100_A9WC61 Autotransporter-associated beta strand repeat protein n=2
            Tax=Chloroflexus RepID=A9WC61_CHLAA
          Length = 1320

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 50/130 (38%), Positives = 75/130 (57%), Gaps = 10/130 (7%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
            AT+ +   PTA+ T  P+AT + T +P A+ TP  +   + TP  +  A  TP+P+++ +
Sbjct: 840  ATASVTPEPTASTTPSPSATASATPEPTASVTPSPSATASVTPSPSATASVTPSPSATAS 899

Query: 263  TSPP-------APTPASTPSTAPTPS-TAGSPPAPTPD-SLGPGPSG-ADTPPSPSAAFS 114
            T+P         P+P++T ST P+PS TA + P+P+   S  P PS  A T PSPSA  S
Sbjct: 900  TTPSPSVTASTTPSPSATASTTPSPSATASTTPSPSATASTTPSPSATASTTPSPSATAS 959

Query: 113  YSKPIIAATA 84
             + P  +ATA
Sbjct: 960  -TTPSPSATA 968

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 53/136 (38%), Positives = 72/136 (52%), Gaps = 16/136 (11%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
            AT+     PTA+ T  P+AT + T +P A+ TP  +   + TP  +  A ATP P +S  
Sbjct: 678  ATASATPEPTASTTPSPSATASTTPEPTASTTPSPSATASTTPSPSATASATPEPTASTT 737

Query: 263  TSPPA-----PTPASTPSTAPTPS-TAGSPPAPTPD-SLGPGPSG---------ADTPPS 132
             SP A     P+P++T ST P+PS TA   P+P+   S+ P PS          A T PS
Sbjct: 738  PSPSATASVTPSPSATASTTPSPSATASVTPSPSATASMTPSPSATASATPEPTASTTPS 797

Query: 131  PSAAFSYSKPIIAATA 84
            PSA  S + P  +ATA
Sbjct: 798  PSATASVT-PSPSATA 812

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 54/138 (39%), Positives = 71/138 (51%), Gaps = 9/138 (6%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAA--TPPTATPPTATPPAAVPAPATPAPASS 270
            AT+     PTA+ T  P+AT + T  P A A  TP  +   + TP  +  A  TP P +S
Sbjct: 966  ATASATPEPTASVTPSPSATASTTPSPSATASVTPSPSATASVTPSPSATASTTPEPTAS 1025

Query: 269  PATSPPA-----PTPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSG-ADTPPSPSAAFSY 111
               SP A     P+P++T ST P+PS TA + P PT  S+ P PS  A   PSPSA  S 
Sbjct: 1026 TTPSPSATASTTPSPSATASTTPSPSATASTTPEPTA-SVTPSPSATASVTPSPSATAST 1084

Query: 110  SKPIIAATALSAALFAIA 57
            +    A+T  S +  A A
Sbjct: 1085 TPEPTASTTPSPSATASA 1102

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 56/155 (36%), Positives = 78/155 (50%), Gaps = 7/155 (4%)
 Frame = -3

Query: 506  SLHPKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTA--TPAPTA----QPPAAATP 345
            S+ P+  +SA  +    +    T+     PTA+ T  PTA  TP PTA    +P A+ TP
Sbjct: 595  SVTPEPTASATPEPTASVTPEPTASATPEPTASVTPEPTASATPEPTASVTPEPTASTTP 654

Query: 344  PTATPPTATPPAAVPAPATPAPASSPATSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLG 165
              +   + TP  +  A  TP+P S+ A++ P PT ++TPS + T ST   P A T     
Sbjct: 655  SPSATASVTPSPSATASVTPSP-SATASATPEPTASTTPSPSATASTTPEPTASTT---- 709

Query: 164  PGPSG-ADTPPSPSAAFSYSKPIIAATALSAALFA 63
            P PS  A T PSPSA  S +    A+T  S +  A
Sbjct: 710  PSPSATASTTPSPSATASATPEPTASTTPSPSATA 744

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 55/156 (35%), Positives = 76/156 (48%), Gaps = 15/156 (9%)
 Frame = -3

Query: 506  SLHPKMASSAAVQIFLILGLLATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPP 327
            S+ P+  +SA  +    +    T+     PTA+ T  PTA+  P+    A+ TP  +   
Sbjct: 611  SVTPEPTASATPEPTASVTPEPTASATPEPTASVTPEPTASTTPSPSATASVTPSPSATA 670

Query: 326  TATPPAAVPAPATPAPASSPATSPPA-------------PTPASTPSTAPTPS-TAGSPP 189
            + TP  +  A ATP P +S   SP A             P+P++T ST P+PS TA + P
Sbjct: 671  SVTPSPSATASATPEPTASTTPSPSATASTTPEPTASTTPSPSATASTTPSPSATASATP 730

Query: 188  APTPDSLGPGPSG-ADTPPSPSAAFSYSKPIIAATA 84
             PT  S  P PS  A   PSPSA  S + P  +ATA
Sbjct: 731  EPTA-STTPSPSATASVTPSPSATAS-TTPSPSATA 764

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 47/114 (41%), Positives = 64/114 (56%), Gaps = 4/114 (3%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAA--TPPTATPPTATPPAAVPAPATPAPASS 270
            AT+     PTA+ T  P+AT + T  P A A  TP  +   + TP  +V A  TP+P+++
Sbjct: 858  ATASATPEPTASVTPSPSATASVTPSPSATASVTPSPSATASTTPSPSVTASTTPSPSAT 917

Query: 269  PATSP-PAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG-ADTPPSPSAAFS 114
             +T+P P+ T ++TPS + T ST  SP A    S  P PS  A T PSPSA  S
Sbjct: 918  ASTTPSPSATASTTPSPSATASTTPSPSATA--STTPSPSATASTTPSPSATAS 969

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 52/139 (37%), Positives = 75/139 (53%), Gaps = 19/139 (13%)
 Frame = -3

Query: 443  ATSCLAQAP--TAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASS 270
            AT+ +  +P  TA+ T  P+AT + T +P A+ TP  +   + TP  +  A  TP+P+++
Sbjct: 762  ATASVTPSPSATASMTPSPSATASATPEPTASTTPSPSATASVTPSPSATASTTPSPSAT 821

Query: 269  PATSP---------PAP------TPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSG-ADT 141
             +T+P         P+P      TP  T ST P+PS TA + P PT  S+ P PS  A  
Sbjct: 822  ASTTPSPSATASATPSPSATASVTPEPTASTTPSPSATASATPEPTA-SVTPSPSATASV 880

Query: 140  PPSPSAAFSYSKPIIAATA 84
             PSPSA  S + P  +ATA
Sbjct: 881  TPSPSATASVT-PSPSATA 898

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 51/133 (38%), Positives = 75/133 (56%), Gaps = 13/133 (9%)
 Frame = -3

Query: 443  ATSCLAQAP--TAAPTKPPTATPAPTAQPP--AAATPPTATPPTATPPAAVPAPATPAPA 276
            AT+ +  +P  TA+ T  P+AT + T  P   A+ TP  +   + TP  +  A  TP+P+
Sbjct: 876  ATASVTPSPSATASVTPSPSATASTTPSPSVTASTTPSPSATASTTPSPSATASTTPSPS 935

Query: 275  SSPATSPP-------APTPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSG-ADTPPSPSA 123
            ++ +T+P         P+P++T ST P+PS TA + P PT  S+ P PS  A T PSPSA
Sbjct: 936  ATASTTPSPSATASTTPSPSATASTTPSPSATASATPEPTA-SVTPSPSATASTTPSPSA 994

Query: 122  AFSYSKPIIAATA 84
              S + P  +ATA
Sbjct: 995  TASVT-PSPSATA 1006

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 43/130 (33%), Positives = 70/130 (53%), Gaps = 2/130 (1%)
 Frame = -3

Query: 443  ATSCLAQAPTAAPTKPPTATPAPTAQPPAAATPPTATPPTATPPAAVPAPATPAPASSPA 264
            A++  + + TA+ T  P+AT + T +P A+ TP  +   + TP  +  A  TP+P+   A
Sbjct: 948  ASTTPSPSATASTTPSPSATASATPEPTASVTPSPSATASTTPSPSATASVTPSPS---A 1004

Query: 263  TSPPAPTPASTPSTAPTPSTAGSPPAPTPDSLGPGPSG-ADTPPSPSAAFSYS-KPIIAA 90
            T+   P+P++T ST P P+ + +P      S  P PS  A T PSPSA  S + +P  + 
Sbjct: 1005 TASVTPSPSATASTTPEPTASTTPSPSATASTTPSPSATASTTPSPSATASTTPEPTASV 1064

Query: 89   TALSAALFAI 60
            T   +A  ++
Sbjct: 1065 TPSPSATASV 1074

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 57/141 (40%), Positives = 73/141 (51%), Gaps = 14/141 (9%)
 Frame = -3

Query: 443 ATSCLAQAPTAAPTKPPTA--TPAPTA----QPPAAATP-PT--ATP-PTATPPAAVPAP 294
           AT+     PTA+ T  PTA  TP PTA    +P A+ TP PT  ATP PTA+      A 
Sbjct: 576 ATASATPEPTASVTPEPTASVTPEPTASATPEPTASVTPEPTASATPEPTASVTPEPTAS 635

Query: 293 ATPAPASSPATSPPA---PTPASTPSTAPTPS-TAGSPPAPTPDSLGPGPSGADTPPSPS 126
           ATP P +S    P A   P+P++