BB933756 ( RCC06276 )

[UP]


[1][TOP]
>UniRef100_O81922 Proline-rich protein n=1 Tax=Capsicum annuum RepID=O81922_CAPAN
          Length = 238

 Score =  149 bits (375), Expect = 1e-34
 Identities = 76/105 (72%), Positives = 82/105 (78%), Gaps = 5/105 (4%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPK-PKKPKEPEKPKEPE 179
           KGCG IKSIEI+E   PPKPK PEKPKEP KPK+PEKPKE EKPK P+KPKEPEKPK+PE
Sbjct: 57  KGCGVIKSIEIIE---PPKPKPPEKPKEPEKPKQPEKPKEPEKPKQPEKPKEPEKPKQPE 113

Query: 180 KPK--EKPPPPPEPK-PEPPKEPEKPKEKPPPPP-QPQPMPQPPP 302
           KPK  EKP  P +PK PE PKEPEKPKE P PPP  P P P+  P
Sbjct: 114 KPKEPEKPKAPEKPKEPEKPKEPEKPKEAPKPPPVAPPPAPESVP 158

[2][TOP]
>UniRef100_Q8LJR7 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=Q8LJR7_SOYBN
          Length = 240

 Score =  135 bits (340), Expect = 1e-30
 Identities = 69/97 (71%), Positives = 75/97 (77%), Gaps = 4/97 (4%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPK-PKKPKEPEKPKEPE 179
           KGCG IKSIEI+EPP P  P +PEKPKEP K KEPEKPKE EKPK P+KPKEP KPKEPE
Sbjct: 64  KGCGTIKSIEIVEPPKPKPPPQPEKPKEPEKSKEPEKPKEPEKPKEPEKPKEPPKPKEPE 123

Query: 180 KPK--EKPPPPPEPK-PEPPKEPEKPKEKPPPPPQPQ 281
           KPK  EKP  P +PK PE PKEPEKPK+ P  P  P+
Sbjct: 124 KPKEPEKPKEPEKPKEPEKPKEPEKPKD-PRSPRSPR 159

[3][TOP]
>UniRef100_B9NCM8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NCM8_POPTR
          Length = 267

 Score =  134 bits (337), Expect = 3e-30
 Identities = 77/133 (57%), Positives = 84/133 (63%), Gaps = 27/133 (20%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPP----------KPKEPEKPKEPVKPKEPEKPKEQEKPK-PKKP 149
           KG  A+KSIEI  P  P           KPKEPEKPKEP KPK+PEKPKE EKPK P+KP
Sbjct: 65  KGGEAVKSIEIKVPEKPKAPENPKAAPEKPKEPEKPKEPEKPKQPEKPKEPEKPKEPEKP 124

Query: 150 KEPEKPKEPEKPK--EKPPPPPEPK-PEPPKEPEKPK---------EKPPPPPQPQPMPQ 293
           KEPEKPKEPEKPK  EKP  P +PK PE PKEPEKPK         ++P P P P P P 
Sbjct: 125 KEPEKPKEPEKPKEPEKPKEPEKPKEPEKPKEPEKPKALIVETPKPKEPAPNPAPNPAPP 184

Query: 294 PP----PHIPASC 320
           PP    P  P +C
Sbjct: 185 PPKAPEPVPPRTC 197

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 46/88 (52%), Positives = 52/88 (59%), Gaps = 12/88 (13%)
 Frame = +3

Query: 69  PEKPKEPVKPKEPEKPKEQEKPKPKKPKE-------PEKPKEPEKPK--EKPPPPPEPK- 218
           PEK KE +  K  E  K  E   P+KPK        PEKPKEPEKPK  EKP  P +PK 
Sbjct: 55  PEKIKEKIVCKGGEAVKSIEIKVPEKPKAPENPKAAPEKPKEPEKPKEPEKPKQPEKPKE 114

Query: 219 PEPPKEPEKPK--EKPPPPPQPQPMPQP 296
           PE PKEPEKPK  EKP  P +P+   +P
Sbjct: 115 PEKPKEPEKPKEPEKPKEPEKPKEPEKP 142

[4][TOP]
>UniRef100_B9HD55 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HD55_POPTR
          Length = 266

 Score =  134 bits (337), Expect = 3e-30
 Identities = 77/133 (57%), Positives = 84/133 (63%), Gaps = 27/133 (20%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPP----------KPKEPEKPKEPVKPKEPEKPKEQEKPK-PKKP 149
           KG  A+KSIEI  P  P           KPKEPEKPKEP KPK+PEKPKE EKPK P+KP
Sbjct: 65  KGGEAVKSIEIKVPEKPKAPENPKAAPEKPKEPEKPKEPEKPKQPEKPKEPEKPKEPEKP 124

Query: 150 KEPEKPKEPEKPK--EKPPPPPEPK-PEPPKEPEKPK---------EKPPPPPQPQPMPQ 293
           KEPEKPKEPEKPK  EKP  P +PK PE PKEPEKPK         ++P P P P P P 
Sbjct: 125 KEPEKPKEPEKPKEPEKPKEPEKPKEPEKPKEPEKPKALIVETPKPKEPAPNPAPNPAPP 184

Query: 294 PP----PHIPASC 320
           PP    P  P +C
Sbjct: 185 PPKAPEPVPPRTC 197

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 46/88 (52%), Positives = 52/88 (59%), Gaps = 12/88 (13%)
 Frame = +3

Query: 69  PEKPKEPVKPKEPEKPKEQEKPKPKKPKE-------PEKPKEPEKPK--EKPPPPPEPK- 218
           PEK KE +  K  E  K  E   P+KPK        PEKPKEPEKPK  EKP  P +PK 
Sbjct: 55  PEKIKEKIVCKGGEAVKSIEIKVPEKPKAPENPKAAPEKPKEPEKPKEPEKPKQPEKPKE 114

Query: 219 PEPPKEPEKPK--EKPPPPPQPQPMPQP 296
           PE PKEPEKPK  EKP  P +P+   +P
Sbjct: 115 PEKPKEPEKPKEPEKPKEPEKPKEPEKP 142

[5][TOP]
>UniRef100_Q8VZA7 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana
           RepID=Q8VZA7_ARATH
          Length = 254

 Score =  115 bits (289), Expect = 1e-24
 Identities = 62/121 (51%), Positives = 70/121 (57%), Gaps = 15/121 (12%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPPKP--------------KEPEKPKEPVKPKEPEKPKEQEKPK- 137
           KG G+IK+IEI+EPP PP+P              K PEKPKEP KPK+PEKPKE EKPK 
Sbjct: 68  KGGGSIKTIEIVEPPKPPQPQPQQPPQKPKDAQPKAPEKPKEPEKPKQPEKPKEPEKPKQ 127

Query: 138 PKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
           P+KPKEPEK K+P  P   P P P  KP P   P        P P PQ +P  P   PA 
Sbjct: 128 PEKPKEPEKTKQP-APAPAPAPAPAAKPAPAPAPAPAPAPKQPGPPPQAIPMMPQGQPAM 186

Query: 318 C 320
           C
Sbjct: 187 C 187

[6][TOP]
>UniRef100_UPI0001A7B217 unknown protein n=1 Tax=Arabidopsis thaliana RepID=UPI0001A7B217
          Length = 233

 Score =  112 bits (279), Expect = 2e-23
 Identities = 61/121 (50%), Positives = 69/121 (57%), Gaps = 15/121 (12%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPPKP--------------KEPEKPKEPVKPKEPEKPKEQEKPK- 137
           KG G+IK+IEI+EPP PP+P              K PEKPKEP KPK+PEK KE EKPK 
Sbjct: 47  KGGGSIKTIEIVEPPKPPQPQPQQPPQKPKDAQPKAPEKPKEPEKPKQPEKLKEPEKPKQ 106

Query: 138 PKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
           P+KPKEPEK K+P  P   P P P  KP P   P        P P PQ +P  P   PA 
Sbjct: 107 PEKPKEPEKTKQP-APAPAPAPAPAAKPAPAPAPAPAPAPKQPGPPPQAIPMMPQGQPAM 165

Query: 318 C 320
           C
Sbjct: 166 C 166

[7][TOP]
>UniRef100_B3H4A8 Putative uncharacterized protein At4g16380.1 n=1 Tax=Arabidopsis
           thaliana RepID=B3H4A8_ARATH
          Length = 254

 Score =  112 bits (279), Expect = 2e-23
 Identities = 61/121 (50%), Positives = 69/121 (57%), Gaps = 15/121 (12%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPPKP--------------KEPEKPKEPVKPKEPEKPKEQEKPK- 137
           KG G+IK+IEI+EPP PP+P              K PEKPKEP KPK+PEK KE EKPK 
Sbjct: 68  KGGGSIKTIEIVEPPKPPQPQPQQPPQKPKDAQPKAPEKPKEPEKPKQPEKLKEPEKPKQ 127

Query: 138 PKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
           P+KPKEPEK K+P  P   P P P  KP P   P        P P PQ +P  P   PA 
Sbjct: 128 PEKPKEPEKTKQP-APAPAPAPAPAAKPAPAPAPAPAPAPKQPGPPPQAIPMMPQGQPAM 186

Query: 318 C 320
           C
Sbjct: 187 C 187

[8][TOP]
>UniRef100_Q9ZRE9 ATFP1 (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q9ZRE9_ARATH
          Length = 181

 Score =  110 bits (274), Expect = 6e-23
 Identities = 56/105 (53%), Positives = 69/105 (65%), Gaps = 8/105 (7%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEP--VKPKEPEKPKEQEKPK-PKKPKEPEKPKEPEKPKE 191
           K+IEI+EPP PP+P+  + P++P   +PK PEKPKE EKPK P+KPKEPEKPK+PEKPKE
Sbjct: 1   KTIEIVEPPKPPQPQPQQPPQKPKDAQPKAPEKPKEPEKPKQPEKPKEPEKPKQPEKPKE 60

Query: 192 -----KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
                +P P P P P P  +P  P   P P P P+    PP  IP
Sbjct: 61  PEKTKQPAPAPAPAPAPAAKP-APAPAPAPAPAPKQPGPPPQAIP 104

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 37/86 (43%), Positives = 43/86 (50%), Gaps = 4/86 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPE---KPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP 209
           +P  P KPKEPE   +P+   KPKEPEK K+   P P        P     P  KP P P
Sbjct: 39  KPKQPEKPKEPEKPKQPE---KPKEPEKTKQ---PAP-------APAPAPAPAAKPAPAP 85

Query: 210 EPKPEP-PKEPEKPKEKPPPPPQPQP 284
            P P P PK+P  P +  P  PQ QP
Sbjct: 86  APAPAPAPKQPGPPPQAIPMMPQGQP 111

[9][TOP]
>UniRef100_B6TF33 Circumsporozoite protein n=1 Tax=Zea mays RepID=B6TF33_MAIZE
          Length = 248

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/120 (48%), Positives = 66/120 (55%), Gaps = 14/120 (11%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPPKPKEPEKP-KEPVKPKEPEK--------PKEQEKPKPKKPKE 155
           K C  IK IEI+EPPPPP PK  E+P KE   P  PEK        P + E PK + PKE
Sbjct: 64  KACKIIKQIEIVEPPPPPPPKPKEEPKKEEQAPPPPEKKEEAAPPPPAKVEPPKEEPPKE 123

Query: 156 PEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPP-----PQPQPMPQPPPHIPASC 320
              P + E PKEKPPPP E KP  P  P++ K  PPPP     P P P P P P  P+ C
Sbjct: 124 KPPPPKEEPPKEKPPPPKEEKP-APAPPKEEKPAPPPPKVVEVPYPWPYPYPYPAWPSDC 182

[10][TOP]
>UniRef100_B3MUK3 GF20626 n=1 Tax=Drosophila ananassae RepID=B3MUK3_DROAN
          Length = 1939

 Score =  103 bits (256), Expect = 8e-21
 Identities = 49/91 (53%), Positives = 64/91 (70%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39   EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
            +P PP  PKEP+ PK P +PK P+ PKE + PKP  PKEP+ PK P++PK  P PP EPK
Sbjct: 1685 QPKPPKPPKEPKPPKPPKEPKPPKPPKEPKPPKP--PKEPKPPKPPKEPK-PPKPPKEPK 1741

Query: 219  -PEPPKEPE--KPKEKPPPPPQPQPMPQPPP 302
             P+PPKEP+  KP ++P PP +P+P  +P P
Sbjct: 1742 PPKPPKEPKPPKPPKEPKPPKEPKPPKEPKP 1772

 Score =  101 bits (252), Expect = 2e-20
 Identities = 47/89 (52%), Positives = 61/89 (68%), Gaps = 2/89 (2%)
 Frame = +3

Query: 39   EPPPPPK-PKEPEKPKEPVKPKEPEKPKEQEKPK-PKKPKEPEKPKEPEKPKEKPPPPPE 212
            +PP PPK PK P+ PKEP  PK P++PK  + PK PK PK P++PK P+ PKE  PP P 
Sbjct: 1687 KPPKPPKEPKPPKPPKEPKPPKPPKEPKPPKPPKEPKPPKPPKEPKPPKPPKEPKPPKPP 1746

Query: 213  PKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
             +P+PPK P++P  KPP  P+P   P+PP
Sbjct: 1747 KEPKPPKPPKEP--KPPKEPKPPKEPKPP 1773

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 50/108 (46%), Positives = 63/108 (58%), Gaps = 17/108 (15%)
 Frame = +3

Query: 39   EPPPPPK-PKEPEKPKEPVKPKEPEKPKEQEKPK-PKKPKEPEKPKEPEKPKEKPPPPPE 212
            +PP PPK PK P+ PKEP  PK P++PK  + PK PK PK P++PK P+ PKE  PP P 
Sbjct: 1696 KPPKPPKEPKPPKPPKEPKPPKPPKEPKPPKPPKEPKPPKPPKEPKPPKPPKEPKPPKPP 1755

Query: 213  PKPEPPKEPEKPKEKPPP---------------PPQPQPMPQPPPHIP 311
             +P+PPKEP+ PKE  PP                P+ +PMP  P   P
Sbjct: 1756 KEPKPPKEPKPPKEPKPPKERKFCSFGRKKEKEQPKEEPMPIEPTPRP 1803

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 46/83 (55%), Positives = 58/83 (69%), Gaps = 2/83 (2%)
 Frame = +3

Query: 57   KPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK-PEPPK 233
            K K+P+ PK P +PK P+ PKE + PKP  PKEP+ PK P++PK  P PP EPK P+PPK
Sbjct: 1682 KEKQPKPPKPPKEPKPPKPPKEPKPPKP--PKEPKPPKPPKEPKP-PKPPKEPKPPKPPK 1738

Query: 234  EPEKPK-EKPPPPPQPQPMPQPP 299
            EP+ PK  K P PP+P   P+PP
Sbjct: 1739 EPKPPKPPKEPKPPKPPKEPKPP 1761

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 46/91 (50%), Positives = 60/91 (65%), Gaps = 10/91 (10%)
 Frame = +3

Query: 57   KPKEPEKPKEPVKPKEPEKP-------KEQEKPKPKKP-KEPEKPKEPEKPKEKPPPPPE 212
            KPK+ EKPK+P K +   K        K++++PKP KP KEP+ PK P++PK  P PP E
Sbjct: 1655 KPKK-EKPKKPPKERSSSKSSGFFSCKKKEKQPKPPKPPKEPKPPKPPKEPKP-PKPPKE 1712

Query: 213  PKP-EPPKEPEKPK-EKPPPPPQPQPMPQPP 299
            PKP +PPKEP+ PK  K P PP+P   P+PP
Sbjct: 1713 PKPPKPPKEPKPPKPPKEPKPPKPPKEPKPP 1743

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 53/150 (35%), Positives = 64/150 (42%), Gaps = 59/150 (39%)
 Frame = +3

Query: 39   EPPPPPKPKEPEKPKEPVKPKEPEKP-----------------------KEQEKPKPKKP 149
            +PP PPKP +P KP++P K KEP+K                        KE +KPK KKP
Sbjct: 1582 KPPKPPKPVKPPKPEKPPKIKEPKKKESKVKIKEPKKKKSSSSGFLCFNKELKKPKEKKP 1641

Query: 150  K--------------EPEKPKEPEKP--------------KEKPPPPPEPKPEP------ 227
            K              + EKPK+P K               KEK P PP+P  EP      
Sbjct: 1642 KPSTSSVSSTKEKKPKKEKPKKPPKERSSSKSSGFFSCKKKEKQPKPPKPPKEPKPPKPP 1701

Query: 228  --PKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
              PK P+ PKE  PP P  +P P  PP  P
Sbjct: 1702 KEPKPPKPPKEPKPPKPPKEPKPPKPPKEP 1731

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 52/151 (34%), Positives = 63/151 (41%), Gaps = 60/151 (39%)
 Frame = +3

Query: 39   EPPPPPKPKEPEKPKEPVKPKEPEKP--------------------------------KE 122
            +PP   KP +P KP +PVKP +PEKP                                KE
Sbjct: 1573 KPPKQEKPPKPPKPPKPVKPPKPEKPPKIKEPKKKESKVKIKEPKKKKSSSSGFLCFNKE 1632

Query: 123  QEKPKPKKPK--------------EPEKPKEPE--------------KPKEKPPPPPEPK 218
             +KPK KKPK              + EKPK+P               K KEK P PP+P 
Sbjct: 1633 LKKPKEKKPKPSTSSVSSTKEKKPKKEKPKKPPKERSSSKSSGFFSCKKKEKQPKPPKP- 1691

Query: 219  PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P+ PK P+ PKE  PP P  +P P  PP  P
Sbjct: 1692 PKEPKPPKPPKEPKPPKPPKEPKPPKPPKEP 1722

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 41/145 (28%), Positives = 55/145 (37%), Gaps = 67/145 (46%)
 Frame = +3

Query: 66   EPEKPKEPV-----KPKEPEKPKEQEKPKPKKPKEPEKPKEPE----------------- 179
            +P+K K  +     + K P+ PK+++ PKP KP +P KP +PE                 
Sbjct: 1554 QPKKSKSSLFKCCRRNKSPKPPKQEKPPKPPKPPKPVKPPKPEKPPKIKEPKKKESKVKI 1613

Query: 180  ---------------------KPKEKPPPP----------PEPKPEPPKEPE-------- 242
                                 KPKEK P P           +PK E PK+P         
Sbjct: 1614 KEPKKKKSSSSGFLCFNKELKKPKEKKPKPSTSSVSSTKEKKPKKEKPKKPPKERSSSKS 1673

Query: 243  ------KPKEKPPPPPQPQPMPQPP 299
                  K KEK P PP+P   P+PP
Sbjct: 1674 SGFFSCKKKEKQPKPPKPPKEPKPP 1698

[11][TOP]
>UniRef100_Q9ZNY1 Cell wall protein, putative n=1 Tax=Zea mays RepID=Q9ZNY1_MAIZE
          Length = 378

 Score =  102 bits (255), Expect = 1e-20
 Identities = 49/100 (49%), Positives = 63/100 (63%), Gaps = 9/100 (9%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P PKP+   +PK   KP+   +P+ + +PKP+   EP+   EPE   KP+ KP P P
Sbjct: 274 EPKPEPKPEPKPEPKPEPKPEPKPEPRPEPEPKPEPKPEPKPKPEPEPQPKPEPKPDPKP 333

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQP-----PPHIP 311
           EPKPEP  EP+ KP+ KP P PQP+P P+P     PPHIP
Sbjct: 334 EPKPEPKPEPQPKPEPKPEPKPQPEPKPEPKPKPDPPHIP 373

 Score =  101 bits (252), Expect = 2e-20
 Identities = 48/89 (53%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +PK   KPK   KP+ Q KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 238 EPKPEPRPEPKPEPKPEPKPKPDPKPEPQPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 296

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EPE KP+ KP P P+P+P PQP P
Sbjct: 297 PEPRPEPEPKPEPKPEPKPKPEPEPQPKP 325

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P PKP+   KP+   +PK   KP+ Q KP+PK   +PE   EP+   KP+ KP P P
Sbjct: 182 EPKPEPKPEPQPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKP 241

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EP+ +PK KP P P+PQP P+P P
Sbjct: 242 EPRPEPKPEPKPEPKPKPDPKPEPQPKPEPKP 273

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 46/89 (51%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   KP+ Q KP+PK   +PE   EP+ KP+ KP P PEP
Sbjct: 164 EPKPEPQPKPEPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEP 223

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 224 KPEPKPEP-KPEPKPEPKPEPRPEPKPEP 251

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPK 218
           P P P+PK   KP+   +PK   KPK + KP+PK   +PE   EP+ KPK +P P P+PK
Sbjct: 113 PTPKPEPKPEPKPEPKPEPKIKPKPKPEPKPEPKPEHKPEPKPEPKPKPKPEPKPEPQPK 172

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+PQP P+P P
Sbjct: 173 PEPKPEP-KPEPKPEPKPEPQPKPEPKP 199

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 45/94 (47%), Positives = 59/94 (62%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP+   +PK   KP+   +P+ + KP+PK   KPK   KP+   KP+ KP P P
Sbjct: 218 EPKPEPKPEPKPEPKPEPKPEPKPEPRPEPKPEPKPEPKPKPDPKPEPQPKPEPKPEPKP 277

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP+   KP+ KP P P+P+P P+P P
Sbjct: 278 EPKPEPKPEPKPEPKPEPKPEPRPEPEPKPEPKP 311

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           +P P P+PK   KP+  +KPK   +PK + KP+ K   +PE KPK   +PK +P P PEP
Sbjct: 116 KPEPKPEPKPEPKPEPKIKPKPKPEPKPEPKPEHKPEPKPEPKPKPKPEPKPEPQPKPEP 175

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 176 KPEPKPEP-KPEPKPEPQPKPEPKPEPKP 203

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 46/91 (50%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P P+PK   KP+   +PK   +PK + KP+PK   +PE   EP+   KP+ KP P P
Sbjct: 186 EPKPEPQPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPRP 245

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP KPK  P P PQP+P P+P P
Sbjct: 246 EPKPEPKPEP-KPKPDPKPEPQPKPEPKPEP 275

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   KP+ + +PKP+   EPE   EP+ +PK KP P P+P
Sbjct: 264 EPQPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPRPEPEPKPEPKPEPKPKPEPEPQP 323

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  +P KP+ KP P P+PQP P+P P
Sbjct: 324 KPEPKPDP-KPEPKPEPKPEPQPKPEPKP 351

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 49/96 (51%), Positives = 62/96 (64%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-EPE-KPKEQEKPKPKKPKEPEKPKEPE-----KPKEKP 197
           EP P PKP+   +PK   KPK +PE KP+ Q KP+PK   +PE   EP+     KP+ KP
Sbjct: 140 EPKPEPKPEHKPEPKPEPKPKPKPEPKPEPQPKPEPKPEPKPEPKPEPKPEPQPKPEPKP 199

Query: 198 PPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            P PEPKPEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 200 EPKPEPKPEPQPKPEPKPEPKPEPKPEPKPEPKPEP 235

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 46/100 (46%), Positives = 59/100 (59%), Gaps = 12/100 (12%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP+   KPK   +PK   KP+ + +PKP+   KPK   KP+   KP+ KP P P
Sbjct: 122 EPKPEPKPEPKIKPKPKPEPKPEPKPEHKPEPKPEPKPKPKPEPKPEPQPKPEPKPEPKP 181

Query: 210 EPKPEPPKEPE---------KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP+         KP+ KP P P+P+P P+P P
Sbjct: 182 EPKPEPKPEPQPKPEPKPEPKPEPKPEPQPKPEPKPEPKP 221

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 43/92 (46%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKPK   KP+   KP+   +PK + KP+PK   +PE   EP+ +P+ +P P PEP
Sbjct: 250 EPKPEPKPKPDPKPEPQPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPRPEPEPKPEP 309

Query: 216 KPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE   +PK +P P P+P+P P+P P
Sbjct: 310 KPEPKPKPEPEPQPKPEPKPDPKPEPKPEPKP 341

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 43/89 (48%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKPK   +PK   +PK   KP+ + +PKP+   EP+   EP+ +PK +P P P+P
Sbjct: 152 EPKPEPKPKPKPEPKPEPQPKPEPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPEPQP 211

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 212 KPEPKPEP-KPEPKPEPKPEPKPEPKPEP 239

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 44/94 (46%), Positives = 59/94 (62%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPPP 209
           +P P PKPK   KP+   KP+   +PK + KP+PK   +PK   KP+   +PK +P P P
Sbjct: 154 KPEPKPKPKPEPKPEPQPKPEPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPEPQPKP 213

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP+   KP+ KP P P+P+P P+P P
Sbjct: 214 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPRPEP 247

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 43/91 (47%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P PKP+   +PK   +P+   +PK + KPKP    EP+   EP+   KP+ KP P P
Sbjct: 226 EPKPEPKPEPKPEPKPEPRPEPKPEPKPEPKPKPDPKPEPQPKPEPKPEPKPEPKPEPKP 285

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP KP+ +P P P+P+P P+P P
Sbjct: 286 EPKPEPKPEP-KPEPRPEPEPKPEPKPEPKP 315

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 44/96 (45%), Positives = 58/96 (60%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-----KPKEKPPP 203
           EP P P+PK   KP+   +PK   +PK + KP+PK   +PE   +PE     KP+ KP P
Sbjct: 168 EPQPKPEPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPEP 227

Query: 204 PPEPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
            PEPKPEP  EP+   +P+ KP P P+P+P P P P
Sbjct: 228 KPEPKPEPKPEPKPEPRPEPKPEPKPEPKPKPDPKP 263

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 48/89 (53%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   KPK + +PKP+ PK   KP EP KP+ KP P PEPK
Sbjct: 110 EPLPTPKPEPKPEPKPEPKPEPKIKPKPKPEPKPE-PKPEHKP-EP-KPEPKPKPKPEPK 166

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE KP+ KP P P+P+P PQP P
Sbjct: 167 PEPQPKPEPKPEPKPEPKPEPKPEPQPKP 195

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 43/88 (48%), Positives = 56/88 (63%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + +P+PK   +PE PK    PK +P P PEPK
Sbjct: 214 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPRPEPKPEPKPE-PKPKPDPKPEPQPKPEPK 272

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 273 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 299

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           +P P P+PK   +P    KP+   +PK + KP+PK KPK   +PK   KP+ KP P PEP
Sbjct: 98  QPMPKPQPKSKPEPLPTPKPEPKPEPKPEPKPEPKIKPKPKPEPKPEPKPEHKPEPKPEP 157

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KP+P  EP KP+ +P P P+P+P P+P P
Sbjct: 158 KPKPKPEP-KPEPQPKPEPKPEPKPEPKP 185

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 43/89 (48%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   KP+ + +PKP+   EP+   +PE KPK  P P P+P
Sbjct: 208 EPQPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPRPEPKPEPKPEPKPKPDPKPEPQP 267

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 268 KPEPKPEP-KPEPKPEPKPEPKPEPKPEP 295

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 45/94 (47%), Positives = 56/94 (59%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P P+PK   +P+   KP+   KP+    PKP+   EP+   +PE   KPK KP P P
Sbjct: 84  EPKPEPQPKPNPEPQPMPKPQPKSKPEPLPTPKPEPKPEPKPEPKPEPKIKPKPKPEPKP 143

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           EPKPE   EP+   KPK KP P P+PQP P+P P
Sbjct: 144 EPKPEHKPEPKPEPKPKPKPEPKPEPQPKPEPKP 177

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 43/92 (46%), Positives = 58/92 (63%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P PKP+   +PK   +PK   KP+ + +PKP+   +PE   EP+   KP+ KP P P
Sbjct: 174 EPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPEPKPEPKP 233

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP  +PK +P P P+P+P P+P P
Sbjct: 234 EPKPEPKPEPRPEPKPEPKPEPKPKPDPKPEP 265

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KP+   +PK   KP+ + +PKP+   EP    +PE PK +P P P+PK
Sbjct: 204 EPKPEPQPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPRPEPKPE-PKPEPKPKPDPK 262

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 263 PEPQPKPEPKPEPKPEPKPEPKPEPKPEP 291

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 41/89 (46%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP+   +PK   KP+   +PK + KP+PK    PE   EP+ +PK KP P PEP
Sbjct: 206 KPEPQPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPRPEPKPEPKPEPKPKPDPKPEP 265

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           +P+P  +PE PK +P P P+P+P P+P P
Sbjct: 266 QPKPEPKPE-PKPEPKPEPKPEPKPEPKP 293

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 46/89 (51%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   KP EP+   +PE PK + KP+PK +PK   KPK   KP+ KP   PEP
Sbjct: 96  EPQPMPKPQPKSKP-EPLPTPKPE-PKPEPKPEPKPEPKIKPKPKPEPKPEPKPEHKPEP 153

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  +P KP+ KP P P+P+P P+P P
Sbjct: 154 KPEPKPKP-KPEPKPEPQPKPEPKPEPKP 181

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 39/93 (41%), Positives = 53/93 (56%), Gaps = 4/93 (4%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPE 212
           ++P P P+PK    P    KP+   KP  + +P PK +PK   +P    KP+ KP P PE
Sbjct: 67  MQPLPQPEPKPKPMPHPEPKPEPQPKPNPEPQPMPKPQPKSKPEPLPTPKPEPKPEPKPE 126

Query: 213 PKPEP---PKEPEKPKEKPPPPPQPQPMPQPPP 302
           PKPEP   PK   +PK +P P  +P+P P+P P
Sbjct: 127 PKPEPKIKPKPKPEPKPEPKPEHKPEPKPEPKP 159

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 40/90 (44%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP    +PK   +PK   +P+   KP+PK   EP    +PE KP+ KP P PEP
Sbjct: 72  QPEPKPKPMPHPEPKPEPQPKPNPEPQPMPKPQPKSKPEPLPTPKPEPKPEPKPEPKPEP 131

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           K +P  +PE KP+ KP   P+P+P P+P P
Sbjct: 132 KIKPKPKPEPKPEPKPEHKPEPKPEPKPKP 161

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 10/95 (10%)
 Frame = +3

Query: 42  PPPPPKPK-EPEKPKEPV-----KPKEPEKPKEQEKPKPKKPKEPE---KPKEPEKPKEK 194
           P P P+PK +PE   +P+     KPK    P+ + +P+PK   EP+   KP+   KP+  
Sbjct: 53  PQPEPQPKTKPEPHMQPLPQPEPKPKPMPHPEPKPEPQPKPNPEPQPMPKPQPKSKPEPL 112

Query: 195 PPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           P P PEPKPEP  EP+ +PK KP P P+P+P P+P
Sbjct: 113 PTPKPEPKPEPKPEPKPEPKIKPKPKPEPKPEPKP 147

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 34/74 (45%), Positives = 44/74 (59%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KPK   +P+   +PK   KP+PK   +PE   +PE PK +P P PEPK
Sbjct: 302 EPEPKPEPKPEPKPKPEPEPQPKPEPKPDPKPEPKPEPKPEPQPKPE-PKPEPKPQPEPK 360

Query: 219 PEPPKEPEKPKEKP 260
           PEP  +P+ P   P
Sbjct: 361 PEPKPKPDPPHIPP 374

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 4/64 (6%)
 Frame = +3

Query: 123 QEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPKPEPPKEPE---KPKEKPPPPPQPQPMP 290
           Q +P+PK   EP     P+ +PK KP P PEPKPEP  +P    +P  KP P  +P+P+P
Sbjct: 54  QPEPQPKTKPEPHMQPLPQPEPKPKPMPHPEPKPEPQPKPNPEPQPMPKPQPKSKPEPLP 113

Query: 291 QPPP 302
            P P
Sbjct: 114 TPKP 117

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 29/69 (42%), Positives = 40/69 (57%), Gaps = 2/69 (2%)
 Frame = +3

Query: 102 EPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPKPEPPKEPEK-PKEKPPPPPQ 275
           E  +P+ Q K KP+   +P    EP+ KP   P P PEP+P+P  EP+  PK +P   P+
Sbjct: 51  EMPQPEPQPKTKPEPHMQPLPQPEPKPKPMPHPEPKPEPQPKPNPEPQPMPKPQPKSKPE 110

Query: 276 PQPMPQPPP 302
           P P P+P P
Sbjct: 111 PLPTPKPEP 119

[12][TOP]
>UniRef100_Q8LLM9 cDNA clone:006-310-A12, full insert sequence n=1 Tax=Oryza sativa
           Japonica Group RepID=Q8LLM9_ORYSJ
          Length = 235

 Score =  101 bits (252), Expect = 2e-20
 Identities = 52/107 (48%), Positives = 61/107 (57%), Gaps = 8/107 (7%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPE--KPKEQEKPKPK------KPKEP 158
           K C  IK IEI++ PPPP P  PE   EP K +EP+   PKE+EKP+P       +P  P
Sbjct: 65  KACKIIKEIEIVDLPPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPPPAVIIVEPPAP 124

Query: 159 EKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
               EPE PK++PPPPP PK EP   P K  E P P P P P P  P
Sbjct: 125 APEPEPEPPKKEPPPPPPPKQEPCPPPPKVVEVPYPWPYPYPFPSWP 171

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 21/38 (55%), Positives = 26/38 (68%)
 Frame = +3

Query: 195 PPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           PPPPP P PEP  EP K +E  PPPP+ +  P+PPP +
Sbjct: 79  PPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPPPAV 116

[13][TOP]
>UniRef100_Q75LM5 Expressed protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q75LM5_ORYSJ
          Length = 247

 Score =  101 bits (252), Expect = 2e-20
 Identities = 52/107 (48%), Positives = 61/107 (57%), Gaps = 8/107 (7%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPE--KPKEQEKPKPK------KPKEP 158
           K C  IK IEI++ PPPP P  PE   EP K +EP+   PKE+EKP+P       +P  P
Sbjct: 77  KACKIIKEIEIVDLPPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPPPAVIIVEPPAP 136

Query: 159 EKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
               EPE PK++PPPPP PK EP   P K  E P P P P P P  P
Sbjct: 137 APEPEPEPPKKEPPPPPPPKQEPCPPPPKVVEVPYPWPYPYPFPSWP 183

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 21/38 (55%), Positives = 26/38 (68%)
 Frame = +3

Query: 195 PPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           PPPPP P PEP  EP K +E  PPPP+ +  P+PPP +
Sbjct: 91  PPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPPPAV 128

[14][TOP]
>UniRef100_Q0DNI1 Os03g0751600 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group
           RepID=Q0DNI1_ORYSJ
          Length = 237

 Score =  101 bits (252), Expect = 2e-20
 Identities = 52/107 (48%), Positives = 61/107 (57%), Gaps = 8/107 (7%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPE--KPKEQEKPKPK------KPKEP 158
           K C  IK IEI++ PPPP P  PE   EP K +EP+   PKE+EKP+P       +P  P
Sbjct: 67  KACKIIKEIEIVDLPPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPPPAVIIVEPPAP 126

Query: 159 EKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
               EPE PK++PPPPP PK EP   P K  E P P P P P P  P
Sbjct: 127 APEPEPEPPKKEPPPPPPPKQEPCPPPPKVVEVPYPWPYPYPFPSWP 173

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 21/38 (55%), Positives = 26/38 (68%)
 Frame = +3

Query: 195 PPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           PPPPP P PEP  EP K +E  PPPP+ +  P+PPP +
Sbjct: 81  PPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPPPAV 118

[15][TOP]
>UniRef100_B9FBU8 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9FBU8_ORYSJ
          Length = 233

 Score =  101 bits (252), Expect = 2e-20
 Identities = 52/107 (48%), Positives = 61/107 (57%), Gaps = 8/107 (7%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPE--KPKEQEKPKPK------KPKEP 158
           K C  IK IEI++ PPPP P  PE   EP K +EP+   PKE+EKP+P       +P  P
Sbjct: 63  KACKIIKEIEIVDLPPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPPPAVIIVEPPAP 122

Query: 159 EKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
               EPE PK++PPPPP PK EP   P K  E P P P P P P  P
Sbjct: 123 APEPEPEPPKKEPPPPPPPKQEPCPPPPKVVEVPYPWPYPYPFPSWP 169

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 21/38 (55%), Positives = 26/38 (68%)
 Frame = +3

Query: 195 PPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           PPPPP P PEP  EP K +E  PPPP+ +  P+PPP +
Sbjct: 77  PPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPPPAV 114

[16][TOP]
>UniRef100_B8AJX2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8AJX2_ORYSI
          Length = 248

 Score =  101 bits (252), Expect = 2e-20
 Identities = 52/107 (48%), Positives = 61/107 (57%), Gaps = 8/107 (7%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPE--KPKEQEKPKPK------KPKEP 158
           K C  IK IEI++ PPPP P  PE   EP K +EP+   PKE+EKP+P       +P  P
Sbjct: 78  KACKIIKEIEIVDLPPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPPPAVIIVEPPAP 137

Query: 159 EKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
               EPE PK++PPPPP PK EP   P K  E P P P P P P  P
Sbjct: 138 APEPEPEPPKKEPPPPPPPKQEPCPPPPKVVEVPYPWPYPYPFPSWP 184

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 21/38 (55%), Positives = 26/38 (68%)
 Frame = +3

Query: 195 PPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           PPPPP P PEP  EP K +E  PPPP+ +  P+PPP +
Sbjct: 92  PPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPPPAV 129

[17][TOP]
>UniRef100_B0FXV3 Putative uncharacterized protein n=1 Tax=Bacillus thuringiensis
           RepID=B0FXV3_BACTU
          Length = 455

 Score =  100 bits (250), Expect = 4e-20
 Identities = 55/98 (56%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KE 191
           K  E  +P  P KP EPEKP EP KP EPEKP E EKP +P+KP EPEKP EPEKP   E
Sbjct: 250 KPTEPEKPTDPGKPTEPEKPTEPEKPTEPEKPTEPEKPTEPEKPTEPEKPTEPEKPTDPE 309

Query: 192 KPPPPPEP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           KP  P +P  PE P +PEKP   EKP  P +P    +P
Sbjct: 310 KPTDPEKPTDPEKPTDPEKPTDPEKPTEPEKPTDPEKP 347

 Score =  100 bits (248), Expect = 7e-20
 Identities = 54/98 (55%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KE 191
           K  E  +P  P KP EPEKP EP KP EPEKP E EKP +P+KP +PEKP +PEKP   E
Sbjct: 262 KPTEPEKPTEPEKPTEPEKPTEPEKPTEPEKPTEPEKPTEPEKPTDPEKPTDPEKPTDPE 321

Query: 192 KPPPPPEP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           KP  P +P  PE P EPEKP   EKP  P +P    +P
Sbjct: 322 KPTDPEKPTDPEKPTEPEKPTDPEKPTDPEKPTDPEKP 359

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 54/98 (55%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KE 191
           K  E  +P  P KP EPEKP +P KP EPEKP E EKP +P+KP EPEKP EPEKP   E
Sbjct: 238 KPTEPEKPTNPEKPTEPEKPTDPGKPTEPEKPTEPEKPTEPEKPTEPEKPTEPEKPTEPE 297

Query: 192 KPPPPPEP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           KP  P +P  PE P +PEKP   EKP  P +P    +P
Sbjct: 298 KPTEPEKPTDPEKPTDPEKPTDPEKPTDPEKPTDPEKP 335

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 53/98 (54%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPK-PKKPKEPEKPKEPEKPK--E 191
           K  E  +P  P KP EPEKP EP KP EPEKP E EKP  P+KP +PEKP +PEKP   E
Sbjct: 268 KPTEPEKPTEPEKPTEPEKPTEPEKPTEPEKPTEPEKPTDPEKPTDPEKPTDPEKPTDPE 327

Query: 192 KPPPPPEP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           KP  P +P +PE P +PEKP   EKP  P +P    +P
Sbjct: 328 KPTDPEKPTEPEKPTDPEKPTDPEKPTDPEKPTEPEKP 365

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 53/98 (54%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KE 191
           K  E  +P  P KP EPEKP  P KP EPEKP +  KP +P+KP EPEKP EPEKP   E
Sbjct: 226 KPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKPTDPGKPTEPEKPTEPEKPTEPEKPTEPE 285

Query: 192 KPPPPPEP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           KP  P +P +PE P EPEKP   EKP  P +P    +P
Sbjct: 286 KPTEPEKPTEPEKPTEPEKPTDPEKPTDPEKPTDPEKP 323

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/98 (53%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KE 191
           K  E  +P  P KP EPEKP EP KP EPEKP + EKP  P+KP +PEKP +PEKP   E
Sbjct: 274 KPTEPEKPTEPEKPTEPEKPTEPEKPTEPEKPTDPEKPTDPEKPTDPEKPTDPEKPTDPE 333

Query: 192 KPPPPPEP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           KP  P +P  PE P +PEKP   EKP  P +P    +P
Sbjct: 334 KPTEPEKPTDPEKPTDPEKPTDPEKPTEPEKPTDPEKP 371

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 50/92 (54%), Positives = 60/92 (65%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KEKPPPPP 209
           +P  P KP EPEKP +P KP +PEKP + EKP +P+KP +PEKP EPEKP   EKP  P 
Sbjct: 328 KPTDPEKPTEPEKPTDPEKPTDPEKPTDPEKPTEPEKPTDPEKPTEPEKPTNPEKPTEPE 387

Query: 210 EP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           +P  PE P EPEKP   EKP  P +P    +P
Sbjct: 388 KPTNPEKPTEPEKPTNPEKPTEPEKPTNPEKP 419

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/98 (53%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KE 191
           K  E  +P  P KP +PEKP +P KP EPEKP + EKP +P+KP  PEKP EPEKP   E
Sbjct: 334 KPTEPEKPTDPEKPTDPEKPTDPEKPTEPEKPTDPEKPTEPEKPTNPEKPTEPEKPTNPE 393

Query: 192 KPPPPPEP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           KP  P +P  PE P EPEKP   EKP  P +P    +P
Sbjct: 394 KPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKPTNPEKP 431

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 52/98 (53%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KE 191
           K  E  +P  P KP EPEKP +P KP +PEKP + EKP  P+KP +PEKP EPEKP   E
Sbjct: 286 KPTEPEKPTEPEKPTEPEKPTDPEKPTDPEKPTDPEKPTDPEKPTDPEKPTEPEKPTDPE 345

Query: 192 KPPPPPEP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           KP  P +P  PE P EPEKP   EKP  P +P    +P
Sbjct: 346 KPTDPEKPTDPEKPTEPEKPTDPEKPTEPEKPTNPEKP 383

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 50/92 (54%), Positives = 59/92 (64%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KEKPPPPP 209
           +P  P KP +PEKP +P KP EPEKP + EKP  P+KP +PEKP EPEKP   EKP  P 
Sbjct: 316 KPTDPEKPTDPEKPTDPEKPTEPEKPTDPEKPTDPEKPTDPEKPTEPEKPTDPEKPTEPE 375

Query: 210 EP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           +P  PE P EPEKP   EKP  P +P    +P
Sbjct: 376 KPTNPEKPTEPEKPTNPEKPTEPEKPTNPEKP 407

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 51/98 (52%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPK-PKKPKEPEKPKEPEKP--KE 191
           K  E  +P  P KP EPEKP EP KP +PEKP + EKP  P+KP +PEKP +PEKP   E
Sbjct: 280 KPTEPEKPTEPEKPTEPEKPTEPEKPTDPEKPTDPEKPTDPEKPTDPEKPTDPEKPTEPE 339

Query: 192 KPPPPPEP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           KP  P +P  PE P +PEKP   EKP  P +P    +P
Sbjct: 340 KPTDPEKPTDPEKPTDPEKPTEPEKPTDPEKPTEPEKP 377

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 49/90 (54%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKE--KPPPPP 209
           +P  P KP EPEKP  P KP EPEKP   EKP +P+KP  PEKP EPEKP +  KP  P 
Sbjct: 208 KPTNPEKPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKPTDPGKPTEPE 267

Query: 210 EP-KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +P +PE P EPEKP E P  P +P+   +P
Sbjct: 268 KPTEPEKPTEPEKPTE-PEKPTEPEKPTEP 296

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 52/94 (55%), Positives = 58/94 (61%), Gaps = 8/94 (8%)
 Frame = +3

Query: 39  EPPPPP----KPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KEKP 197
           E P PP    KP  PEKP EP KP  PEKP E EKP  P+KP EPEKP  PEKP   EKP
Sbjct: 198 EKPKPPIGPEKPTNPEKPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKP 257

Query: 198 PPPPEP-KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
             P +P +PE P EPEKP E P  P +P+   +P
Sbjct: 258 TDPGKPTEPEKPTEPEKPTE-PEKPTEPEKPTEP 290

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 52/98 (53%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KE 191
           K  E  +P  P KP EPEKP  P KP EPEKP   EKP +P+KP +P KP EPEKP   E
Sbjct: 214 KPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKPTDPGKPTEPEKPTEPE 273

Query: 192 KPPPPPEP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           KP  P +P +PE P EPEKP   EKP  P +P    +P
Sbjct: 274 KPTEPEKPTEPEKPTEPEKPTEPEKPTEPEKPTDPEKP 311

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 49/96 (51%), Positives = 61/96 (63%), Gaps = 4/96 (4%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPK-PKKPKEPEKPKEPEKP--KE 191
           K  E  +P  P KP +PEKP +P KP +PEKP + EKP  P+KP EPEKP +PEKP   E
Sbjct: 292 KPTEPEKPTEPEKPTDPEKPTDPEKPTDPEKPTDPEKPTDPEKPTEPEKPTDPEKPTDPE 351

Query: 192 KPPPPPEP-KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           KP  P +P +PE P +PEKP E P  P  P+   +P
Sbjct: 352 KPTDPEKPTEPEKPTDPEKPTE-PEKPTNPEKPTEP 386

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 50/98 (51%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KE 191
           K  E  +P  P KP +PEKP +P KP +PEKP + EKP +P+KP +PEKP +PEKP   E
Sbjct: 298 KPTEPEKPTDPEKPTDPEKPTDPEKPTDPEKPTDPEKPTEPEKPTDPEKPTDPEKPTDPE 357

Query: 192 KPPPPPEP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           KP  P +P  PE P EPEKP   EKP  P +P    +P
Sbjct: 358 KPTEPEKPTDPEKPTEPEKPTNPEKPTEPEKPTNPEKP 395

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 49/90 (54%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KEKPPPPP 209
           +P  P KP +PEKP EP KP +PEKP E EKP  P+KP EPEKP  PEKP   EKP  P 
Sbjct: 346 KPTDPEKPTDPEKPTEPEKPTDPEKPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKPTNPE 405

Query: 210 EP-KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +P +PE P  PEKP E P  P  P+   +P
Sbjct: 406 KPTEPEKPTNPEKPTE-PEKPTNPEKPAEP 434

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 48/90 (53%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPK-PKKPKEPEKPKEPEKP--KEKPPPPP 209
           +P  P KP +PEKP EP KP +PEKP + EKP  P+KP EPEKP +PEKP   EKP  P 
Sbjct: 322 KPTDPEKPTDPEKPTEPEKPTDPEKPTDPEKPTDPEKPTEPEKPTDPEKPTEPEKPTNPE 381

Query: 210 EP-KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +P +PE P  PEKP E P  P  P+   +P
Sbjct: 382 KPTEPEKPTNPEKPTE-PEKPTNPEKPTEP 410

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 52/99 (52%), Positives = 61/99 (61%), Gaps = 7/99 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPK-PKKPKEPEKPKEPEKPKE--KPPPPP 209
           +P  P KP +PEKP +P KP +PEKP E EKP  P+KP EPEKP  PEKP E  KP  P 
Sbjct: 334 KPTEPEKPTDPEKPTDPEKPTDPEKPTEPEKPTDPEKPTEPEKPTNPEKPTEPEKPTNPE 393

Query: 210 EP-KPEPPKEPEKP--KEKPPPPPQP-QPMPQPPPHIPA 314
           +P +PE P  PEKP   EKP  P +P +P     P  PA
Sbjct: 394 KPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKPTNPEKPA 432

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 50/92 (54%), Positives = 57/92 (61%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPK--EKPPPPP 209
           +P  P KP EPEKP +P KP EPEKP   EKP +P+KP  PEKP EPEKP   EKP  P 
Sbjct: 352 KPTDPEKPTEPEKPTDPEKPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKPTNPEKPTEPE 411

Query: 210 EP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           +P  PE P EPEKP   EKP  P +     +P
Sbjct: 412 KPTNPEKPTEPEKPTNPEKPAEPEKTTNQEKP 443

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 47/90 (52%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPK-PKKPKEPEKPKEPEKP--KEKPPPPP 209
           +P  P KP +PEKP +P KP +PEKP E EKP  P+KP +PEKP +PEKP   EKP  P 
Sbjct: 310 KPTDPEKPTDPEKPTDPEKPTDPEKPTEPEKPTDPEKPTDPEKPTDPEKPTEPEKPTDPE 369

Query: 210 EP-KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +P +PE P  PEKP E P  P  P+   +P
Sbjct: 370 KPTEPEKPTNPEKPTE-PEKPTNPEKPTEP 398

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 47/87 (54%), Positives = 54/87 (62%), Gaps = 4/87 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KEKPPPPP 209
           +P  P KP +PEKP EP KP  PEKP E EKP  P+KP EPEKP  PEKP   EKP  P 
Sbjct: 358 KPTEPEKPTDPEKPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKPTNPE 417

Query: 210 EP-KPEPPKEPEKPKEKPPPPPQPQPM 287
           +P +PE P  PEKP E      Q +P+
Sbjct: 418 KPTEPEKPTNPEKPAEPEKTTNQEKPV 444

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 49/86 (56%), Positives = 54/86 (62%), Gaps = 6/86 (6%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KE 191
           K  E  +P  P KP EPEKP  P KP EPEKP   EKP +P+KP  PEKP EPEKP   E
Sbjct: 358 KPTEPEKPTDPEKPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKPTNPEKPTEPEKPTNPE 417

Query: 192 KPPPPPEP-KPEPPKEPEKP--KEKP 260
           KP  P +P  PE P EPEK   +EKP
Sbjct: 418 KPTEPEKPTNPEKPAEPEKTTNQEKP 443

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 41/94 (43%), Positives = 48/94 (51%), Gaps = 13/94 (13%)
 Frame = +3

Query: 54  PKPKEPEKPKEPVKPKEPEKPKEQ----EKPKP----KKPKEPEKPKEPEKP--KEKPPP 203
           P  K+P+    P    E E    +    EKPKP    +KP  PEKP EPEKP   EKP  
Sbjct: 170 PSEKKPDTTVNPPIITEGENGNTENTGTEKPKPPIGPEKPTNPEKPTEPEKPTNPEKPTE 229

Query: 204 PPEP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           P +P  PE P EPEKP   EKP  P +P    +P
Sbjct: 230 PEKPTNPEKPTEPEKPTNPEKPTEPEKPTDPGKP 263

[18][TOP]
>UniRef100_B6SRV9 Early nodulin 75 protein n=1 Tax=Zea mays RepID=B6SRV9_MAIZE
          Length = 338

 Score =  100 bits (250), Expect = 4e-20
 Identities = 48/93 (51%), Positives = 61/93 (65%), Gaps = 2/93 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P PKP+   +PK   KP+   +PK + KP+PK   EPE   EP KP+  P P PEPK
Sbjct: 242 KPEPEPKPEPKPEPKPEPKPEPRPEPKPEPKPEPKPKPEPEPKPEP-KPEHLPEPKPEPK 300

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQP-PPHIP 311
           PEP  +PE KP+ KP P P+P+P P+P PPHIP
Sbjct: 301 PEPQPKPEPKPEPKPQPEPKPEPKPKPDPPHIP 333

 Score =  100 bits (249), Expect = 5e-20
 Identities = 47/89 (52%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPK 218
           P P P+PK   KP+   +PK   KPK + KP+PK   +PE   EPE KP+ KP P PEPK
Sbjct: 113 PTPKPEPKPEPKPEPKPEPKMKPKPKPESKPEPKPDHKPEPKPEPEPKPEPKPEPKPEPK 172

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE KP+ KP P P+P+P PQP P
Sbjct: 173 PEPQPKPEPKPEPKPEPKPEPKPEPQPKP 201

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 45/90 (50%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   +PK + KP+PK   +PE   EP+ KP+ KP P PEP
Sbjct: 152 EPKPEPEPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEP 211

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KP+P  +PE KP+ KP P P+PQP P+P P
Sbjct: 212 KPQPQPKPEPKPEPKPEPKPEPQPKPEPKP 241

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 46/89 (51%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   KP+ Q KP+PK   +PE KP+   KP+ KP P PEP
Sbjct: 170 EPKPEPQPKPEPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPQPQPKPEPKPEPKPEP 229

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE PK KP P P+P+P P+P P
Sbjct: 230 KPEPQPKPE-PKPKPEPEPKPEPKPEPKP 257

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 46/89 (51%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP+   KP+   +PK   KP+ Q KP+PK   +PE   EP+ KP+ KP P PEP
Sbjct: 188 EPKPEPKPEPQPKPEPKPEPKPEPKPQPQPKPEPKPEPKPEPKPEPQPKPEPKPKPEPEP 247

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 248 KPEPKPEP-KPEPKPEPRPEPKPEPKPEP 275

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/91 (49%), Positives = 58/91 (63%), Gaps = 2/91 (2%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           ++P P P+ K   KP    +PK   +PK + KP+PK   +PE   +PE KP+ KP P PE
Sbjct: 133 MKPKPKPESKPEPKPDHKPEPKPEPEPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPE 192

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PKPEP  +PE KP+ KP P PQPQP P+P P
Sbjct: 193 PKPEPQPKPEPKPEPKPEPKPQPQPKPEPKP 223

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 44/92 (47%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   +PK + KP+PK   +PE   +PE KPK +P P PEP
Sbjct: 192 EPKPEPQPKPEPKPEPKPEPKPQPQPKPEPKPEPKPEPKPEPQPKPEPKPKPEPEPKPEP 251

Query: 216 KPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP+   +P+ KP P P+P+P P+P P
Sbjct: 252 KPEPKPEPKPEPRPEPKPEPKPEPKPKPEPEP 283

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 46/95 (48%), Positives = 61/95 (64%), Gaps = 4/95 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+PK   KP+   KP+   +PK + KP+P+   EP+   EPE KP+ KP P PEP
Sbjct: 200 KPEPKPEPKPEPKPQPQPKPEPKPEPKPEPKPEPQPKPEPKPKPEPEPKPEPKPEPKPEP 259

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP---PPHIP 311
           KPEP  EP KP+ KP P P+P+P P+P   P H+P
Sbjct: 260 KPEPRPEP-KPEPKPEPKPKPEPEPKPEPKPEHLP 293

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 43/90 (47%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP+   KP+   +PK   KP+ + +P+PK   +PE   EP+ +P+ KP P PEP
Sbjct: 166 EPKPEPKPEPQPKPEPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPQPQPKPEPKPEP 225

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP+ KP+ KP P P+P+P P+P P
Sbjct: 226 KPEPKPEPQPKPEPKPKPEPEPKPEPKPEP 255

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 43/87 (49%), Positives = 57/87 (65%), Gaps = 2/87 (2%)
 Frame = +3

Query: 48  PPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPKPE 224
           P PKP+   KP+   +PK   KP+ Q KP+PK   +PE   EP+ +P+ KP P PEPKPE
Sbjct: 151 PEPKPEPEPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPEPKPEPQPKPEPKPEPKPE 210

Query: 225 PPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P  +P+ KP+ KP P P+P+P PQP P
Sbjct: 211 PKPQPQPKPEPKPEPKPEPKPEPQPKP 237

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 47/106 (44%), Positives = 58/106 (54%), Gaps = 18/106 (16%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P PKP+   KP+   +PK   KP+ Q KP+PK   EPE   EP+   KP+ KP P P
Sbjct: 206 EPKPEPKPQPQPKPEPKPEPKPEPKPEPQPKPEPKPKPEPEPKPEPKPEPKPEPKPEPRP 265

Query: 210 EPKPEPPKEPEK---------------PKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP+                P+ KP P P+PQP P+P P
Sbjct: 266 EPKPEPKPEPKPKPEPEPKPEPKPEHLPEPKPEPKPEPQPKPEPKP 311

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 44/93 (47%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-----KPKEKPPP 203
           EP P PK K   KP+   +PK   KP+ + +P+PK   +PE   EP+     KP+ KP P
Sbjct: 126 EPKPEPKMKPKPKPESKPEPKPDHKPEPKPEPEPKPEPKPEPKPEPKPEPQPKPEPKPEP 185

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PEPKPEP  EP+ PK +P P P+P+P PQP P
Sbjct: 186 KPEPKPEPKPEPQ-PKPEPKPEPKPEPKPQPQP 217

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 42/92 (45%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPPP 209
           +P P P+PK   KP+   KP+   +PK + KP+PK   +PK   KP+   +PK +P P P
Sbjct: 160 KPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPQPQPKP 219

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP+ +P+ KP P P+P+P P+P P
Sbjct: 220 EPKPEPKPEPKPEPQPKPEPKPKPEPEPKPEP 251

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 42/92 (45%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P PKP+   +PK   +PK   KP+ + +PKP+   +PE   EP+   KP+ +P P P
Sbjct: 180 EPKPEPKPEPKPEPKPEPQPKPEPKPEPKPEPKPQPQPKPEPKPEPKPEPKPEPQPKPEP 239

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PKPEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 240 KPKPEPEPKPEPKPEPKPEPKPEPRPEPKPEP 271

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 47/94 (50%), Positives = 58/94 (61%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP    KP EP+   +PE PK + KP+PK +PK   KPK   KP+ KP   PEP
Sbjct: 96  EPQPMPKPLPKSKP-EPLPTPKPE-PKPEPKPEPKPEPKMKPKPKPESKPEPKPDHKPEP 153

Query: 216 KPEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE     KP+ KP P P+P+P P+P P
Sbjct: 154 KPEPEPKPEPKPEPKPEPKPEPQPKPEPKPEPKP 187

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 42/90 (46%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+P+   KP    KP+    PK + KP+PK   +PE   +P+ KP+ KP P P+ 
Sbjct: 90  QPKPNPEPQPMPKPLPKSKPEPLPTPKPEPKPEPKPEPKPEPKMKPKPKPESKPEPKPDH 149

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  EPE KP+ KP P P+P+P PQP P
Sbjct: 150 KPEPKPEPEPKPEPKPEPKPEPKPEPQPKP 179

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 41/94 (43%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP    +PK   +PK   +P+   KP PK   EP    +PE KP+ KP P PEP
Sbjct: 72  QPEPKPKPMPHPEPKPEPQPKPNPEPQPMPKPLPKSKPEPLPTPKPEPKPEPKPEPKPEP 131

Query: 216 KPEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
           K +P  +PE     KP  KP P P+P+P P+P P
Sbjct: 132 KMKPKPKPESKPEPKPDHKPEPKPEPEPKPEPKP 165

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 41/88 (46%), Positives = 52/88 (59%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   +P+   KP    KP+    PKP+   EP+   +PE PK KP P PE K
Sbjct: 84  EPKPEPQPKPNPEPQPMPKPLPKSKPEPLPTPKPEPKPEPKPEPKPE-PKMKPKPKPESK 142

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP K   KP+ KP P P+P+P P+P P
Sbjct: 143 PEP-KPDHKPEPKPEPEPKPEPKPEPKP 169

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 4/93 (4%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK-PKEPEKPKEPEKPKEKPPPPPE 212
           ++P P P+PK    P    KP+   KP  + +P PK  PK   +P    KP+ KP P PE
Sbjct: 67  MQPLPQPEPKPKPMPHPEPKPEPQPKPNPEPQPMPKPLPKSKPEPLPTPKPEPKPEPKPE 126

Query: 213 PKPEPPKEPE-KPKEKPPPPP--QPQPMPQPPP 302
           PKPEP  +P+ KP+ KP P P  +P+P P+P P
Sbjct: 127 PKPEPKMKPKPKPESKPEPKPDHKPEPKPEPEP 159

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 4/64 (6%)
 Frame = +3

Query: 123 QEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPKPEPPKEPE---KPKEKPPPPPQPQPMP 290
           Q +P+PK   EP     P+ +PK KP P PEPKPEP  +P    +P  KP P  +P+P+P
Sbjct: 54  QPEPQPKTKPEPHMQPLPQPEPKPKPMPHPEPKPEPQPKPNPEPQPMPKPLPKSKPEPLP 113

Query: 291 QPPP 302
            P P
Sbjct: 114 TPKP 117

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 34/87 (39%), Positives = 41/87 (47%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P+PK         KP+   +P  Q +PKPK    PE   EP+ PK  P P P PKP
Sbjct: 53  PQPEPQPK--------TKPEPHMQPLPQPEPKPKPMPHPEPKPEPQ-PKPNPEPQPMPKP 103

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P  +PE         P P P P+P P
Sbjct: 104 LPKSKPE---------PLPTPKPEPKP 121

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 27/55 (49%), Positives = 34/55 (61%), Gaps = 7/55 (12%)
 Frame = +3

Query: 159 EKPKEPEKPKEKPP------PPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           E P+   +PK KP       P PEPKP+P   PE KP+ +P P P+PQPMP+P P
Sbjct: 51  EMPQPEPQPKTKPEPHMQPLPQPEPKPKPMPHPEPKPEPQPKPNPEPQPMPKPLP 105

[19][TOP]
>UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q8L685_VOLCA
          Length = 1009

 Score =  100 bits (249), Expect = 5e-20
 Identities = 43/92 (46%), Positives = 44/92 (47%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            PP  P  P   PPPPP P P P PPP +P S
Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 43/92 (46%), Positives = 43/92 (46%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           L PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P
Sbjct: 240 LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P PP  P  P   PPPPP P P P PPP  P
Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 215 PPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 672 PPPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 675 LPPSPPPPPPPPPPPPPPPPPPPPPPPPHP 704

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 42/101 (41%), Positives = 45/101 (44%)
 Frame = +3

Query: 9   CGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK 188
           C  + ++    PPPP  P  P  P  P  P  P  P     P P  P  P  P  P  P 
Sbjct: 198 CCPVSTVIGYNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPP 257

Query: 189 EKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PPPPP P P PP  P  P   PPPPP P P P PPP  P
Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 41/90 (45%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPP  P  P  P  P+ P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 41/90 (45%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P+P  PP  P
Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP PP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 221 PPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 43/96 (44%), Positives = 43/96 (44%), Gaps = 6/96 (6%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669

Query: 222 EPP------KEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP        P  P   PPPPP P P P PPPH P
Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPP  P P
Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 680 PPPPPPPPPPPPPPPPPPPPPPPHPPPPSP 709

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P PPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 41/89 (46%), Positives = 41/89 (46%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P 
Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PP  P  P   PPPPP P P P PPP  P
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 41/91 (45%), Positives = 42/91 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PP PP P P
Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
            PP  P  P   PPPPP   P P PPP +PA
Sbjct: 685 PPPPPPPPPPPPPPPPPPHPPPPSPPPLVPA 715

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP PP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 218 PPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP    P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP PP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P  PP  P
Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PP   P
Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P   P PPP  P
Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P   PPP  P
Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP   P P PPP  P
Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P   P PPP  P
Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPP  P P P PPP  P
Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PP PP P P P PPP  P
Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PP PP P P P PPP  P
Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P    PPPP P P P PPP  P
Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P      PPPPP P P P PPP  P
Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 43/99 (43%), Positives = 44/99 (44%), Gaps = 6/99 (6%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PP PP P P
Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPP------PHIPASC 320
            PP  P  P   PPPPP P P P PP      P +P SC
Sbjct: 682 PPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPPSC 720

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPP  P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 41/90 (45%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   P PPP P P P PPP  P
Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694

[20][TOP]
>UniRef100_C5X0A2 Putative uncharacterized protein Sb01g007870 n=1 Tax=Sorghum
           bicolor RepID=C5X0A2_SORBI
          Length = 235

 Score =  100 bits (249), Expect = 5e-20
 Identities = 57/115 (49%), Positives = 67/115 (58%), Gaps = 9/115 (7%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPPKPKEPEKP-KEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE 179
           K C  IK IEI+EPPPPP P++ E+P KE   P  PEK +E   P P   +EP K    E
Sbjct: 64  KACKIIKQIEIVEPPPPPPPEKKEEPKKEEPAPPPPEKKEEPAPPPPAIVEEPPK----E 119

Query: 180 KPKEKPPPPPEPKPEPPKE-PEKPKEKPPPP-------PQPQPMPQPPPHIPASC 320
           KPKE+ PP  +PK EPPKE P  PKE+P PP       P P P P P P  P+ C
Sbjct: 120 KPKEE-PPKEKPKEEPPKEKPPPPKEQPAPPPPKVVEIPYPWPYPYPYPAWPSDC 173

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 42/101 (41%), Positives = 53/101 (52%), Gaps = 21/101 (20%)
 Frame = +3

Query: 60  PKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP-----PEPKP- 221
           P +PEK  + +  K  +  K+ E  +P  P  PEK +EP+K +  PPPP     P P P 
Sbjct: 51  PFDPEKLADKLCCKACKIIKQIEIVEPPPPPPPEKKEEPKKEEPAPPPPEKKEEPAPPPP 110

Query: 222 ----EPPKE-------PEKPKEKP----PPPPQPQPMPQPP 299
               EPPKE        EKPKE+P    PPPP+ QP P PP
Sbjct: 111 AIVEEPPKEKPKEEPPKEKPKEEPPKEKPPPPKEQPAPPPP 151

[21][TOP]
>UniRef100_A7KH48 Proline-rich protein n=1 Tax=Sorghum bicolor RepID=A7KH48_SORBI
          Length = 415

 Score =  100 bits (248), Expect = 7e-20
 Identities = 49/96 (51%), Positives = 60/96 (62%), Gaps = 5/96 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KPK   KP+   +PK +  PKP+   +PE   EP KPK +P P PEPK
Sbjct: 317 EPLPKPEPKPEPKPKPEPKPEPKPEPKPEPLPKPEPKPKPEPKPEP-KPKPEPKPEPEPK 375

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQP-----PPHIP 311
           PEP  EP KP+ KP P P+P+P P+P     PPHIP
Sbjct: 376 PEPKPEP-KPEPKPEPKPKPEPKPEPKPKPNPPHIP 410

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 49/89 (55%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KP+   KP+   KP  + KPKPKKP EP KPK   KP+ KP P PEPK
Sbjct: 107 EPKPEPQPKPITKPEPKPKPEPMPKPMPEPKPKPKKP-EP-KPKPEPKPEPKPEPEPEPK 164

Query: 219 PEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP PK   KP+ KP P P+P+P P+P P
Sbjct: 165 PEPLPKPEPKPEPKPKPEPKPEPKPEPKP 193

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 45/93 (48%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-----KPKEPEKPKEKPPP 203
           +P P PKP+   +PK   KP+   KPK + KP+PK   +PE     +PK   KPK KP P
Sbjct: 174 KPEPKPKPEPKPEPKPEPKPEPMPKPKPEPKPEPKPEPKPEPMPKPEPKPEPKPKPKPEP 233

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PEPKPEP  EP  PK +P P P+P+P P+P P
Sbjct: 234 KPEPKPEPKPEPLPPKPEPKPEPKPEPKPEPKP 266

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 50/103 (48%), Positives = 61/103 (59%), Gaps = 9/103 (8%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPE-------KPKEP 176
           K I   EP P P+P     P+   KPK+PE KPK + KP+PK   EPE       KP+  
Sbjct: 115 KPITKPEPKPKPEPMPKPMPEPKPKPKKPEPKPKPEPKPEPKPEPEPEPKPEPLPKPEPK 174

Query: 177 EKPKEKPPPPPEPKPEPPKEP-EKPKEKPPPPPQPQPMPQPPP 302
            +PK KP P PEPKPEP  EP  KPK +P P P+P+P P+P P
Sbjct: 175 PEPKPKPEPKPEPKPEPKPEPMPKPKPEPKPEPKPEPKPEPMP 217

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 42/89 (47%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   +PK   KP+   KP+   KP P+   +P+KP+   KP+ KP P PEP+
Sbjct: 101 EPSPKPEPKPEPQPKPITKPEPKPKPEPMPKPMPEPKPKPKKPEPKPKPEPKPEPKPEPE 160

Query: 219 PEPPKEP-EKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP  KP+ KP P P+P+P P+P P
Sbjct: 161 PEPKPEPLPKPEPKPEPKPKPEPKPEPKP 189

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 50/99 (50%), Positives = 62/99 (62%), Gaps = 8/99 (8%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE---KPKEQEKPKPKKPKEPE---KPKEPEKPKEKP 197
           EP P PKP+ EPE   EP+   EP+   KPK + KP+PK   +PE   KPK   KP+ KP
Sbjct: 150 EPKPEPKPEPEPEPKPEPLPKPEPKPEPKPKPEPKPEPKPEPKPEPMPKPKPEPKPEPKP 209

Query: 198 PPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHIP 311
            P PEP P+P  +PE KPK KP P P+P+P P+P P  P
Sbjct: 210 EPKPEPMPKPEPKPEPKPKPKPEPKPEPKPEPKPEPLPP 248

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 44/89 (49%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   KP+   +PK   KP+ + +PKP+   EP  PK   KP+ KP P PEPK
Sbjct: 206 EPKPEPKPEPMPKPEPKPEPKPKPKPEPKPEPKPEPKPEPLPPKPEPKPEPKPEPKPEPK 265

Query: 219 PEPPKEP-EKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP  KP+ KP P P+P+P P P P
Sbjct: 266 PEPKPEPLPKPEPKPEPKPEPKPKPLPKP 294

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 46/90 (51%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKP-PPPPE 212
           +P P PKPK   KP+   +PK    PK + KP+PK KPK   KP+   +PK +P PP PE
Sbjct: 192 KPEPMPKPKPEPKPEPKPEPKPEPMPKPEPKPEPKPKPKPEPKPEPKPEPKPEPLPPKPE 251

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PKPEP  EP KP+ KP P P+P P P+P P
Sbjct: 252 PKPEPKPEP-KPEPKPEPKPEPLPKPEPKP 280

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 50/95 (52%), Positives = 62/95 (65%), Gaps = 8/95 (8%)
 Frame = +3

Query: 42  PPPPPKPKEPE-KPKEPVKPK-----EPE-KPKEQEKPKPK-KPKEPEKPKEPEKPKEKP 197
           P P PKPK+PE KPK   KP+     EPE KP+   KP+PK +PK   +PK   KP+ KP
Sbjct: 134 PEPKPKPKKPEPKPKPEPKPEPKPEPEPEPKPEPLPKPEPKPEPKPKPEPKPEPKPEPKP 193

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P P+PKPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 194 EPMPKPKPEPKPEP-KPEPKPEPMPKPEPKPEPKP 227

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 46/94 (48%), Positives = 58/94 (61%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-----KPKEKPPP 203
           EP P P+PK   KPK   KP+   +PK +  PKPK   +PE   EP+     KP+ KP P
Sbjct: 166 EPLPKPEPKPEPKPKPEPKPEPKPEPKPEPMPKPKPEPKPEPKPEPKPEPMPKPEPKPEP 225

Query: 204 PPEPKPEPPKEPEKPKEKPPP-PPQPQPMPQPPP 302
            P+PKPEP  EP KP+ KP P PP+P+P P+P P
Sbjct: 226 KPKPKPEPKPEP-KPEPKPEPLPPKPEPKPEPKP 258

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 44/93 (47%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPPP 209
           +P P P+PK   KP+   KPK   KP+ + +PKP+   KP+   +PK   KP+ KP P P
Sbjct: 180 KPEPKPEPKPEPKPEPMPKPKPEPKPEPKPEPKPEPMPKPEPKPEPKPKPKPEPKPEPKP 239

Query: 210 EPKPE--PPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EPKPE  PPK   KP+ KP P P+P+P P+P P
Sbjct: 240 EPKPEPLPPKPEPKPEPKPEPKPEPKPEPKPEP 272

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 42/88 (47%), Positives = 54/88 (61%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +P    +PK   KPK + +PKP+   EP+    P KP+ KP P PEPK
Sbjct: 202 EPKPEPKPEPKPEPMPKPEPKPEPKPKPKPEPKPEPKPEPKPEPLPPKPEPKPEPKPEPK 261

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+  P P P+P+P P+P P
Sbjct: 262 PEPKPEP-KPEPLPKPEPKPEPKPEPKP 288

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 47/93 (50%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK---EPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPP 206
           EP P PKPK   +PK   KP+   EP  PK + KP+PK   +PE   EP+ +P  KP P 
Sbjct: 220 EPKPEPKPKPKPEPKPEPKPEPKPEPLPPKPEPKPEPKPEPKPEPKPEPKPEPLPKPEPK 279

Query: 207 PEPKPEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEPKPEP PK   KP+ KP P P+P+P P+P P
Sbjct: 280 PEPKPEPKPKPLPKPEPKPEPLPKPEPKPEPKP 312

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 44/90 (48%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   +PK   KP+   KP+ + +PKP+ KPK   KP+   +P  KP P PEP
Sbjct: 251 EPKPEPKPEPKPEPKPEPKPEPLPKPEPKPEPKPEPKPKPLPKPEPKPEPLPKPEPKPEP 310

Query: 216 KPEPPKEP-EKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP  KP+ KP P P+P+P P+P P
Sbjct: 311 KPEPKPEPLPKPEPKPEPKPKPEPKPEPKP 340

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/92 (48%), Positives = 57/92 (61%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP-EKPKEKPPPPPEP 215
           EP P PKP+   +PK    PK   KP+ + +PKPK   +PE   EP  KP+ KP P PEP
Sbjct: 255 EPKPEPKPEPKPEPKPEPLPKPEPKPEPKPEPKPKPLPKPEPKPEPLPKPEPKPEPKPEP 314

Query: 216 KPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE   +PK KP P P+P+P P+P P
Sbjct: 315 KPEPLPKPEPKPEPKPKPEPKPEPKPEPKPEP 346

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 45/96 (46%), Positives = 58/96 (60%), Gaps = 5/96 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-----KPKEPEKPKEPEKPKEKPPP 203
           EP P PKP+   KP+   +PK   +PK + KP+PK     KPK   KP+   +PK +P P
Sbjct: 158 EPEPEPKPEPLPKPEPKPEPKPKPEPKPEPKPEPKPEPMPKPKPEPKPEPKPEPKPEPMP 217

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PEPKPEP  +P KP+ KP P P+P+P P PP   P
Sbjct: 218 KPEPKPEPKPKP-KPEPKPEPKPEPKPEPLPPKPEP 252

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P PKP+   KPK   KP+   +PK +  PKP+   EP+ KPK   KP+ KP P PEP
Sbjct: 186 EPKPEPKPEPMPKPKPEPKPEPKPEPKPEPMPKPEPKPEPKPKPKPEPKPEPKPEPKPEP 245

Query: 216 ---KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
              KPEP  EP+ +PK +P P P+P+P+P+P P
Sbjct: 246 LPPKPEPKPEPKPEPKPEPKPEPKPEPLPKPEP 278

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 45/92 (48%), Positives = 56/92 (60%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP+   KP+   +PK   KPK   KP+PK    PK   KP+   +PK +P P P
Sbjct: 263 EPKPEPKPEPLPKPEPKPEPKPEPKPKPLPKPEPKPEPLPKPEPKPEPKPEPKPEPLPKP 322

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE KP+ KP P P+P P P+P P
Sbjct: 323 EPKPEPKPKPEPKPEPKPEPKPEPLPKPEPKP 354

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 43/90 (47%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK    PK + KP+PK   EP+   +PE KP+  P P PEP
Sbjct: 144 EPKPKPEPKPEPKPEPEPEPKPEPLPKPEPKPEPKPKPEPKPEPKPEPKPEPMPKPKPEP 203

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP+ +P  KP P P+P+P P+P P
Sbjct: 204 KPEPKPEPKPEPMPKPEPKPEPKPKPKPEP 233

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 42/88 (47%), Positives = 54/88 (61%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P PKP+   +PK    PK   KP+ + KPKP+   EP+   +PE    KP P PEPK
Sbjct: 198 KPKPEPKPEPKPEPKPEPMPKPEPKPEPKPKPKPEPKPEPKPEPKPEPLPPKPEPKPEPK 257

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 258 PEPKPEP-KPEPKPEPLPKPEPKPEPKP 284

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 47/96 (48%), Positives = 58/96 (60%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP EP  PK   KP+   +PK + KP+PK    PK   KP+   +PK KP P P
Sbjct: 236 EPKPEPKP-EPLPPKPEPKPEPKPEPKPEPKPEPKPEPLPKPEPKPEPKPEPKPKPLPKP 294

Query: 210 EPKPEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE     KP+ KP P P+P+P P+P P
Sbjct: 295 EPKPEPLPKPEPKPEPKPEPKPEPLPKPEPKPEPKP 330

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 43/88 (48%), Positives = 55/88 (62%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P PK   KP+   +PK    PK + KP+PK   EP+   +PE PK +P P PEPK
Sbjct: 295 EPKPEPLPKPEPKPEPKPEPKPEPLPKPEPKPEPKPKPEPKPEPKPE-PKPEPLPKPEPK 353

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+P  +PE PK KP P P+P+P P+P P
Sbjct: 354 PKPEPKPE-PKPKPEPKPEPEPKPEPKP 380

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 44/91 (48%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE---KPKEPEKPKEKPPPPP 209
           EP P PKP+   KP    +PK    PK + KP+PK   +PE   KP+   +PK KP P P
Sbjct: 277 EPKPEPKPEPKPKPLPKPEPKPEPLPKPEPKPEPKPEPKPEPLPKPEPKPEPKPKPEPKP 336

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP  PK +P P P+P+P P+P P
Sbjct: 337 EPKPEPKPEP-LPKPEPKPKPEPKPEPKPKP 366

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 42/91 (46%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KPK   +PK   KP+ + +P P KP+   +PK   KP+ KP P PEP 
Sbjct: 214 EPMPKPEPKPEPKPKPKPEPKPEPKPEPKPEPLPPKPEPKPEPKPEPKPEPKPEPKPEPL 273

Query: 219 PEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           P+P  +PE   +PK KP P P+P+P P P P
Sbjct: 274 PKPEPKPEPKPEPKPKPLPKPEPKPEPLPKP 304

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 45/98 (45%), Positives = 57/98 (58%), Gaps = 10/98 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPP 209
           EP P PKPK   KP+   +P    +PK + KP+PK    PK   KP+   KP+ KP P P
Sbjct: 281 EPKPEPKPKPLPKPEPKPEPLPKPEPKPEPKPEPKPEPLPKPEPKPEPKPKPEPKPEPKP 340

Query: 210 EPKPEPPKEPE-------KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE       KP+ KP P P+P+P P+P P
Sbjct: 341 EPKPEPLPKPEPKPKPEPKPEPKPKPEPKPEPEPKPEP 378

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 42/90 (46%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK-PKEKPPPPPEP 215
           EP P P+PK   KP+   +P    +PK + KPKP+   EP+   +PE  PK +P P PEP
Sbjct: 299 EPLPKPEPKPEPKPEPKPEPLPKPEPKPEPKPKPEPKPEPKPEPKPEPLPKPEPKPKPEP 358

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE KP+ +P P P+P+P P+P P
Sbjct: 359 KPEPKPKPEPKPEPEPKPEPKPEPKPEPKP 388

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 39/87 (44%), Positives = 54/87 (62%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P PKP+   +PK   +PK    P+   KP+PK   +P+   +PE PK KP P P+P P
Sbjct: 76  PQPEPKPEPKPEPKPRPEPKTEPHPEPSPKPEPKPEPQPKPITKPE-PKPKPEPMPKPMP 134

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP  +P+KP+ KP P P+P+P P+P P
Sbjct: 135 EPKPKPKKPEPKPKPEPKPEPKPEPEP 161

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 39/88 (44%), Positives = 53/88 (60%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +P+   +P     PK + KP+P+ PK   KP+   KP+  P P PEPK
Sbjct: 79  EPKPEPKPEPKPRPEPKTEPHPEPSPKPEPKPEPQ-PKPITKPEPKPKPEPMPKPMPEPK 137

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+P K   KPK +P P P+P+P P+P P
Sbjct: 138 PKPKKPEPKPKPEPKPEPKPEPEPEPKP 165

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 42/90 (46%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE---KPKEPEKPKEKPPPPPEP 215
           PP P+PK   KP+   +PK   KP+   KP+PK   +PE   KP    +PK +P P PEP
Sbjct: 247 PPKPEPKPEPKPEPKPEPKPEPKPEPLPKPEPKPEPKPEPKPKPLPKPEPKPEPLPKPEP 306

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP+ +P  KP P P+P+P P+P P
Sbjct: 307 KPEPKPEPKPEPLPKPEPKPEPKPKPEPKP 336

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 39/88 (44%), Positives = 54/88 (61%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P PKP+   +PK   KP+   +PK + KP+P  PK   KP+   +PK +P P P+P+
Sbjct: 212 KPEPMPKPEPKPEPKPKPKPEPKPEPKPEPKPEPLPPKPEPKPEPKPEPKPEPKPEPKPE 271

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P P  EP KP+ KP P P+P P P+P P
Sbjct: 272 PLPKPEP-KPEPKPEPKPKPLPKPEPKP 298

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP-EKPKEKPPPPPEPK 218
           P P PKP+   +PK    PK   KP+   KP+PK   +PE   EP  KP+ KP P P+P+
Sbjct: 274 PKPEPKPEPKPEPKPKPLPKPEPKPEPLPKPEPKPEPKPEPKPEPLPKPEPKPEPKPKPE 333

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+P  +PE PK +P P P+P+P P+P P
Sbjct: 334 PKPEPKPE-PKPEPLPKPEPKPKPEPKP 360

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 43/94 (45%), Positives = 56/94 (59%)
 Frame = +3

Query: 30  EILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP 209
           E+ +P P PKP EP+   +P+   EP   K + KP+PK   EP+    PE P  KP P P
Sbjct: 56  ELPQPEPQPKP-EPQPQPQPLPQPEP---KPEPKPEPKPRPEPKTEPHPE-PSPKPEPKP 110

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           EP+P+P  +PE PK KP P P+P P P+P P  P
Sbjct: 111 EPQPKPITKPE-PKPKPEPMPKPMPEPKPKPKKP 143

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 37/91 (40%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KP--KEKPPPPP 209
           EP P P+P    +PK   KP+   +P+ + +P P+   +PE   EP+ KP  K +P P P
Sbjct: 67  EPQPQPQPLPQPEPKPEPKPEPKPRPEPKTEPHPEPSPKPEPKPEPQPKPITKPEPKPKP 126

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP P+P  EP+   +KP P P+P+P P+P P
Sbjct: 127 EPMPKPMPEPKPKPKKPEPKPKPEPKPEPKP 157

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPK---EPE-KPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP 206
           EP P P+PK    PE  PK   KP+   KP  + +PKPK    P+   EP+   +KP P 
Sbjct: 87  EPKPRPEPKTEPHPEPSPKPEPKPEPQPKPITKPEPKPKPEPMPKPMPEPKPKPKKPEPK 146

Query: 207 PEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+P+P+P  +PE +P+ KP P P+P+P P+P P
Sbjct: 147 PKPEPKPEPKPEPEPEPKPEPLPKPEPKPEPKP 179

[22][TOP]
>UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q852P0_VOLCA
          Length = 606

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 42/93 (45%), Positives = 45/93 (48%)
 Frame = +3

Query: 33  ILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           ++EP PPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP 
Sbjct: 200 VVEPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 259

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P P PP  P  P   PPPPP P P P PPP +P
Sbjct: 260 PSPSPPPPPPSP-SPPPPPPPPSPPPAPPPFVP 291

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 33/71 (46%), Positives = 35/71 (49%)
 Frame = +3

Query: 102 EPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQ 281
           EP+ P     P P  P  P  P  P  P   PPPPP P P PP  P  P   PPPPP P 
Sbjct: 202 EPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPS 261

Query: 282 PMPQPPPHIPA 314
           P P PPP  P+
Sbjct: 262 PSPPPPPPSPS 272

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 30/63 (47%), Positives = 32/63 (50%)
 Frame = +3

Query: 129 KPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           +P+P  P  P  P  P  P   PPPPP P P PP  P  P   PPPPP P P   PPP  
Sbjct: 202 EPQPPPPPPPPPPPSPPPP---PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 258

Query: 309 PAS 317
           P S
Sbjct: 259 PPS 261

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 22/46 (47%), Positives = 24/46 (52%)
 Frame = +3

Query: 174 PEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P+    +P PPP P P PP  P  P   PPPP  P P P PPP  P
Sbjct: 196 PQNIVVEPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 241

[23][TOP]
>UniRef100_Q84PC5 Os05g0227600 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q84PC5_ORYSJ
          Length = 416

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 46/93 (49%), Positives = 60/93 (64%), Gaps = 4/93 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+   +PK   KP+   +PK + KPKPK +PK   +PK   +PK KP P PEP
Sbjct: 193 EPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPKPKPEPKPKPEPKPYPEPKPKPEPKPEP 252

Query: 216 KPEPPKEPE---KPKEKPPPPPQPQPMPQPPPH 305
           KPEP  EP+   KP+ KP P P+P+P P+P PH
Sbjct: 253 KPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPH 285

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 47/89 (52%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P PKP+   +PK   KP+   KPK + KPKP+    PE KPK   KP+ KP P PEP
Sbjct: 201 EPKPEPKPEPKPEPKPEPKPEPKPKPKPEPKPKPEPKPYPEPKPKPEPKPEPKPEPKPEP 260

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P P P
Sbjct: 261 KPEPKPEP-KPEPKPEPKPKPEPKPHPKP 288

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 46/89 (51%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P P+PK   +PK   KP+   +PK + KP+PK   +PE KPK   KP  KP P PEP
Sbjct: 235 EPKPYPEPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPHPKPEPKPEP 294

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 295 KPEPKPEP-KPEPKPEPKPEPEPKPEPKP 322

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 47/94 (50%), Positives = 58/94 (61%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP+   KPK   KPK   KP  + KPKP+   EP+   +PE KP+ KP P PEP
Sbjct: 213 EPKPEPKPEPKPKPKPEPKPKPEPKPYPEPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEP 272

Query: 216 KPEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE     KP+ KP P P+P+P P+P P
Sbjct: 273 KPEPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEP 306

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 47/99 (47%), Positives = 58/99 (58%), Gaps = 10/99 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   +PK   KP+   +PK + KPKP+ KP    +PK   KP+ KP P PEP
Sbjct: 247 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEP 306

Query: 216 KPEPPKEPE---------KPKEKPPPPPQPQPMPQPPPH 305
           KPEP  EPE         KP+ KP P P+P P P+P PH
Sbjct: 307 KPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPH 345

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 46/88 (52%), Positives = 56/88 (63%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   +PK   +PK   KP+PK   EPE   EP KP+ KP P PEPK
Sbjct: 145 EPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEPKPEP-KPEPKPHPEPEPK 203

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 204 PEPKPEP-KPEPKPEPKPEPKPKPKPEP 230

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 46/89 (51%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP    +PK   KP+   +PK + KP+PK KPK   KPK   KP  +P P PEP
Sbjct: 189 EPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPKPKPEPKPKPEPKPYPEPKPKPEP 248

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 249 KPEPKPEP-KPEPKPEPKPEPKPEPKPEP 276

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 45/89 (50%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP    KPK   KP+   +PK + KP+PK   +PE   EP+ KP+ KP P PEP
Sbjct: 231 KPKPEPKPYPEPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPHPKPEP 290

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 291 KPEPKPEP-KPEPKPEPKPEPKPEPEPKP 318

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 46/99 (46%), Positives = 60/99 (60%), Gaps = 2/99 (2%)
 Frame = +3

Query: 12  GAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPK 188
           G +   ++ EP P PKPK   KP    +PK   +PK   +P+PK   +PE   EP+ +PK
Sbjct: 46  GRVTYEKLPEPEPKPKPKPHPKPTPKPEPKPEPEPKPVPEPEPKPEPKPEPKPEPKPEPK 105

Query: 189 EKPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
             P P PEPKPEP  EPE KP+ KP P P+P+P P+P P
Sbjct: 106 PYPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKP 144

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 44/91 (48%), Positives = 58/91 (63%), Gaps = 2/91 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK-PKEKPPPPPEP 215
           EP P PKP+   +PK   +PK   KP+ + +P+PK   +PE   EP+  P+ KP P PEP
Sbjct: 91  EPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEP 150

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPPH 305
           KPEP  EP+ KP+ KP P P+P P P+P PH
Sbjct: 151 KPEPKPEPKPKPEPKPHPEPKPDPKPEPKPH 181

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 43/90 (47%), Positives = 59/90 (65%), Gaps = 1/90 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP+   +PK   KP+   +PK + KP+PK   EP+   +PE KP+ KP P PEP
Sbjct: 243 KPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPHPKPEPKPEPKPEPKPEP 302

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPH 305
           KPEP  EP KP+ +P P P+P+P P+P P+
Sbjct: 303 KPEPKPEP-KPEPEPKPEPKPEPKPEPKPY 331

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 45/90 (50%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+PK   +PK   KP+   +PK + KP+PK   +PE   EPE KP+ KP P PEP
Sbjct: 269 KPEPKPEPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEP 328

Query: 216 KPEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           KP P PK   KP+ KP P P+P+P PQP P
Sbjct: 329 KPYPEPKPDPKPEPKPHPEPKPEPKPQPEP 358

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 48/95 (50%), Positives = 61/95 (64%), Gaps = 6/95 (6%)
 Frame = +3

Query: 39  EPPPPPKPK---EPE-KPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPP 203
           EP P P+PK   EPE KP+   +PK   KP+ +  P+PK   +PE   EPE KP+ KP P
Sbjct: 73  EPKPEPEPKPVPEPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPEPKPEPKPEP 132

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPH 305
            PEPKP P  +PE KP+ KP P P+P+P P+P PH
Sbjct: 133 KPEPKPYPEPKPEPKPEPKPEPKPEPKPKPEPKPH 167

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 46/91 (50%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P PKPK   KP    KP    +PK   +P+PK   +PE    PE   KP+ KP P P
Sbjct: 153 EPKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEPKPEPKPEPKPHPEPEPKPEPKPEPKP 212

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP KPK KP P P+P+P P P P
Sbjct: 213 EPKPEPKPEP-KPKPKPEPKPKPEPKPYPEP 242

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 45/94 (47%), Positives = 57/94 (60%), Gaps = 3/94 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPPP 209
           EP P P+PK   KP+   +PK   +PK   KP+PK   +PK   KP+   KP+ KP P P
Sbjct: 309 EPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPEPKPQPEPKPEPKPEPKP 368

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           EPKPEP  EP KP  +P P P+P+P P+P P  P
Sbjct: 369 EPKPEPKPEP-KPYPEPKPEPKPKPKPEPKPEAP 401

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 44/90 (48%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P P+PK   KP    +PK   KP+ + +PKP+   EP+ KPK   KPK +P P PEP
Sbjct: 183 EPEPKPEPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPKPKPEPKPKPEPKPYPEP 242

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KP+P  +PE KP+ KP P P+P+P P+P P
Sbjct: 243 KPKPEPKPEPKPEPKPEPKPEPKPEPKPEP 272

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 44/88 (50%), Positives = 56/88 (63%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KP+   +PK   +PK + KP+PK   EP+   +PE PK +P P PEPK
Sbjct: 85  EPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPEPKPEPKPE-PKPEPKPYPEPK 143

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P P P
Sbjct: 144 PEPKPEP-KPEPKPEPKPKPEPKPHPEP 170

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 45/98 (45%), Positives = 57/98 (58%), Gaps = 10/98 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---------KPKE 191
           +P P PKPK   KPK   KP    KPK + KP+PK   +PE   EP+         +PK 
Sbjct: 219 KPEPKPKPKPEPKPKPEPKPYPEPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKP 278

Query: 192 KPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KP P P PKPEP  EP+ +PK +P P P+P+P P+P P
Sbjct: 279 KPEPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEP 316

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 44/90 (48%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+PK   KPK   KP    +PK + KP+PK   +PE   EP+ +P+ KP P PEP
Sbjct: 265 KPEPKPEPKPEPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEP 324

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP   PE KP  KP P P P+P P+P P
Sbjct: 325 KPEPKPYPEPKPDPKPEPKPHPEPKPEPKP 354

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 46/97 (47%), Positives = 56/97 (57%), Gaps = 6/97 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   +PK   +PK   KP+ +  P+PK +PK   +PK   KP+ KP P PEP
Sbjct: 315 EPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPEPKPQPEPKPEPKPEPKPEPKPEP 374

Query: 216 KPEP-----PKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           KPEP     PK   KPK KP P P+  P    PPHIP
Sbjct: 375 KPEPKPYPEPKPEPKPKPKPEPKPEAPPKKHKPPHIP 411

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 49/89 (55%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KP EP    EPE PK + KP+PK   EPE   EP KP+ KP P PEPK
Sbjct: 163 EPKPHPEPKPDPKP-EPKPHPEPE-PKPEPKPEPKPHPEPEPKPEP-KPEPKPEPKPEPK 219

Query: 219 PEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP PK   +PK KP P P P+P P+P P
Sbjct: 220 PEPKPKPKPEPKPKPEPKPYPEPKPKPEP 248

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 43/90 (47%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   KP+ + +PKP+   EPE   EP+ +PK +P P PEP
Sbjct: 275 EPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEP 334

Query: 216 KPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
           KP+P  EP+  P+ KP P PQP+P P+P P
Sbjct: 335 KPDPKPEPKPHPEPKPEPKPQPEPKPEPKP 364

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 43/91 (47%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   KP+   +PK   KP  + KP+PK   +PE   EP KPK +P P PEPK
Sbjct: 113 EPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEP-KPKPEPKPHPEPK 171

Query: 219 PEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           P+P  EP+   +P+ KP P P+P+P P+P P
Sbjct: 172 PDPKPEPKPHPEPEPKPEPKPEPKPHPEPEP 202

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 43/90 (47%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   +PK + KP+PK   +PE KPK   KP  +P P P+P
Sbjct: 117 EPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKP 176

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+P  EPE KP+ KP P P P+P P+P P
Sbjct: 177 EPKPHPEPEPKPEPKPEPKPHPEPEPKPEP 206

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 44/92 (47%), Positives = 56/92 (60%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP    KP+   +PK   KP+ + KP+PK   EP+   +PE KP  +P P PEP
Sbjct: 131 EPKPEPKPYPEPKPEPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEPKPEP 190

Query: 216 KPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           KPEP   PE   KP+ KP P P+P+P P+P P
Sbjct: 191 KPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEP 222

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 43/92 (46%), Positives = 57/92 (61%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P PKP+   +PK   KPK   KP  + +PKP+   EP+   +PE   +PK +P P P
Sbjct: 259 EPKPEPKPEPKPEPKPEPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKP 318

Query: 210 EPKPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP+  P+ KP P P+P+P P+P P
Sbjct: 319 EPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKP 350

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 43/91 (47%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+PK   +PK   KP+   +PK + KPKP+    PE PK   KP+ KP P PEPK
Sbjct: 129 KPEPKPEPKPYPEPKPEPKPEPKPEPKPEPKPKPEPKPHPE-PKPDPKPEPKPHPEPEPK 187

Query: 219 PEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+   +P+ KP P P+P+P P+P P
Sbjct: 188 PEPKPEPKPHPEPEPKPEPKPEPKPEPKPEP 218

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 43/92 (46%), Positives = 57/92 (61%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK---PKEKPPPPP 209
           +P P P+PK   KP+   +PK   KP+ + KP+PK   +PE    PE    PK +P P P
Sbjct: 287 KPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHP 346

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 347 EPKPEPKPQPEPKPEPKPEPKPEPKPEPKPEP 378

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 43/91 (47%), Positives = 56/91 (61%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKP---KKPKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP+   +PK   +PK   KP+ + +PKP    KP    +PK   +PK +P P P
Sbjct: 297 EPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPEPKPQP 356

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 357 EPKPEPKPEP-KPEPKPEPKPEPKPYPEPKP 386

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 43/90 (47%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP+    P+   +PK   KP+ + KP+PK   +PE    PE KP+ KP P PEP
Sbjct: 95  EPKPEPKPEPKPYPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEP 154

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE KP  +P P P+P+P P P P
Sbjct: 155 KPEPKPKPEPKPHPEPKPDPKPEPKPHPEP 184

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 43/88 (48%), Positives = 53/88 (60%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KPK   KP  + KP PK   +P    EP KP+ KP P P P+
Sbjct: 141 EPKPEPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEP-KPEPKPEPKPHPE 199

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 200 PEPKPEP-KPEPKPEPKPEPKPEPKPKP 226

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 42/90 (46%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP    +PK   KP+    P+ + KP+PK   +PE   EP+ +PK KP P P+P
Sbjct: 173 DPKPEPKPHPEPEPKPEPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPKPKPEPKP 232

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP   PE KPK +P P P+P+P P+P P
Sbjct: 233 KPEPKPYPEPKPKPEPKPEPKPEPKPEPKP 262

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 43/88 (48%), Positives = 53/88 (60%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   KP+   +PK   KP  + KP PK   +P    +PE PK +P P PEPK
Sbjct: 305 EPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPE-PKPQPEPKPEPK 363

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P P+P P+P P
Sbjct: 364 PEPKPEP-KPEPKPEPKPYPEPKPEPKP 390

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 44/96 (45%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP    KP+   +PK   +PK + KP+PK +PK   +PK   KP+ KP P PEP
Sbjct: 99  EPKPEPKPYPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEP 158

Query: 216 KPEP-------PKEPEKPKEKPPPPPQPQPMPQPPP 302
           KP+P       PK   KP+ KP P P+P+P P+P P
Sbjct: 159 KPKPEPKPHPEPKPDPKPEPKPHPEPEPKPEPKPEP 194

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 43/89 (48%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   +PK   +PK   KP+ + +PKP+ KPK   KP    KP  KP P P P
Sbjct: 123 EPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKPEPKPHP 182

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           +PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 183 EPEPKPEP-KPEPKPHPEPEPKPEPKPEP 210

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 42/90 (46%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   KPK + KP P+ KP    +PK   +P+ KP P PEP
Sbjct: 135 EPKPYPEPKPEPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEPKPEPKPEP 194

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KP P  EP+ +PK +P P P+P+P P+P P
Sbjct: 195 KPHPEPEPKPEPKPEPKPEPKPEPKPEPKP 224

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +PK   KP    +PK + KP+PK   +PE   EP KPK KP P P+P+
Sbjct: 177 EPKPHPEPEPKPEPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEP-KPKPKPEPKPKPE 235

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+P  EP+ KP+ KP P P+P+P P+P P
Sbjct: 236 PKPYPEPKPKPEPKPEPKPEPKPEPKPEP 264

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 41/92 (44%), Positives = 57/92 (61%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK---PKEKPPPPP 209
           EP P PKP+   +PK   KP+   +PK + KP+P+   EP+   +PE    P+ KP P P
Sbjct: 281 EPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKP 340

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKP P  +PE KP+ +P P P+P+P P+P P
Sbjct: 341 EPKPHPEPKPEPKPQPEPKPEPKPEPKPEPKP 372

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 42/90 (46%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P PKP+   +PK   KP+   KP+ + +PKP+    PE KP    +PK  P P PEP
Sbjct: 293 EPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPEP 352

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KP+P  +PE KP+ KP P P+P+P P+P P
Sbjct: 353 KPQPEPKPEPKPEPKPEPKPEPKPEPKPYP 382

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+    P+   KP+   +PK   +P+PK   +PE   EP KP+ KP P P+PK
Sbjct: 169 EPKPDPKPEPKPHPEPEPKPEPKPEPKPHPEPEPKPEPKPEPKPEP-KPEPKPEPKPKPK 227

Query: 219 PEPPKEPEK---PKEKPPPPPQPQPMPQPPP 302
           PEP  +PE    P+ KP P P+P+P P+P P
Sbjct: 228 PEPKPKPEPKPYPEPKPKPEPKPEPKPEPKP 258

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+    P+   +PK   +PK + KP+PK   +PE   EP KP  +P P P+PK
Sbjct: 333 EPKPDPKPEPKPHPEPKPEPKPQPEPKPEPKPEPKPEPKPEPKPEP-KPYPEPKPEPKPK 391

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQ 293
           P+P  +PE P +K  PP  P    Q
Sbjct: 392 PKPEPKPEAPPKKHKPPHIPPATDQ 416

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 28/57 (49%), Positives = 37/57 (64%)
 Frame = +3

Query: 135 KPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPH 305
           K  +P+   KPK   KP  KP P PEP+P+P  EPE PK +P P P+P+P P+P P+
Sbjct: 52  KLPEPEPKPKPKPHPKPTPKPEPKPEPEPKPVPEPE-PKPEPKPEPKPEPKPEPKPY 107

[24][TOP]
>UniRef100_B9IH21 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IH21_POPTR
          Length = 206

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 54/104 (51%), Positives = 61/104 (58%)
 Frame = +3

Query: 9   CGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK 188
           C   K+++ +E   P KPK PEKPKEP KPK+PEK           PKEPEKPKEPEKPK
Sbjct: 63  CKGGKAVKCIEIKVPEKPKPPEKPKEPEKPKQPEK-----------PKEPEKPKEPEKPK 111

Query: 189 EKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPASC 320
           E   PPP PKP P         KP PPP   P+P PPP  P +C
Sbjct: 112 E---PPPAPKPAP---------KPAPPP---PVPCPPPVYPRTC 140

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 47/82 (57%), Positives = 54/82 (65%), Gaps = 1/82 (1%)
 Frame = +3

Query: 69  PEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK-PEPPKEPEK 245
           PEK K  +  K  +  K  E   P+KPK PEKPKEPEKPK+    P +PK PE PKEPEK
Sbjct: 54  PEKIKNKICCKGGKAVKCIEIKVPEKPKPPEKPKEPEKPKQ----PEKPKEPEKPKEPEK 109

Query: 246 PKEKPPPPPQPQPMPQPPPHIP 311
           PKE PPP P+P P P PPP +P
Sbjct: 110 PKE-PPPAPKPAPKPAPPPPVP 130

[25][TOP]
>UniRef100_A9PEW6 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
           RepID=A9PEW6_POPTR
          Length = 206

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 54/104 (51%), Positives = 61/104 (58%)
 Frame = +3

Query: 9   CGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK 188
           C   K+++ +E   P KPK PEKPKEP KPK+PEK           PKEPEKPKEPEKPK
Sbjct: 63  CKGGKAVKCIEIKVPEKPKPPEKPKEPEKPKQPEK-----------PKEPEKPKEPEKPK 111

Query: 189 EKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPASC 320
           E   PPP PKP P         KP PPP   P+P PPP  P +C
Sbjct: 112 E---PPPAPKPAP---------KPAPPP---PVPCPPPVYPRTC 140

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 47/82 (57%), Positives = 54/82 (65%), Gaps = 1/82 (1%)
 Frame = +3

Query: 69  PEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK-PEPPKEPEK 245
           PEK K  +  K  +  K  E   P+KPK PEKPKEPEKPK+    P +PK PE PKEPEK
Sbjct: 54  PEKIKNKICCKGGKAVKCIEIKVPEKPKPPEKPKEPEKPKQ----PEKPKEPEKPKEPEK 109

Query: 246 PKEKPPPPPQPQPMPQPPPHIP 311
           PKE PPP P+P P P PPP +P
Sbjct: 110 PKE-PPPAPKPAPKPAPPPPVP 130

[26][TOP]
>UniRef100_A7KH49 Proline-rich protein n=1 Tax=Oryza sativa Japonica Group
           RepID=A7KH49_ORYSJ
          Length = 416

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 46/93 (49%), Positives = 60/93 (64%), Gaps = 4/93 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+   +PK   KP+   +PK + KPKPK +PK   +PK   +PK KP P PEP
Sbjct: 193 EPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPKPKPEPKPKPEPKPYPEPKPKPEPKPEP 252

Query: 216 KPEPPKEPE---KPKEKPPPPPQPQPMPQPPPH 305
           KPEP  EP+   KP+ KP P P+P+P P+P PH
Sbjct: 253 KPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPH 285

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 47/89 (52%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P PKP+   +PK   KP+   KPK + KPKP+    PE KPK   KP+ KP P PEP
Sbjct: 201 EPKPEPKPEPKPEPKPEPKPEPKPKPKPEPKPKPEPKPYPEPKPKPEPKPEPKPEPKPEP 260

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P P P
Sbjct: 261 KPEPKPEP-KPEPKPEPKPKPEPKPHPKP 288

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 47/88 (53%), Positives = 56/88 (63%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKPK   +PK   +PK   +PK   KP+PK   EPE   EP KP+ KP P PEPK
Sbjct: 145 EPKPEPKPKPKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEPKPEP-KPEPKPHPEPEPK 203

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 204 PEPKPEP-KPEPKPEPKPEPKPKPKPEP 230

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 46/89 (51%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P P+PK   +PK   KP+   +PK + KP+PK   +PE KPK   KP  KP P PEP
Sbjct: 235 EPKPYPEPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPHPKPEPKPEP 294

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 295 KPEPKPEP-KPEPKPEPKPEPEPKPEPKP 322

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 47/94 (50%), Positives = 58/94 (61%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP+   KPK   KPK   KP  + KPKP+   EP+   +PE KP+ KP P PEP
Sbjct: 213 EPKPEPKPEPKPKPKPEPKPKPEPKPYPEPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEP 272

Query: 216 KPEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE     KP+ KP P P+P+P P+P P
Sbjct: 273 KPEPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEP 306

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 47/99 (47%), Positives = 58/99 (58%), Gaps = 10/99 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   +PK   KP+   +PK + KPKP+ KP    +PK   KP+ KP P PEP
Sbjct: 247 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEP 306

Query: 216 KPEPPKEPE---------KPKEKPPPPPQPQPMPQPPPH 305
           KPEP  EPE         KP+ KP P P+P P P+P PH
Sbjct: 307 KPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPH 345

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 46/89 (51%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP    +PK   KP+   +PK + KP+PK KPK   KPK   KP  +P P PEP
Sbjct: 189 EPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPKPKPEPKPKPEPKPYPEPKPKPEP 248

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 249 KPEPKPEP-KPEPKPEPKPEPKPEPKPEP 276

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 45/89 (50%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP    KPK   KP+   +PK + KP+PK   +PE   EP+ KP+ KP P PEP
Sbjct: 231 KPKPEPKPYPEPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPHPKPEP 290

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 291 KPEPKPEP-KPEPKPEPKPEPKPEPEPKP 318

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 46/99 (46%), Positives = 60/99 (60%), Gaps = 2/99 (2%)
 Frame = +3

Query: 12  GAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPK 188
           G +   ++ EP P PKPK   KP    +PK   +PK   +P+PK   +PE   EP+ +PK
Sbjct: 46  GRVTYEKLPEPEPKPKPKPHPKPTPKPEPKPEPEPKPVPEPEPKPEPKPEPKPEPKPEPK 105

Query: 189 EKPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
             P P PEPKPEP  EPE KP+ KP P P+P+P P+P P
Sbjct: 106 PYPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKP 144

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 45/88 (51%), Positives = 56/88 (63%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KP+   +PK   +PK + KP+PK   EP+   +PE PK +P P PEPK
Sbjct: 85  EPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPEPKPEPKPE-PKPEPKPYPEPK 143

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KPK KP P P+P+P P P P
Sbjct: 144 PEPKPEP-KPKPKPEPKPKPEPKPHPEP 170

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 43/90 (47%), Positives = 59/90 (65%), Gaps = 1/90 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP+   +PK   KP+   +PK + KP+PK   EP+   +PE KP+ KP P PEP
Sbjct: 243 KPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPHPKPEPKPEPKPEPKPEP 302

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPH 305
           KPEP  EP KP+ +P P P+P+P P+P P+
Sbjct: 303 KPEPKPEP-KPEPEPKPEPKPEPKPEPKPY 331

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 45/90 (50%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+PK   +PK   KP+   +PK + KP+PK   +PE   EPE KP+ KP P PEP
Sbjct: 269 KPEPKPEPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEP 328

Query: 216 KPEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           KP P PK   KP+ KP P P+P+P PQP P
Sbjct: 329 KPYPEPKPDPKPEPKPHPEPKPEPKPQPEP 358

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 48/95 (50%), Positives = 61/95 (64%), Gaps = 6/95 (6%)
 Frame = +3

Query: 39  EPPPPPKPK---EPE-KPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPP 203
           EP P P+PK   EPE KP+   +PK   KP+ +  P+PK   +PE   EPE KP+ KP P
Sbjct: 73  EPKPEPEPKPVPEPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPEPKPEPKPEP 132

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPH 305
            PEPKP P  +PE KP+ KP P P+P+P P+P PH
Sbjct: 133 KPEPKPYPEPKPEPKPEPKPKPKPEPKPKPEPKPH 167

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 45/94 (47%), Positives = 57/94 (60%), Gaps = 3/94 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPPP 209
           EP P P+PK   KP+   +PK   +PK   KP+PK   +PK   KP+   KP+ KP P P
Sbjct: 309 EPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPEPKPQPEPKPEPKPEPKP 368

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           EPKPEP  EP KP  +P P P+P+P P+P P  P
Sbjct: 369 EPKPEPKPEP-KPYPEPKPEPKPKPKPEPKPEAP 401

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 44/90 (48%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P P+PK   KP    +PK   KP+ + +PKP+   EP+ KPK   KPK +P P PEP
Sbjct: 183 EPEPKPEPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPKPKPEPKPKPEPKPYPEP 242

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KP+P  +PE KP+ KP P P+P+P P+P P
Sbjct: 243 KPKPEPKPEPKPEPKPEPKPEPKPEPKPEP 272

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 43/91 (47%), Positives = 58/91 (63%), Gaps = 2/91 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK-PKEKPPPPPEP 215
           EP P PKP+   +PK   +PK   KP+ + +P+PK   +PE   EP+  P+ KP P PEP
Sbjct: 91  EPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEP 150

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPPH 305
           KP+P  EP+ KP+ KP P P+P P P+P PH
Sbjct: 151 KPKPKPEPKPKPEPKPHPEPKPDPKPEPKPH 181

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 44/90 (48%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   +PK + KP+PK KPK   KPK   KP  +P P P+P
Sbjct: 117 EPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPKPKPEPKPKPEPKPHPEPKPDPKP 176

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+P  EPE KP+ KP P P P+P P+P P
Sbjct: 177 EPKPHPEPEPKPEPKPEPKPHPEPEPKPEP 206

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 45/98 (45%), Positives = 57/98 (58%), Gaps = 10/98 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---------KPKE 191
           +P P PKPK   KPK   KP    KPK + KP+PK   +PE   EP+         +PK 
Sbjct: 219 KPEPKPKPKPEPKPKPEPKPYPEPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKP 278

Query: 192 KPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KP P P PKPEP  EP+ +PK +P P P+P+P P+P P
Sbjct: 279 KPEPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEP 316

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 44/90 (48%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+PK   KPK   KP    +PK + KP+PK   +PE   EP+ +P+ KP P PEP
Sbjct: 265 KPEPKPEPKPEPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEP 324

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP   PE KP  KP P P P+P P+P P
Sbjct: 325 KPEPKPYPEPKPDPKPEPKPHPEPKPEPKP 354

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 46/97 (47%), Positives = 56/97 (57%), Gaps = 6/97 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   +PK   +PK   KP+ +  P+PK +PK   +PK   KP+ KP P PEP
Sbjct: 315 EPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPEPKPQPEPKPEPKPEPKPEPKPEP 374

Query: 216 KPEP-----PKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           KPEP     PK   KPK KP P P+  P    PPHIP
Sbjct: 375 KPEPKPYPEPKPEPKPKPKPEPKPEAPPKKHKPPHIP 411

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 45/95 (47%), Positives = 57/95 (60%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+PK   +PK   KP+   KPK + KPKP+    PE PK   KP+ KP P PEPK
Sbjct: 129 KPEPKPEPKPYPEPKPEPKPEPKPKPKPEPKPKPEPKPHPE-PKPDPKPEPKPHPEPEPK 187

Query: 219 PEPPKEPE-------KPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+       KP+ KP P P+P+P P+P P
Sbjct: 188 PEPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEP 222

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 49/89 (55%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KP EP    EPE PK + KP+PK   EPE   EP KP+ KP P PEPK
Sbjct: 163 EPKPHPEPKPDPKP-EPKPHPEPE-PKPEPKPEPKPHPEPEPKPEP-KPEPKPEPKPEPK 219

Query: 219 PEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP PK   +PK KP P P P+P P+P P
Sbjct: 220 PEPKPKPKPEPKPKPEPKPYPEPKPKPEP 248

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 43/90 (47%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   KP+ + +PKP+   EPE   EP+ +PK +P P PEP
Sbjct: 275 EPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEP 334

Query: 216 KPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
           KP+P  EP+  P+ KP P PQP+P P+P P
Sbjct: 335 KPDPKPEPKPHPEPKPEPKPQPEPKPEPKP 364

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 44/88 (50%), Positives = 53/88 (60%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   KPK   KPK   KP  + KP PK   +P    EP KP+ KP P P P+
Sbjct: 141 EPKPEPKPEPKPKPKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEP-KPEPKPEPKPHPE 199

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 200 PEPKPEP-KPEPKPEPKPEPKPEPKPKP 226

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 43/91 (47%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   KP+   +PK   KP  + KP+PK   +P KPK   KPK +P P PEPK
Sbjct: 113 EPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKP-KPKPEPKPKPEPKPHPEPK 171

Query: 219 PEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           P+P  EP+   +P+ KP P P+P+P P+P P
Sbjct: 172 PDPKPEPKPHPEPEPKPEPKPEPKPHPEPEP 202

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 6/95 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPPP 209
           EP P P+PK   KP+   +P+   +PK + KP+PK   +PK   KP+   KPK +P P P
Sbjct: 103 EPKPYPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPKPKPEPKPKP 162

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPPH 305
           EPKP P  +P+   +PK  P P P+P+P P+P PH
Sbjct: 163 EPKPHPEPKPDPKPEPKPHPEPEPKPEPKPEPKPH 197

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 44/89 (49%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   +PK   +PK   KP+ + KPKP+ KPK   KP    KP  KP P P P
Sbjct: 123 EPKPEPKPEPKPEPKPYPEPKPEPKPEPKPKPKPEPKPKPEPKPHPEPKPDPKPEPKPHP 182

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           +PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 183 EPEPKPEP-KPEPKPHPEPEPKPEPKPEP 210

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 43/90 (47%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+PK   KP+   KPK   KPK + KP P+ KP    +PK   +P+ KP P PEP
Sbjct: 135 EPKPYPEPKPEPKPEPKPKPKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEPKPEPKPEP 194

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KP P  EP+ +PK +P P P+P+P P+P P
Sbjct: 195 KPHPEPEPKPEPKPEPKPEPKPEPKPEPKP 224

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 43/92 (46%), Positives = 57/92 (61%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P PKP+   +PK   KPK   KP  + +PKP+   EP+   +PE   +PK +P P P
Sbjct: 259 EPKPEPKPEPKPEPKPEPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKP 318

Query: 210 EPKPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP+  P+ KP P P+P+P P+P P
Sbjct: 319 EPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKP 350

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 43/92 (46%), Positives = 57/92 (61%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK---PKEKPPPPP 209
           +P P P+PK   KP+   +PK   KP+ + KP+PK   +PE    PE    PK +P P P
Sbjct: 287 KPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHP 346

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 347 EPKPEPKPQPEPKPEPKPEPKPEPKPEPKPEP 378

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 43/91 (47%), Positives = 56/91 (61%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKP---KKPKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP+   +PK   +PK   KP+ + +PKP    KP    +PK   +PK +P P P
Sbjct: 297 EPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPEPKPQP 356

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 357 EPKPEPKPEP-KPEPKPEPKPEPKPYPEPKP 386

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 42/90 (46%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP    +PK   KP+    P+ + KP+PK   +PE   EP+ +PK KP P P+P
Sbjct: 173 DPKPEPKPHPEPEPKPEPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPKPKPEPKP 232

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP   PE KPK +P P P+P+P P+P P
Sbjct: 233 KPEPKPYPEPKPKPEPKPEPKPEPKPEPKP 262

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 43/88 (48%), Positives = 53/88 (60%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   KP+   +PK   KP  + KP PK   +P    +PE PK +P P PEPK
Sbjct: 305 EPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPE-PKPQPEPKPEPK 363

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P P+P P+P P
Sbjct: 364 PEPKPEP-KPEPKPEPKPYPEPKPEPKP 390

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 42/89 (47%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP    KP+   +PK   +PK + KP+PK +PK   +PK   KP+ KP P PEP
Sbjct: 99  EPKPEPKPYPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPKPKPEP 158

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KP+P  +P  P+ KP P P+P+P P+P P
Sbjct: 159 KPKPEPKPH-PEPKPDPKPEPKPHPEPEP 186

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +PK   KP    +PK + KP+PK   +PE   EP KPK KP P P+P+
Sbjct: 177 EPKPHPEPEPKPEPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEP-KPKPKPEPKPKPE 235

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+P  EP+ KP+ KP P P+P+P P+P P
Sbjct: 236 PKPYPEPKPKPEPKPEPKPEPKPEPKPEP 264

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 42/90 (46%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP+    P+   +PK   KP+ + KP+PK   +PE    PE KP+ KP P P+P
Sbjct: 95  EPKPEPKPEPKPYPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPKP 154

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE KP  +P P P+P+P P P P
Sbjct: 155 KPEPKPKPEPKPHPEPKPDPKPEPKPHPEP 184

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 41/92 (44%), Positives = 57/92 (61%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK---PKEKPPPPP 209
           EP P PKP+   +PK   KP+   +PK + KP+P+   EP+   +PE    P+ KP P P
Sbjct: 281 EPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKP 340

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKP P  +PE KP+ +P P P+P+P P+P P
Sbjct: 341 EPKPHPEPKPEPKPQPEPKPEPKPEPKPEPKP 372

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 42/90 (46%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P PKP+   +PK   KP+   KP+ + +PKP+    PE KP    +PK  P P PEP
Sbjct: 293 EPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPEP 352

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KP+P  +PE KP+ KP P P+P+P P+P P
Sbjct: 353 KPQPEPKPEPKPEPKPEPKPEPKPEPKPYP 382

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+    P+   KP+   +PK   +P+PK   +PE   EP KP+ KP P P+PK
Sbjct: 169 EPKPDPKPEPKPHPEPEPKPEPKPEPKPHPEPEPKPEPKPEPKPEP-KPEPKPEPKPKPK 227

Query: 219 PEPPKEPEK---PKEKPPPPPQPQPMPQPPP 302
           PEP  +PE    P+ KP P P+P+P P+P P
Sbjct: 228 PEPKPKPEPKPYPEPKPKPEPKPEPKPEPKP 258

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+    P+   +PK   +PK + KP+PK   +PE   EP KP  +P P P+PK
Sbjct: 333 EPKPDPKPEPKPHPEPKPEPKPQPEPKPEPKPEPKPEPKPEPKPEP-KPYPEPKPEPKPK 391

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQ 293
           P+P  +PE P +K  PP  P    Q
Sbjct: 392 PKPEPKPEAPPKKHKPPHIPPATDQ 416

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 28/57 (49%), Positives = 37/57 (64%)
 Frame = +3

Query: 135 KPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPH 305
           K  +P+   KPK   KP  KP P PEP+P+P  EPE PK +P P P+P+P P+P P+
Sbjct: 52  KLPEPEPKPKPKPHPKPTPKPEPKPEPEPKPVPEPE-PKPEPKPEPKPEPKPEPKPY 107

[27][TOP]
>UniRef100_UPI000007DD57 hypothetical protein Y22D7AR.1 n=1 Tax=Caenorhabditis elegans
           RepID=UPI000007DD57
          Length = 350

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 50/98 (51%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = +3

Query: 12  GAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKE 191
           G +K+   L+  P PKP+   KPK   KPK    PK + KPKPK PK    PK   KPK 
Sbjct: 149 GVLKNEPKLKSKPNPKPEPKPKPKPEPKPKPKPDPKPKPKPKPK-PKPKPNPKPEPKPKP 207

Query: 192 KPPPPPEPKPEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           KP P P+PKPEP PK   KPK KP P P P+P P+P P
Sbjct: 208 KPEPKPKPKPEPKPKPKPKPKPKPKPNPNPKPEPKPKP 245

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 46/89 (51%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           +P P P+PK   KP+   KPK   KPK + KPKPK KP    +PK   KP+ KP P PEP
Sbjct: 160 KPNPKPEPKPKPKPEPKPKPKPDPKPKPKPKPKPKPKPNPKPEPKPKPKPEPKPKPKPEP 219

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KP+P  +P KPK KP P P+P+P P+P P
Sbjct: 220 KPKPKPKP-KPKPKPNPNPKPEPKPKPKP 247

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 46/89 (51%), Positives = 54/89 (60%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   KPK   KPK   KPK + KP PK   +P KPK   KPK KP P P+PK
Sbjct: 166 EPKPKPKPEPKPKPKPDPKPKPKPKPKPKPKPNPKPEPKP-KPKPEPKPKPKPEPKPKPK 224

Query: 219 PEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+P PK    P  KP P P+P+P P+P P
Sbjct: 225 PKPKPKPKPNPNPKPEPKPKPKPKPKPEP 253

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 52/104 (50%), Positives = 60/104 (57%), Gaps = 11/104 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           +P P PKP+   KPK   KPK   +PK + KPKPK KPK    PK   KPK KP P PEP
Sbjct: 194 KPKPNPKPEPKPKPKPEPKPKPKPEPKPKPKPKPKPKPKPNPNPKPEPKPKPKPKPKPEP 253

Query: 216 KP------EPPKEPE-KPKEKPPPPPQPQPMPQ---PPPHIPAS 317
           KP      EP  +P+ KPK KP P P+P PMP+    P H P S
Sbjct: 254 KPKTKLKSEPKPKPKLKPKPKPNPKPEPNPMPELKPKPKHKPNS 297

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 48/106 (45%), Positives = 56/106 (52%), Gaps = 16/106 (15%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-----KPKEPEKPKEPEKPKEKPPP 203
           +P P PKPK   KPK   KP+   KPK + KPKPK     KPK   KPK    P  KP P
Sbjct: 182 DPKPKPKPKPKPKPKPNPKPEPKPKPKPEPKPKPKPEPKPKPKPKPKPKPKPNPNPKPEP 241

Query: 204 PPEPKPEPPKEPE-----------KPKEKPPPPPQPQPMPQPPPHI 308
            P+PKP+P  EP+           KPK KP P P P+P P P P +
Sbjct: 242 KPKPKPKPKPEPKPKTKLKSEPKPKPKLKPKPKPNPKPEPNPMPEL 287

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 45/86 (52%), Positives = 54/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           +P P PKPK   KPK   KPK   KP  + +PKPK   EP+ KPK   KPK KP P P+P
Sbjct: 172 KPEPKPKPKPDPKPKPKPKPKPKPKPNPKPEPKPKPKPEPKPKPKPEPKPKPKPKPKPKP 231

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQ 293
           KP P  +PE PK KP P P+P+P P+
Sbjct: 232 KPNPNPKPE-PKPKPKPKPKPEPKPK 256

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 51/98 (52%), Positives = 57/98 (58%), Gaps = 10/98 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPK-----EPE-KPKEKP 197
           +P P P+PK   KPK   KPK    PK + KPKPK KPK   KPK     EP+ KPK KP
Sbjct: 212 KPKPKPEPKPKPKPKPKPKPKPNPNPKPEPKPKPKPKPKPEPKPKTKLKSEPKPKPKLKP 271

Query: 198 PPPPEPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
            P P PKPEP   PE   KPK KP   P+P P P+P P
Sbjct: 272 KPKPNPKPEPNPMPELKPKPKHKPNSRPKPNPRPKPKP 309

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 47/93 (50%), Positives = 52/93 (55%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-----KPKEPEKPKEPEKPKEKPPP 203
           EP P PKP    KPK   KPK    PK + KPKPK     KPK   KPK   KPK KP P
Sbjct: 174 EPKPKPKPDPKPKPKPKPKPKPKPNPKPEPKPKPKPEPKPKPKPEPKPKPKPKPKPKPKP 233

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P PKPEP  +P KPK KP P P+ +   +P P
Sbjct: 234 NPNPKPEPKPKP-KPKPKPEPKPKTKLKSEPKP 265

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 47/108 (43%), Positives = 54/108 (50%), Gaps = 18/108 (16%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKPK   KPK    PK   KPK + KPKP+ KPK   K +   KPK KP P P P
Sbjct: 218 EPKPKPKPKPKPKPKPNPNPKPEPKPKPKPKPKPEPKPKTKLKSEPKPKPKLKPKPKPNP 277

Query: 216 KPEP-----------------PKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           KPEP                 PK   +PK KP   P P+P P+P P +
Sbjct: 278 KPEPNPMPELKPKPKHKPNSRPKPNPRPKPKPRSKPNPKPKPRPKPEL 325

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 1/90 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKPK   +PK   K K   KPK + KPKPK   +PE    PE KPK K  P   P
Sbjct: 240 EPKPKPKPKPKPEPKPKTKLKSEPKPKPKLKPKPKPNPKPEPNPMPELKPKPKHKPNSRP 299

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPH 305
           KP P  +P KP+ KP P P+P+P P+  P+
Sbjct: 300 KPNPRPKP-KPRSKPNPKPKPRPKPELKPN 328

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 25/47 (53%), Positives = 31/47 (65%), Gaps = 1/47 (2%)
 Frame = +3

Query: 168 KEPEKPKEKPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPH 305
           K   K K KP P PEPKP+P  EP+ KPK  P P P+P+P P+P P+
Sbjct: 152 KNEPKLKSKPNPKPEPKPKPKPEPKPKPKPDPKPKPKPKPKPKPKPN 198

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 29/63 (46%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPE 212
           L+P P P PK    P   +KPK   KP  + KP P+ KPK   KP     PK KP P PE
Sbjct: 269 LKPKPKPNPKPEPNPMPELKPKPKHKPNSRPKPNPRPKPKPRSKP----NPKPKPRPKPE 324

Query: 213 PKP 221
            KP
Sbjct: 325 LKP 327

[28][TOP]
>UniRef100_C0MDN2 SzPSe-like cell surface-anchored protein n=1 Tax=Steptococcus equi
           subsp. zooepidemicus H70 RepID=C0MDN2_STRS7
          Length = 439

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 46/90 (51%), Positives = 59/90 (65%), Gaps = 1/90 (1%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           LEP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEP
Sbjct: 295 LEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEP 353

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP+ +PK +P P P+P+P PQP P
Sbjct: 354 KPEPKPEPKPEPKPEPKPEPKPEPKPQPKP 383

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 42/86 (48%), Positives = 55/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 304 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 362

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQ 293
           PEP  EP+ +PK +P P P+P P P+
Sbjct: 363 PEPKPEPKPEPKPEPKPQPKPAPKPE 388

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/92 (47%), Positives = 55/92 (59%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 308 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 366

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
           PEP  EP KP+ KP P P P+P  +     PA
Sbjct: 367 PEPKPEP-KPEPKPQPKPAPKPEAKKEEKKPA 397

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 38/78 (48%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +3

Query: 72  EKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPE-KP 248
           E+ K   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPKPEP  EP+ +P
Sbjct: 291 EEVKLEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPKPEPKPEPKPEP 349

Query: 249 KEKPPPPPQPQPMPQPPP 302
           K +P P P+P+P P+P P
Sbjct: 350 KPEPKPEPKPEPKPEPKP 367

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 36/84 (42%), Positives = 51/84 (60%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P P+PK
Sbjct: 324 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPQPK 382

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMP 290
           P P  E +K ++KP P  + + +P
Sbjct: 383 PAPKPEAKKEEKKPAPKQEAKKLP 406

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 38/93 (40%), Positives = 48/93 (51%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P P PK
Sbjct: 328 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPQPKPAPK 386

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
           PE  KE +KP  K      P       P   A+
Sbjct: 387 PEAKKEEKKPAPKQEAKKLPSTGEATHPFFTAA 419

[29][TOP]
>UniRef100_A8NKV7 LPXTG cell wall surface anchor family protein, putative (Fragment)
           n=1 Tax=Brugia malayi RepID=A8NKV7_BRUMA
          Length = 86

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 48/83 (57%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +3

Query: 54  PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEP-P 230
           PKPK   KPK   KPK   KPK + KPKP KPK   KPK   KPK KP P P+PKP+P P
Sbjct: 1   PKPKPKPKPKPKPKPKPKPKPKPKPKPKP-KPKPXPKPKPKPKPKPKPKPKPKPKPKPKP 59

Query: 231 KEPEKPKEKPPPPPQPQPMPQPP 299
           K   KPK KP P P+P+P P+PP
Sbjct: 60  KPXPKPKPKPKPKPKPKPKPKPP 82

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 43/76 (56%), Positives = 50/76 (65%), Gaps = 1/76 (1%)
 Frame = +3

Query: 78  PKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKE 254
           PK   KPK   KPK + KPKPK KPK   KPK   KPK KP P P+PKP+P  +P KPK 
Sbjct: 1   PKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPXPKPKPKPKPKPKPKPKPKPKP-KPKP 59

Query: 255 KPPPPPQPQPMPQPPP 302
           KP P P+P+P P+P P
Sbjct: 60  KPXPKPKPKPKPKPKP 75

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 39/75 (52%), Positives = 44/75 (58%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P PKPK   KPK    PK   KPK + KPKP       KPK   KPK KP P P+PK
Sbjct: 16  KPKPKPKPKPKPKPKPKPXPKPKPKPKPKPKPKP-------KPKPKPKPKPKPXPKPKPK 68

Query: 219 PEPPKEPEKPKEKPP 263
           P+P  +P KPK KPP
Sbjct: 69  PKPKPKP-KPKPKPP 82

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 33/61 (54%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           +P P PKPK   KPK   KPK   KPK + KPKPK KP    KPK   KPK KP P P  
Sbjct: 24  KPKPKPKPKPXPKPKPKPKPKPKPKPKPKPKPKPKPKPXPKPKPKPKPKPKPKPKPKPPL 83

Query: 216 K 218
           K
Sbjct: 84  K 84

[30][TOP]
>UniRef100_A0BMF6 Chromosome undetermined scaffold_116, whole genome shotgun sequence
            n=1 Tax=Paramecium tetraurelia RepID=A0BMF6_PARTE
          Length = 1734

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 55/98 (56%), Positives = 65/98 (66%), Gaps = 9/98 (9%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEPEKPKEQEK-PKPKK--PKEPEKPKE----PEKPKEKPPP 203
            PP  +PK+PE PKE  +PK+PE PKEQ K P+P K  PK+PE PKE    PE PKE+P  
Sbjct: 1101 PPKEQPKQPEPPKE--QPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQ 1158

Query: 204  PPEPKPEPPKEPEKPKEKP--PPPPQPQPMPQPPPHIP 311
            P  PK E PK+PE PKE+P  P PP+ QP  Q PP  P
Sbjct: 1159 PEPPK-EQPKQPEPPKEQPKQPEPPKEQPKQQEPPKQP 1195

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 52/101 (51%), Positives = 64/101 (63%), Gaps = 16/101 (15%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEP--VKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
            P PPK +EP K  EP  V+PK+PE PK+ E PK ++PK+PE PK+PE PK++P  P  PK
Sbjct: 795  PDPPKKQEPPKQPEPPKVQPKQPEPPKKPELPK-EQPKQPEPPKQPELPKQQPKQPEPPK 853

Query: 219  -----------PEPPKEPEKPKEKP--PPPPQPQP-MPQPP 299
                       P PPK PE PKE+P  P PP+ QP  PQPP
Sbjct: 854  QPEPLKEQPKQPGPPKNPEPPKEQPKQPEPPKEQPKQPQPP 894

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 53/113 (46%), Positives = 68/113 (60%), Gaps = 24/113 (21%)
 Frame = +3

Query: 39   EPPPPPKPKEP-EKPKEPVKPKEPEKPKEQEK-PKPKK--------PKEPEKPKEPEKPK 188
            +P PP KP+ P E+PK+P  PK+PE PK+Q K P+P K        PK+P  PK PE PK
Sbjct: 816  QPEPPKKPELPKEQPKQPEPPKQPELPKQQPKQPEPPKQPEPLKEQPKQPGPPKNPEPPK 875

Query: 189  EKPPPPPEPK-----PEPPKEPEKPKE---KPPPPPQPQP------MPQPPPH 305
            E+P  P  PK     P+PPK+PE PKE   +P PP QP+P       P+PP +
Sbjct: 876  EQPKQPEPPKEQPKQPQPPKQPEPPKEYPKQPEPPKQPEPSKVQPKQPEPPKY 928

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 53/108 (49%), Positives = 67/108 (62%), Gaps = 11/108 (10%)
 Frame = +3

Query: 21   KSIEILEPPPPPK--PKEPEKPKEP----VKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK 182
            K  E  + P PPK  PK+PE PK+P     +PK+PE PK+ E PK ++PK+PE PK+PE 
Sbjct: 799  KKQEPPKQPEPPKVQPKQPEPPKKPELPKEQPKQPEPPKQPELPK-QQPKQPEPPKQPEP 857

Query: 183  PKEKPPPP-----PEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             KE+P  P     PEP  E PK+PE PKE+ P  PQP   P+PP   P
Sbjct: 858  LKEQPKQPGPPKNPEPPKEQPKQPEPPKEQ-PKQPQPPKQPEPPKEYP 904

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 55/99 (55%), Positives = 66/99 (66%), Gaps = 10/99 (10%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEPEKPKEQEK-PKPKK--PKEPEKPKE----PEKPKEKPPP 203
            PP  +PK+PE PKE  +PK+PE PKEQ K P+P K  PK+PE PKE    PE PKE+P  
Sbjct: 1061 PPKEQPKQPEPPKE--QPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQ 1118

Query: 204  PPEPKPEPPKEPEKPKEKP--PPPPQPQP-MPQPPPHIP 311
            P  PK E PK+PE PKE+P  P PP+ QP  P+PP   P
Sbjct: 1119 PEPPK-EQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP 1156

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 55/99 (55%), Positives = 66/99 (66%), Gaps = 10/99 (10%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEPEKPKEQEK-PKPKK--PKEPEKPKE----PEKPKEKPPP 203
            PP  +PK+PE PKE  +PK+PE PKEQ K P+P K  PK+PE PKE    PE PKE+P  
Sbjct: 1071 PPKEQPKQPEPPKE--QPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQ 1128

Query: 204  PPEPKPEPPKEPEKPKEKP--PPPPQPQP-MPQPPPHIP 311
            P  PK E PK+PE PKE+P  P PP+ QP  P+PP   P
Sbjct: 1129 PEPPK-EQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP 1166

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 55/99 (55%), Positives = 66/99 (66%), Gaps = 10/99 (10%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEPEKPKEQEK-PKPKK--PKEPEKPKE----PEKPKEKPPP 203
            PP  +PK+PE PKE  +PK+PE PKEQ K P+P K  PK+PE PKE    PE PKE+P  
Sbjct: 1081 PPKEQPKQPEPPKE--QPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQ 1138

Query: 204  PPEPKPEPPKEPEKPKEKP--PPPPQPQP-MPQPPPHIP 311
            P  PK E PK+PE PKE+P  P PP+ QP  P+PP   P
Sbjct: 1139 PEPPK-EQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP 1176

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 54/102 (52%), Positives = 68/102 (66%), Gaps = 11/102 (10%)
 Frame = +3

Query: 39   EPPPPPKPKE-PEKPKEPVKPKEPEKPKEQEK-PKPKK--PKEPEKPKE----PEKPKEK 194
            +P PP +P++  E+PK+P  PK+PE PKEQ K P+P K  PK+PE PKE    PE PKE+
Sbjct: 986  QPEPPKQPEQLKEQPKQPEPPKQPEPPKEQPKQPEPLKEQPKQPEPPKEQPKQPEPPKEQ 1045

Query: 195  PPPPPEPKPEPPKEPEKPKEKP--PPPPQPQP-MPQPPPHIP 311
            P  P EP  E PK+PE PKE+P  P PP+ QP  P+PP   P
Sbjct: 1046 PKQP-EPLKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP 1086

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 57/116 (49%), Positives = 67/116 (57%), Gaps = 29/116 (25%)
 Frame = +3

Query: 45   PPPPKPKEP--EKPKEPVKPKEPEKPKEQEK-PKPKK--PKEPEKPKEPEKPKE-----K 194
            P PPK  EP  E+PK+P  PK PE PKEQ K P+P K  PK+P+ PK+PE PKE     +
Sbjct: 849  PEPPKQPEPLKEQPKQPGPPKNPEPPKEQPKQPEPPKEQPKQPQPPKQPEPPKEYPKQPE 908

Query: 195  PPPPPEP------KPEPPKEPEKPKEKP----------PP---PPQPQPMPQPPPH 305
            PP  PEP      +PEPPK PE PKE+P          PP   P QP+P  QP  H
Sbjct: 909  PPKQPEPSKVQPKQPEPPKYPEAPKEQPKQPEPPKQPEPPKDQPKQPEPPKQPETH 964

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 52/97 (53%), Positives = 65/97 (67%), Gaps = 8/97 (8%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEP--EKPKEQEKPK--PKKPKEP-EKPKEPEKPKEKPPPPP 209
            PP  +PK+PE PKE  K  EP  E+PK+ E PK  PK+P+ P E+PK+PE PKE+P  P 
Sbjct: 1031 PPKEQPKQPEPPKEQPKQPEPLKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPE 1090

Query: 210  EPKPEPPKEPEKPKEKP--PPPPQPQP-MPQPPPHIP 311
             PK E PK+PE PKE+P  P PP+ QP  P+PP   P
Sbjct: 1091 PPK-EQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP 1126

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 56/105 (53%), Positives = 69/105 (65%), Gaps = 19/105 (18%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEPEKPKEQEK-PKPKK--PKEPEKPKE----PEKPKEKP-- 197
            PP  +PK+PE PKE  +PK+PE PKEQ K P+P K  PK+PE PKE    PE PKE+P  
Sbjct: 1121 PPKEQPKQPEPPKE--QPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQ 1178

Query: 198  PPPPEPKP---EPPKEPEKPKEKPPPPPQP-QPMP------QPPP 302
            P PP+ +P   EPPK+PE+PKE+P  P  P QP+P      QP P
Sbjct: 1179 PEPPKEQPKQQEPPKQPEQPKEQPKQPESPKQPLPSKEQPKQPEP 1223

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 55/109 (50%), Positives = 67/109 (61%), Gaps = 18/109 (16%)
 Frame = +3

Query: 39   EPPPPPKPKEPEKPKEPVK--------PKEPEKPKEQEK-PKPKK--PKEP----EKPKE 173
            +P  P  PK+PE PKE  K        PK+PE PKEQ K P+P K  PK+P    E+PK+
Sbjct: 999  QPKQPEPPKQPEPPKEQPKQPEPLKEQPKQPEPPKEQPKQPEPPKEQPKQPEPLKEQPKQ 1058

Query: 174  PEKPKEKPPPPPEPKPEPPKEPEKPKEKP--PPPPQPQP-MPQPPPHIP 311
            PE PKE+ P  PEP  E PK+PE PKE+P  P PP+ QP  P+PP   P
Sbjct: 1059 PEPPKEQ-PKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP 1106

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 54/99 (54%), Positives = 65/99 (65%), Gaps = 10/99 (10%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEPEKPKEQEK-PKPKK--PKEPEKPKE----PEKPKEKPPP 203
            P   +PK+PE PKE  +PK+PE PKEQ K P+P K  PK+PE PKE    PE PKE+ P 
Sbjct: 1051 PLKEQPKQPEPPKE--QPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQ-PK 1107

Query: 204  PPEPKPEPPKEPEKPKEKP--PPPPQPQP-MPQPPPHIP 311
             PEP  E PK+PE PKE+P  P PP+ QP  P+PP   P
Sbjct: 1108 QPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP 1146

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 57/128 (44%), Positives = 69/128 (53%), Gaps = 37/128 (28%)
 Frame = +3

Query: 39   EPPPPPK-----PKEPE----------KPKEPVKPKEPEKPKEQEK-PKPKK--PKEPEK 164
            EPP  P+     PK+PE          +PK+P  PK PE PKEQ K P+P K  PK+P+ 
Sbjct: 834  EPPKQPELPKQQPKQPEPPKQPEPLKEQPKQPGPPKNPEPPKEQPKQPEPPKEQPKQPQP 893

Query: 165  PKEPEKPKE-----KPPPPPEP------KPEPPKEPEKPKEKP--------PPPPQPQPM 287
            PK+PE PKE     +PP  PEP      +PEPPK PE PKE+P        P PP+ QP 
Sbjct: 894  PKQPEPPKEYPKQPEPPKQPEPSKVQPKQPEPPKYPEAPKEQPKQPEPPKQPEPPKDQPK 953

Query: 288  PQPPPHIP 311
               PP  P
Sbjct: 954  QPEPPKQP 961

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 54/99 (54%), Positives = 65/99 (65%), Gaps = 10/99 (10%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEPEKPKEQEK-PKPKK--PKEPEKPKE----PEKPKEKPPP 203
            P   +PK+PE PKE  +PK+PE PKEQ K P+P K  PK+PE PKE    PE PKE+ P 
Sbjct: 1021 PLKEQPKQPEPPKE--QPKQPEPPKEQPKQPEPLKEQPKQPEPPKEQPKQPEPPKEQ-PK 1077

Query: 204  PPEPKPEPPKEPEKPKEKP--PPPPQPQP-MPQPPPHIP 311
             PEP  E PK+PE PKE+P  P PP+ QP  P+PP   P
Sbjct: 1078 QPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQP 1116

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 51/97 (52%), Positives = 61/97 (62%), Gaps = 12/97 (12%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEPEKPKEQEK-PKPKK--PKEPEKPKE----PEKPKEKPPP 203
            PP  +PK+PE PKE  +PK+PE PKEQ K P+P K  PK+PE PKE    PE PKE+P  
Sbjct: 1111 PPKEQPKQPEPPKE--QPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQ 1168

Query: 204  PPEPK-----PEPPKEPEKPKEKPPPPPQPQPMPQPP 299
            P  PK     PEPPKE  K +E P  P QP+  P+ P
Sbjct: 1169 PEPPKEQPKQPEPPKEQPKQQEPPKQPEQPKEQPKQP 1205

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/112 (45%), Positives = 65/112 (58%), Gaps = 21/112 (18%)
 Frame = +3

Query: 39   EPPPPPKPKEP-EKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
            +P PP KP+ P ++PK P  PK+ E PK+ E PK + PK+PE PK+PE PKE+P  P  P
Sbjct: 778  QPEPPKKPETPKQQPKLPDPPKKQEPPKQPEPPKVQ-PKQPEPPKKPELPKEQPKQPEPP 836

Query: 216  K-----------PEPPKEPEKPKEKP--------PPPPQPQP-MPQPPPHIP 311
            K           PEPPK+PE  KE+P        P PP+ QP  P+PP   P
Sbjct: 837  KQPELPKQQPKQPEPPKQPEPLKEQPKQPGPPKNPEPPKEQPKQPEPPKEQP 888

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 48/102 (47%), Positives = 64/102 (62%), Gaps = 11/102 (10%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKE-PEKPKEQEKPKPKK--PKEPEKPKEPEKPKEKPPPPPEP 215
            PP  +PK+P+ PK+P  PKE P++P+  ++P+P K  PK+PE PK PE PKE+P      
Sbjct: 883  PPKEQPKQPQPPKQPEPPKEYPKQPEPPKQPEPSKVQPKQPEPPKYPEAPKEQPK----- 937

Query: 216  KPEPPKEPEKPKEKPP---PPPQP-----QPMPQPPPHIPAS 317
            +PEPPK+PE PK++P    PP QP     QP    PP  P S
Sbjct: 938  QPEPPKQPEPPKDQPKQPEPPKQPETHKEQPKQAEPPKQPES 979

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/107 (48%), Positives = 68/107 (63%), Gaps = 16/107 (14%)
 Frame = +3

Query: 39   EPPPPPK-----PKEPEKPKEPVK----PKEPEKPKEQEKPKPKKPKEPE----KPKEPE 179
            EPP  P+     PK+PE PK+P +    PK+PE PK+ E PK ++PK+PE    +PK+PE
Sbjct: 972  EPPKQPESLMEQPKQPEPPKQPEQLKEQPKQPEPPKQPEPPK-EQPKQPEPLKEQPKQPE 1030

Query: 180  KPKEKPPPPPEPKPEPPKEPEKPKEKP--PPPPQPQP-MPQPPPHIP 311
             PKE+P  P  PK E PK+PE  KE+P  P PP+ QP  P+PP   P
Sbjct: 1031 PPKEQPKQPEPPK-EQPKQPEPLKEQPKQPEPPKEQPKQPEPPKEQP 1076

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 52/116 (44%), Positives = 66/116 (56%), Gaps = 30/116 (25%)
 Frame = +3

Query: 45   PPPPK--PKEPEKPKEP----VKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP 206
            P PPK  PK+PE PK+P    V+PK+PE PK  E PK ++PK+PE PK+PE PK++P  P
Sbjct: 897  PEPPKEYPKQPEPPKQPEPSKVQPKQPEPPKYPEAPK-EQPKQPEPPKQPEPPKDQPKQP 955

Query: 207  PEPK-----------PEPPKEP----EKPKEKPPP---------PPQPQPMPQPPP 302
              PK            EPPK+P    E+PK+  PP         P QP+P  QP P
Sbjct: 956  EPPKQPETHKEQPKQAEPPKQPESLMEQPKQPEPPKQPEQLKEQPKQPEPPKQPEP 1011

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 48/103 (46%), Positives = 64/103 (62%), Gaps = 11/103 (10%)
 Frame = +3

Query: 36   LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKP---PPP 206
            ++P  P  PK PE PKE  +PK+PE PK+ E PK  +PK+PE PK+PE  KE+P    PP
Sbjct: 918  VQPKQPEPPKYPEAPKE--QPKQPEPPKQPEPPK-DQPKQPEPPKQPETHKEQPKQAEPP 974

Query: 207  PEP--------KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             +P        +PEPPK+PE+ KE+ P  P+P   P+PP   P
Sbjct: 975  KQPESLMEQPKQPEPPKQPEQLKEQ-PKQPEPPKQPEPPKEQP 1016

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 46/96 (47%), Positives = 62/96 (64%), Gaps = 9/96 (9%)
 Frame = +3

Query: 39   EPPPPPK-----PKEPEKPKEPV----KPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKE 191
            EPP  P+     PK+ E PK+P     +PK+PE PK+ E+ K ++PK+PE PK+PE PKE
Sbjct: 956  EPPKQPETHKEQPKQAEPPKQPESLMEQPKQPEPPKQPEQLK-EQPKQPEPPKQPEPPKE 1014

Query: 192  KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
            + P  PEP  E PK+PE PKE+P  P  P+  P+ P
Sbjct: 1015 Q-PKQPEPLKEQPKQPEPPKEQPKQPEPPKEQPKQP 1049

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 49/105 (46%), Positives = 64/105 (60%), Gaps = 22/105 (20%)
 Frame = +3

Query: 51   PPKPKEPEKPKEPVK----PKEPEKPKEQEKPK----PK-KPKEPEKPKEPEKPKEKPPP 203
            P  PK+PE PKEP+K    PK+PE+PK+ + PK    PK +PK+PE PK+ E PKE+P  
Sbjct: 703  PDPPKKPEPPKEPLKQLEPPKKPEQPKQADPPKKPDHPKEQPKQPEPPKKTEPPKEQPKQ 762

Query: 204  PPEPK-----------PEPPKEPEKPKEKP--PPPPQPQPMPQPP 299
            P   K           PEPPK+PE PK++P  P PP+ Q  P+ P
Sbjct: 763  PEPQKKPESLKEQSKQPEPPKKPETPKQQPKLPDPPKKQEPPKQP 807

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 49/109 (44%), Positives = 68/109 (62%), Gaps = 18/109 (16%)
 Frame = +3

Query: 39   EPPPPPKPKEP-EKPKEPVKPKEPE----KPKEQEKPKP-----KKPKEPEKPKEPEKPK 188
            +P PP +P+ P ++PK+P  PK+PE    +PK+ E PK      ++PK+PE PK+PE+ K
Sbjct: 938  QPEPPKQPEPPKDQPKQPEPPKQPETHKEQPKQAEPPKQPESLMEQPKQPEPPKQPEQLK 997

Query: 189  E-----KPPPPPEPKPEPPKEPEKPKEKP--PPPPQPQP-MPQPPPHIP 311
            E     +PP  PEP  E PK+PE  KE+P  P PP+ QP  P+PP   P
Sbjct: 998  EQPKQPEPPKQPEPPKEQPKQPEPLKEQPKQPEPPKEQPKQPEPPKEQP 1046

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 45/98 (45%), Positives = 59/98 (60%), Gaps = 11/98 (11%)
 Frame = +3

Query: 39   EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEP-------EKPKEPEKPKEKP 197
            +P  P  PK+PE PKE  K  EP K  E  K +PK+P+ P       E+PK+PE PK+  
Sbjct: 887  QPKQPQPPKQPEPPKEYPKQPEPPKQPEPSKVQPKQPEPPKYPEAPKEQPKQPEPPKQPE 946

Query: 198  PPPPEPK-PEPPKEPEKPKEKP---PPPPQPQPMPQPP 299
            PP  +PK PEPPK+PE  KE+P    PP QP+ + + P
Sbjct: 947  PPKDQPKQPEPPKQPETHKEQPKQAEPPKQPESLMEQP 984

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 47/90 (52%), Positives = 59/90 (65%), Gaps = 6/90 (6%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEPEKPKEQEK-PKPKK--PKEPEKPKEPEKPKEKPPPPPEP 215
            PP  +PK+PE PKE  +PK+PE PKEQ K P+P K  PK+PE PKE  K +E P  P +P
Sbjct: 1141 PPKEQPKQPEPPKE--QPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQQEPPKQPEQP 1198

Query: 216  KPEPPKEPEKPKEKPP---PPPQPQPMPQP 296
            K E PK+PE PK+  P    P QP+P  +P
Sbjct: 1199 K-EQPKQPESPKQPLPSKEQPKQPEPTKEP 1227

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 53/115 (46%), Positives = 68/115 (59%), Gaps = 24/115 (20%)
 Frame = +3

Query: 39   EPPPPPKPKEP-EKPKEPVKPKEPEKPKEQEK-PKPKK--------PKEPEKPKEPEKPK 188
            +P PP  P+ P E+PK+P  PK+PE PK+Q K P+P K        PK+ E PK+PE   
Sbjct: 922  QPEPPKYPEAPKEQPKQPEPPKQPEPPKDQPKQPEPPKQPETHKEQPKQAEPPKQPESLM 981

Query: 189  EKP--PPPP--------EPK-PEPPKEPEKPKEKP--PPPPQPQP-MPQPPPHIP 311
            E+P  P PP        +PK PEPPK+PE PKE+P  P P + QP  P+PP   P
Sbjct: 982  EQPKQPEPPKQPEQLKEQPKQPEPPKQPEPPKEQPKQPEPLKEQPKQPEPPKEQP 1036

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 51/118 (43%), Positives = 68/118 (57%), Gaps = 20/118 (16%)
 Frame = +3

Query: 18   IKSIEILEPPPPPKPKEP--------EKPKEPVKPKEPEKPKEQEK-PKP-KKP------ 149
            +K +E  + P  PK  +P        E+PK+P  PK+ E PKEQ K P+P KKP      
Sbjct: 716  LKQLEPPKKPEQPKQADPPKKPDHPKEQPKQPEPPKKTEPPKEQPKQPEPQKKPESLKEQ 775

Query: 150  -KEPEKPKEPEKPKEKPP-PPPEPKPEPPKEPEKPKEKP--PPPPQPQPMPQPPPHIP 311
             K+PE PK+PE PK++P  P P  K EPPK+PE PK +P  P PP+   +P+  P  P
Sbjct: 776  SKQPEPPKKPETPKQQPKLPDPPKKQEPPKQPEPPKVQPKQPEPPKKPELPKEQPKQP 833

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 47/108 (43%), Positives = 60/108 (55%), Gaps = 23/108 (21%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKE----PEKPKEQEKPK-----PKKPKEPEKPKEPEKPKEKP 197
            PP  +PK+PE  K+P   KE    PE PK+ E PK     P  PK+ E PK+PE PK +P
Sbjct: 755  PPKEQPKQPEPQKKPESLKEQSKQPEPPKKPETPKQQPKLPDPPKKQEPPKQPEPPKVQP 814

Query: 198  PPPPEPK-----------PEPPKEPEKPKE---KPPPPPQPQPMPQPP 299
              P  PK           PEPPK+PE PK+   +P PP QP+P+ + P
Sbjct: 815  KQPEPPKKPELPKEQPKQPEPPKQPELPKQQPKQPEPPKQPEPLKEQP 862

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 45/93 (48%), Positives = 61/93 (65%), Gaps = 5/93 (5%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEPEKPKEQEK-PKPKK--PKEPEKPKEPEKPKEKPPPPPEP 215
            PP  +PK+PE PKE  +PK+PE PKEQ K P+P K  PK+ E PK+PE+PKE+P  P  P
Sbjct: 1151 PPKEQPKQPEPPKE--QPKQPEPPKEQPKQPEPPKEQPKQQEPPKQPEQPKEQPKQPESP 1208

Query: 216  K-PEPPKE-PEKPKEKPPPPPQPQPMPQPPPHI 308
            K P P KE P++P+    P  +P+   + P H+
Sbjct: 1209 KQPLPSKEQPKQPEPTKEPLKKPEQEIKKPDHL 1241

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 43/107 (40%), Positives = 61/107 (57%), Gaps = 16/107 (14%)
 Frame = +3

Query: 39   EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK--------PKEK 194
            +P  P  PK+ E PKE  K  EP+K  E  K + K+P+ P+KP+ P++         K++
Sbjct: 743  QPKQPEPPKKTEPPKEQPKQPEPQKKPESLKEQSKQPEPPKKPETPKQQPKLPDPPKKQE 802

Query: 195  PPPPPEP------KPEPPKEPEKPKEKP--PPPPQPQPMPQPPPHIP 311
            PP  PEP      +PEPPK+PE PKE+P  P PP+   +P+  P  P
Sbjct: 803  PPKQPEPPKVQPKQPEPPKKPELPKEQPKQPEPPKQPELPKQQPKQP 849

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 47/99 (47%), Positives = 60/99 (60%), Gaps = 11/99 (11%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKP----KEPEKPKEQEKPKPKKPKEP----EKPKEPEKPKEK 194
           +P PP + K+PE+PK+   P    K+P+ PK     KP+ PKEP    E PK+PE+PK+ 
Sbjct: 677 KPEPPKQTKQPEQPKKTELPTPQQKQPDPPK-----KPEPPKEPLKQLEPPKKPEQPKQA 731

Query: 195 PPP--PPEPKPEPPKEPEKPKEKPPPPPQP-QPMPQPPP 302
            PP  P  PK E PK+PE PK+  PP  QP QP PQ  P
Sbjct: 732 DPPKKPDHPK-EQPKQPEPPKKTEPPKEQPKQPEPQKKP 769

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 44/104 (42%), Positives = 60/104 (57%), Gaps = 13/104 (12%)
 Frame = +3

Query: 39  EPPPPP----------KPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK 188
           EPP  P          KP+ P++ K+P +PK+ E P  Q+K +P  PK+PE PKEP K  
Sbjct: 661 EPPKRPQNTNQQEAQKKPEPPKQTKQPEQPKKTELPTPQQK-QPDPPKKPEPPKEPLKQL 719

Query: 189 EKPPPPPEPK-PEPPKEPEKPKEKP--PPPPQPQPMPQPPPHIP 311
           E P  P +PK  +PPK+P+ PKE+P  P PP+    P+  P  P
Sbjct: 720 EPPKKPEQPKQADPPKKPDHPKEQPKQPEPPKKTEPPKEQPKQP 763

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/89 (41%), Positives = 52/89 (58%), Gaps = 6/89 (6%)
 Frame = +3

Query: 63  KEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK-PEPPKEP 239
           K+    +EP  PK P+   +QE  K  KP+ P++ K+PE+PK+   P P+ K P+PPK+P
Sbjct: 654 KQQNYSQEP--PKRPQNTNQQEAQK--KPEPPKQTKQPEQPKKTELPTPQQKQPDPPKKP 709

Query: 240 EKPKE-----KPPPPPQPQPMPQPPPHIP 311
           E PKE     +PP  P+ QP    PP  P
Sbjct: 710 EPPKEPLKQLEPPKKPE-QPKQADPPKKP 737

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 28/75 (37%), Positives = 47/75 (62%), Gaps = 4/75 (5%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKE-PEKPKEQEKPKPKK--PKEPEKPKEP-EKPKEKPPPPPE 212
            PP  +PK+ E PK+P +PKE P++P+  ++P P K  PK+PE  KEP +KP+++   P  
Sbjct: 1181 PPKEQPKQQEPPKQPEQPKEQPKQPESPKQPLPSKEQPKQPEPTKEPLKKPEQEIKKPDH 1240

Query: 213  PKPEPPKEPEKPKEK 257
               +  K+ ++ + K
Sbjct: 1241 LIDQKSKQQQQDQSK 1255

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 8/91 (8%)
 Frame = +3

Query: 63  KEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPE 242
           +E +K  EP K  E +K +   +  PK+P+   + +  +KP+   PP    +PE PK+ E
Sbjct: 638 QERQKQTEPAKISEIQKQQNYSQEPPKRPQNTNQQEAQKKPE---PPKQTKQPEQPKKTE 694

Query: 243 KP---KEKPPPPPQPQPMPQP-----PPHIP 311
            P   +++P PP +P+P  +P     PP  P
Sbjct: 695 LPTPQQKQPDPPKKPEPPKEPLKQLEPPKKP 725

[31][TOP]
>UniRef100_A2Y1S4 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2Y1S4_ORYSI
          Length = 422

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 46/89 (51%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +P+ + KP+PK   EPE   EP KP+ KP P PEPK
Sbjct: 255 EPKPEPKPEPKPEPKPEPKPEPKPEPEPKPKPEPKPHPEPEPKPEP-KPEPKPEPKPEPK 313

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EPE KP+ KP P P+P+P P+P P
Sbjct: 314 PEPKPEPEPKPEPKPEPKPEPKPYPEPKP 342

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 45/91 (49%), Positives = 59/91 (64%), Gaps = 2/91 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+PK   KP+   +PK   +PK + KP+PK   +PE   EPE KP+ KP P PEP
Sbjct: 85  KPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEP 144

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPPH 305
           KP P  +PE KP+ KP P P+P+P P+P PH
Sbjct: 145 KPYPEPKPEPKPEPKPEPKPEPKPKPEPKPH 175

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 45/95 (47%), Positives = 59/95 (62%), Gaps = 6/95 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-----KPKEKPPP 203
           EP P PKP    +PK   KP+   +PK + KP+PK   +PE   +PE     +PK KP P
Sbjct: 197 EPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPYPEPKPKPEP 256

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPH 305
            PEPKPEP  EP+ +PK +P P P+P+P P+P PH
Sbjct: 257 KPEPKPEPKPEPKPEPKPEPKPEPEPKPKPEPKPH 291

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 48/98 (48%), Positives = 57/98 (58%), Gaps = 10/98 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---------KPKE 191
           EP P PKPK   KP    KPK   +PK   KP+PK   +PE   EP+         KP+ 
Sbjct: 55  EPEPKPKPKPHPKPTPKPKPKPEPEPKPVPKPEPKPEPKPEPKPEPKPEPKPYPEPKPEP 114

Query: 192 KPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KP P PEPKPEP  EPE KP+ KP P P+P+P P+P P
Sbjct: 115 KPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKP 152

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 50/96 (52%), Positives = 61/96 (63%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-EPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
           EP P PKPK   KP    KPK EP+ +PK + KP+PK   +PE   EPE   KP+ KP P
Sbjct: 233 EPKPEPKPKPEPKPYPEPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPKPEPKPHP 292

Query: 204 PPEPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
            PEPKPEP  EP+   KP+ KP P P+P+P P+P P
Sbjct: 293 EPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKP 328

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 46/94 (48%), Positives = 57/94 (60%), Gaps = 5/94 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   KPK + KP P+   +PE   EP KP+ KP P PEPK
Sbjct: 259 EPKPEPKPEPKPEPKPEPKPEPEPKPKPEPKPHPEPEPKPEPKPEP-KPEPKPEPKPEPK 317

Query: 219 PEPPKEPE-----KPKEKPPPPPQPQPMPQPPPH 305
           PEP  +PE     KP+ KP P P+P P P+P PH
Sbjct: 318 PEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPH 351

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 46/88 (52%), Positives = 56/88 (63%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   +PK   +PK   KP+PK   EPE   EP KP+ KP P PEPK
Sbjct: 153 EPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEPKPEP-KPEPKPHPEPEPK 211

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 212 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 238

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 44/90 (48%), Positives = 59/90 (65%), Gaps = 1/90 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   KP+ + +P+PK   EP+   EPE KP+ KP P PEP
Sbjct: 249 EPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPKPEPKPHPEPEPKPEPKPEPKPEP 308

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPH 305
           KPEP  EP KP+ +P P P+P+P P+P P+
Sbjct: 309 KPEPKPEP-KPEPEPKPEPKPEPKPEPKPY 337

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 46/94 (48%), Positives = 57/94 (60%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP+   KPK   KP    +PK + KP+PK   +PE   EP+ +P+ KP P PEP
Sbjct: 271 EPKPEPKPEPEPKPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEP 330

Query: 216 KPEP-----PKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP     PK   KP+ KP P P+P+P PQP P
Sbjct: 331 KPEPKPYPEPKPDPKPEPKPHPEPKPEPKPQPEP 364

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 45/91 (49%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   +PK   KP+   +PK + KP+PK   EP KPK   KP  +P P PEPK
Sbjct: 243 EPKPYPEPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEP-KPKPEPKPHPEPEPKPEPK 301

Query: 219 PEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+   KP+ KP P P+P+P P+P P
Sbjct: 302 PEPKPEPKPEPKPEPKPEPEPKPEPKPEPKP 332

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 45/94 (47%), Positives = 57/94 (60%), Gaps = 3/94 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPPP 209
           EP P P+PK   KP+   +PK   +PK   KP+PK   +PK   KP+   KP+ KP P P
Sbjct: 315 EPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPEPKPQPEPKPEPKPEPKP 374

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           EPKPEP  EP KP  +P P P+P+P P+P P  P
Sbjct: 375 EPKPEPKPEP-KPYPEPKPEPKPEPKPEPKPEAP 407

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 45/94 (47%), Positives = 59/94 (62%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           +P P PKPK   +PK   KP+   +PK + KP+PK +PK   +PK   KP+ KP P PEP
Sbjct: 67  KPTPKPKPKPEPEPKPVPKPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEP 126

Query: 216 KPEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE     KP+ KP P P+P+P P+P P
Sbjct: 127 KPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKP 160

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 44/91 (48%), Positives = 57/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK-PKEKPPPPPEP 215
           EP P PKP    KP+   +PK   KP+ + +P+PK   +PE   EP+  P+ KP P PEP
Sbjct: 99  EPKPEPKPYPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEP 158

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPPH 305
           KPEP  EP+ KP+ KP P P+P P P+P PH
Sbjct: 159 KPEPKPEPKPKPEPKPHPEPKPDPKPEPKPH 189

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 44/89 (49%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+PK   KPK   KP    KPK + KP+PK   +PE   EP KP+ KP P P+PK
Sbjct: 227 KPEPKPEPKPEPKPKPEPKPYPEPKPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPEPKPK 285

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP   PE +PK +P P P+P+P P+P P
Sbjct: 286 PEPKPHPEPEPKPEPKPEPKPEPKPEPKP 314

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 49/89 (55%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KP EP    EPE PK + KP+PK   EPE   EP KP+ KP P PEPK
Sbjct: 171 EPKPHPEPKPDPKP-EPKPHPEPE-PKPEPKPEPKPHPEPEPKPEP-KPEPKPEPKPEPK 227

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+ +PK KP P P P+P P+P P
Sbjct: 228 PEPKPEPKPEPKPKPEPKPYPEPKPKPEP 256

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 44/89 (49%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP+   +PK   +PK   KP+ + +PKP+   EPE   EP+ +PK +P P PEP
Sbjct: 91  EPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEP 150

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P P P
Sbjct: 151 KPEPKPEP-KPEPKPEPKPKPEPKPHPEP 178

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 44/88 (50%), Positives = 57/88 (64%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPK 218
           P P PKP+   +PK   KP+   +PK + KP+PK   EP+   EP+ KP+ KP P PEPK
Sbjct: 206 PEPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPYPEPKPKPEPKPEPKPEPK 265

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 266 PEPKPEP-KPEPKPEPEPKPKPEPKPHP 292

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 47/97 (48%), Positives = 59/97 (60%), Gaps = 6/97 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   +PK   +PK   KP+ +  P+PK +PK   +PK   KP+ KP P PEP
Sbjct: 321 EPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPEPKPQPEPKPEPKPEPKPEPKPEP 380

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQP----PPHIP 311
           KPEP   PE KP+ KP P P+P+P   P    PPHIP
Sbjct: 381 KPEPKPYPEPKPEPKPEPKPEPKPEAPPKKHKPPHIP 417

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 44/89 (49%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           E PP P+PK   KP     PK   KP+ + KP PK   +PE   EP+ +PK +P P PEP
Sbjct: 51  EKPPEPEPKPKPKPHPKPTPKPKPKPEPEPKPVPKPEPKPEPKPEPKPEPKPEPKPYPEP 110

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 111 KPEPKPEP-KPEPKPEPKPEPEPKPEPKP 138

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 45/91 (49%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P PKPK   KP    KP    +PK   +P+PK   +PE    PE   KP+ KP P P
Sbjct: 161 EPKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEPKPEPKPEPKPHPEPEPKPEPKPEPKP 220

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP KP+ KP P P+P+P P P P
Sbjct: 221 EPKPEPKPEP-KPEPKPEPKPKPEPKPYPEP 250

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/100 (45%), Positives = 58/100 (58%), Gaps = 12/100 (12%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-----KPKEPEKPKEPEKPKEKPPP 203
           EP P PKP+   +PK   KP+   +PK + KPKP+     +PK   +PK   KP+ KP P
Sbjct: 209 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPYPEPKPKPEPKPEPKPEPKPEP 268

Query: 204 PPEPKPEPPKEPE-------KPKEKPPPPPQPQPMPQPPP 302
            PEPKPEP  EPE       KP  +P P P+P+P P+P P
Sbjct: 269 KPEPKPEPKPEPEPKPKPEPKPHPEPEPKPEPKPEPKPEP 308

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 45/103 (43%), Positives = 58/103 (56%), Gaps = 14/103 (13%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   KP+ + KP+PK   +PE    PE KP+ KP P PEP
Sbjct: 103 EPKPYPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEP 162

Query: 216 KPEPPKEPE-------------KPKEKPPPPPQPQPMPQPPPH 305
           KPEP  +PE             +PK  P P P+P+P P+P PH
Sbjct: 163 KPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEPKPEPKPEPKPH 205

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 43/91 (47%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   KP+   +PK   KP  + KP+PK   +PE   EP KPK +P P PEPK
Sbjct: 121 EPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEP-KPKPEPKPHPEPK 179

Query: 219 PEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           P+P  EP+   +P+ KP P P+P+P P+P P
Sbjct: 180 PDPKPEPKPHPEPEPKPEPKPEPKPHPEPEP 210

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 43/89 (48%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP+    P+   KP+   +PK + KP+PK   +PE   EP+ KP+ KP P P+P
Sbjct: 193 EPKPEPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPYPEPKP 252

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 253 KPEPKPEP-KPEPKPEPKPEPKPEPKPEP 280

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 43/95 (45%), Positives = 58/95 (61%), Gaps = 6/95 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK---PKEKPPPPP 209
           EP P P+PK   KP+   +PK   KP+ + KP+PK   +PE    PE    PK +P P P
Sbjct: 293 EPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHP 352

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPPH 305
           EPKPEP  +PE   +PK +P P P+P+P P+P P+
Sbjct: 353 EPKPEPKPQPEPKPEPKPEPKPEPKPEPKPEPKPY 387

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 43/90 (47%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   +PK + KP+PK   +PE KPK   KP  +P P P+P
Sbjct: 125 EPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKP 184

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+P  EPE KP+ KP P P P+P P+P P
Sbjct: 185 EPKPHPEPEPKPEPKPEPKPHPEPEPKPEP 214

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 44/92 (47%), Positives = 56/92 (60%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP    KP+   +PK   KP+ + KP+PK   EP+   +PE KP  +P P PEP
Sbjct: 139 EPKPEPKPYPEPKPEPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEPKPEP 198

Query: 216 KPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           KPEP   PE   KP+ KP P P+P+P P+P P
Sbjct: 199 KPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEP 230

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 43/90 (47%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+PK   KP+   +PK   KP  + KP+PK   +PE   EP+ +P+ KP P PEP
Sbjct: 81  KPVPKPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEP 140

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP   PE KP+ KP P P+P+P P+P P
Sbjct: 141 KPEPKPYPEPKPEPKPEPKPEPKPEPKPKP 170

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 43/91 (47%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+PK   +PK   KP+   +PK + KPKP+    PE PK   KP+ KP P PEPK
Sbjct: 137 KPEPKPEPKPYPEPKPEPKPEPKPEPKPEPKPKPEPKPHPE-PKPDPKPEPKPHPEPEPK 195

Query: 219 PEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+   +P+ KP P P+P+P P+P P
Sbjct: 196 PEPKPEPKPHPEPEPKPEPKPEPKPEPKPEP 226

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 42/90 (46%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP+   +PK   KPK   KP  + KPKP+   EP+   +PE KP+ KP P PEP
Sbjct: 221 EPKPEPKPEPKPEPKPEPKPKPEPKPYPEPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEP 280

Query: 216 KPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
           +P+P  EP+  P+ +P P P+P+P P+P P
Sbjct: 281 EPKPKPEPKPHPEPEPKPEPKPEPKPEPKP 310

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 42/90 (46%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   +P+   +PK   KP+ + +PKP+   EPE   EP+ +PK +P P PEP
Sbjct: 281 EPKPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEP 340

Query: 216 KPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
           KP+P  EP+  P+ KP P PQP+P P+P P
Sbjct: 341 KPDPKPEPKPHPEPKPEPKPQPEPKPEPKP 370

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 43/91 (47%), Positives = 56/91 (61%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKP---KKPKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP+   +PK   +PK   KP+ + +PKP    KP    +PK   +PK +P P P
Sbjct: 303 EPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPEPKPQP 362

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 363 EPKPEPKPEP-KPEPKPEPKPEPKPYPEPKP 392

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 43/88 (48%), Positives = 53/88 (60%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KPK   KP  + KP PK   +P    EP KP+ KP P P P+
Sbjct: 149 EPKPEPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEP-KPEPKPEPKPHPE 207

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 208 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 234

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 43/88 (48%), Positives = 53/88 (60%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   KP+   +PK   KP  + KP PK   +P    +PE PK +P P PEPK
Sbjct: 311 EPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPE-PKPQPEPKPEPK 369

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P P+P P+P P
Sbjct: 370 PEPKPEP-KPEPKPEPKPYPEPKPEPKP 396

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 42/91 (46%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK   +PKP+   EP+   +PE PK +P P PEPK
Sbjct: 79  EPKPVPKPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPE-PKPEPEPKPEPK 137

Query: 219 PEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+   +PK +P P P+P+P P+P P
Sbjct: 138 PEPKPEPKPYPEPKPEPKPEPKPEPKPEPKP 168

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+    P+   KP+   +PK   +P+PK   +PE   EP KP+ KP P PEPK
Sbjct: 177 EPKPDPKPEPKPHPEPEPKPEPKPEPKPHPEPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 235

Query: 219 PEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE     +PK KP P P+P+P P+P P
Sbjct: 236 PEPKPKPEPKPYPEPKPKPEPKPEPKPEPKPEP 268

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 42/92 (45%), Positives = 57/92 (61%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           +P P P+PK   KP+   KPK   KP  + +PKP+   EP+   +PE   +PK +P P P
Sbjct: 265 KPEPKPEPKPEPKPEPEPKPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKP 324

Query: 210 EPKPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP+  P+ KP P P+P+P P+P P
Sbjct: 325 EPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKP 356

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 42/92 (45%), Positives = 56/92 (60%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           +P P PKP    +PK   KP+   +PK + KP+PK   EP+   +PE   +PK  P P P
Sbjct: 283 KPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKP 342

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PKPEP   PE KP+ KP P P+P+P P+P P
Sbjct: 343 DPKPEPKPHPEPKPEPKPQPEPKPEPKPEPKP 374

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 43/89 (48%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   +PK   +PK   KP+ + +PKP+ KPK   KP    KP  KP P P P
Sbjct: 131 EPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKPEPKPHP 190

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           +PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 191 EPEPKPEP-KPEPKPHPEPEPKPEPKPEP 218

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 42/90 (46%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   KPK + KP P+ KP    +PK   +P+ KP P PEP
Sbjct: 143 EPKPYPEPKPEPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEPKPEPKPEP 202

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KP P  EP+ +PK +P P P+P+P P+P P
Sbjct: 203 KPHPEPEPKPEPKPEPKPEPKPEPKPEPKP 232

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 42/92 (45%), Positives = 57/92 (61%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P P+P+   +PK   KP    +PK + KP+PK   +PE   EP+   KP+ KP P P
Sbjct: 185 EPKPHPEPEPKPEPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEP 244

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P PEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 245 KPYPEPKPKPEPKPEPKPEPKPEPKPEPKPEP 276

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +3

Query: 135 KPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPH 305
           KP +P+   KPK   KP  KP P PEP+P+P  +PE PK +P P P+P+P P+P P+
Sbjct: 52  KPPEPEPKPKPKPHPKPTPKPKPKPEPEPKPVPKPE-PKPEPKPEPKPEPKPEPKPY 107

[32][TOP]
>UniRef100_UPI00015535DE PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI00015535DE
          Length = 231

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 46/90 (51%), Positives = 70/90 (77%), Gaps = 4/90 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPK--EKPPPPP 209
           EP  P +P+EPE+P+EP +P+EPE+P+E E+P +P++P++PE+P+EPE+P+  E+P  P 
Sbjct: 72  EPEEPEEPEEPEEPEEPEEPEEPEEPEEPEQPEQPEQPEQPEEPEEPEQPEQPEQPEEPE 131

Query: 210 EP-KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           EP +PE P+EPE+P E+P  P QP+   QP
Sbjct: 132 EPEEPEEPEEPEEP-EEPEEPEQPEQPEQP 160

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 42/87 (48%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP  P +P+EPE+P+EP +P+EPE+P++ E+P +P++P+EPE+P++PE+P+E   P    
Sbjct: 78  EPEEPEEPEEPEEPEEPEEPEEPEQPEQPEQPEQPEEPEEPEQPEQPEQPEEPEEPEEPE 137

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PE P+EPE+P E+P  P QP+   QP
Sbjct: 138 EPEEPEEPEEP-EEPEQPEQPEQPEQP 163

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 41/97 (42%), Positives = 72/97 (74%), Gaps = 7/97 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPK--EKPPPPP 209
           +P  P +P+EPE+P+EP +P+EPE+P+E E+P +P++P++PE+P++PE+P+  E+P  P 
Sbjct: 123 QPEQPEEPEEPEEPEEPEEPEEPEEPEEPEQPEQPEQPEQPEQPEQPEQPEQPEQPEQPE 182

Query: 210 EP----KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           +P    +PE P++PE+P+E   P  +P+  P+P P +
Sbjct: 183 QPEQPEQPEQPEQPEQPEEPEQPELEPESEPEPEPEL 219

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 41/87 (47%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP  P +P+EPE+P+EP +P++PE+P++ E+P +P++P++PE+P+EPE+P+E   P    
Sbjct: 84  EPEEPEEPEEPEEPEEPEQPEQPEQPEQPEEPEEPEQPEQPEQPEEPEEPEEPEEPEEPE 143

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PE P+EPE+P E+P  P QP+   QP
Sbjct: 144 EPEEPEEPEQP-EQPEQPEQPEQPEQP 169

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 41/87 (47%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP  P +P+EPE+P++P +P++PE+P+E E+P +P++P+EPE+P+EPE+P+E   P    
Sbjct: 90  EPEEPEEPEEPEQPEQPEQPEQPEEPEEPEQPEQPEQPEEPEEPEEPEEPEEPEEPEEPE 149

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PE P++PE+P E+P  P QP+   QP
Sbjct: 150 EPEQPEQPEQP-EQPEQPEQPEQPEQP 175

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 40/87 (45%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP  P +P+EPE+P+EP +P++PE+P++ E+P +P++P++PE+P++PE+P+E   P    
Sbjct: 81  EPEEPEEPEEPEEPEEPEEPEQPEQPEQPEQPEEPEEPEQPEQPEQPEEPEEPEEPEEPE 140

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PE P+EPE+P E+P  P QP+   QP
Sbjct: 141 EPEEPEEPEEP-EQPEQPEQPEQPEQP 166

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 40/87 (45%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP  P +P+EPE+P++P +P++PE+P+E E+P +P++P++PE+P+EPE+P+E   P    
Sbjct: 87  EPEEPEEPEEPEEPEQPEQPEQPEQPEEPEEPEQPEQPEQPEEPEEPEEPEEPEEPEEPE 146

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PE P++PE+P E+P  P QP+   QP
Sbjct: 147 EPEEPEQPEQP-EQPEQPEQPEQPEQP 172

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 40/87 (45%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP  P +P++PE+P++P +P+EPE+P++ E+P +P++P+EPE+P+EPE+P+E   P    
Sbjct: 93  EPEEPEEPEQPEQPEQPEQPEEPEEPEQPEQPEQPEEPEEPEEPEEPEEPEEPEEPEEPE 152

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PE P++PE+P E+P  P QP+   QP
Sbjct: 153 QPEQPEQPEQP-EQPEQPEQPEQPEQP 178

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 40/87 (45%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP  P +P++PE+P++P +P+EPE+P++ E+P +P++P+EPE+P+EPE+P+E   P    
Sbjct: 96  EPEEPEQPEQPEQPEQPEEPEEPEQPEQPEQPEEPEEPEEPEEPEEPEEPEEPEEPEQPE 155

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PE P++PE+P E+P  P QP+   QP
Sbjct: 156 QPEQPEQPEQP-EQPEQPEQPEQPEQP 181

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 40/87 (45%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP  P +P++PE+P+EP +P++PE+P++ E+P +P++P+EPE+P+EPE+P+E   P    
Sbjct: 99  EPEQPEQPEQPEQPEEPEEPEQPEQPEQPEEPEEPEEPEEPEEPEEPEEPEEPEQPEQPE 158

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PE P++PE+P E+P  P QP+   QP
Sbjct: 159 QPEQPEQPEQP-EQPEQPEQPEQPEQP 184

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 39/87 (44%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           +P  P +P++PE+P+EP +P++PE+P+E E+P +P++P+EPE+P+EPE+P++   P    
Sbjct: 102 QPEQPEQPEQPEEPEEPEQPEQPEQPEEPEEPEEPEEPEEPEEPEEPEEPEQPEQPEQPE 161

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PE P++PE+P E+P  P QP+   QP
Sbjct: 162 QPEQPEQPEQP-EQPEQPEQPEQPEQP 187

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 39/87 (44%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           +P  P +P+EPE+P++P +P++PE+P+E E+P +P++P+EPE+P+EPE+P++   P    
Sbjct: 105 QPEQPEQPEEPEEPEQPEQPEQPEEPEEPEEPEEPEEPEEPEEPEEPEQPEQPEQPEQPE 164

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PE P++PE+P E+P  P QP+   QP
Sbjct: 165 QPEQPEQPEQP-EQPEQPEQPEQPEQP 190

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 39/87 (44%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           +P  P +P+EPE+P++P +P+EPE+P+E E+P +P++P+EPE+P++PE+P++   P    
Sbjct: 108 QPEQPEEPEEPEQPEQPEQPEEPEEPEEPEEPEEPEEPEEPEEPEQPEQPEQPEQPEQPE 167

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PE P++PE+P E+P  P QP+   QP
Sbjct: 168 QPEQPEQPEQP-EQPEQPEQPEQPEQP 193

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 39/87 (44%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP  P +P++PE+P+EP +P+EPE+P+E E+P +P++P++PE+P++PE+P++   P    
Sbjct: 114 EPEEPEQPEQPEQPEEPEEPEEPEEPEEPEEPEEPEEPEQPEQPEQPEQPEQPEQPEQPE 173

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PE P++PE+P E+P  P QP+   QP
Sbjct: 174 QPEQPEQPEQP-EQPEQPEQPEQPEQP 199

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 38/87 (43%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           +P  P +P++PE+P++P +P+EPE+P+E E+P +P++P+EPE+P++PE+P++   P    
Sbjct: 111 QPEEPEEPEQPEQPEQPEEPEEPEEPEEPEEPEEPEEPEEPEQPEQPEQPEQPEQPEQPE 170

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PE P++PE+P E+P  P QP+   QP
Sbjct: 171 QPEQPEQPEQP-EQPEQPEQPEQPEQP 196

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 40/82 (48%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +3

Query: 57  KPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP-KPEPP 230
           +P+EPE+P+EP +P+EPE+P+E E+P +P++P+EPE+P++PE+P E+P  P EP +PE P
Sbjct: 66  EPEEPEEPEEPEEPEEPEEPEEPEEPEEPEEPEEPEQPEQPEQP-EQPEEPEEPEQPEQP 124

Query: 231 KEPEKPKEKPPPPPQPQPMPQP 296
           ++PE+P E+P  P +P+   +P
Sbjct: 125 EQPEEP-EEPEEPEEPEEPEEP 145

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 40/80 (50%), Positives = 64/80 (80%), Gaps = 2/80 (2%)
 Frame = +3

Query: 63  KEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP-KPEPPKE 236
           KEPE+P+EP +P+EPE+P+E E+P +P++P+EPE+P++PE+P E+P  P EP +PE P++
Sbjct: 65  KEPEEPEEPEEPEEPEEPEEPEEPEEPEEPEEPEEPEQPEQP-EQPEQPEEPEEPEQPEQ 123

Query: 237 PEKPKEKPPPPPQPQPMPQP 296
           PE+P E+P  P +P+   +P
Sbjct: 124 PEQP-EEPEEPEEPEEPEEP 142

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 29/78 (37%), Positives = 46/78 (58%)
 Frame = +3

Query: 63  KEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPE 242
           +E +K  + +K +  E          K+P+EPE+P+EPE+P+E   P    +PE P+EPE
Sbjct: 39  EEVQKDLQKIKNERAELQGILANYTNKEPEEPEEPEEPEEPEEPEEPEEPEEPEEPEEPE 98

Query: 243 KPKEKPPPPPQPQPMPQP 296
           +P E+P  P QP+   +P
Sbjct: 99  EP-EQPEQPEQPEQPEEP 115

[33][TOP]
>UniRef100_C5FE44 Trans-sialidase n=1 Tax=Microsporum canis CBS 113480
           RepID=C5FE44_NANOT
          Length = 820

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 51/99 (51%), Positives = 66/99 (66%), Gaps = 9/99 (9%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           P P P+PK+PE   EP KP+ P+ +P +QE+PKP+ PK+ E   +PE+PK KPP P EPK
Sbjct: 293 PKPDPEPKQPEPKPEPPKPEPPKPEPPKQEEPKPEPPKQEEL--KPEEPKAKPPQPEEPK 350

Query: 219 PEPP------KEPEKPKE-KPPPPPQPQPMPQPP-PHIP 311
           PE P      KE  KP+E KP PP + +P P+PP P IP
Sbjct: 351 PEAPAPEPPKKEEPKPEEPKPEPPKKEEPKPEPPKPEIP 389

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 50/102 (49%), Positives = 69/102 (67%), Gaps = 10/102 (9%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPK-EPVKPKEPE-KPKEQEKPKPKKPK----EPEKPK----EPEKPK 188
           +P P P+P +PE PK EP K +EP+ +P +QE+ KP++PK    +PE+PK     PE PK
Sbjct: 301 QPEPKPEPPKPEPPKPEPPKQEEPKPEPPKQEELKPEEPKAKPPQPEEPKPEAPAPEPPK 360

Query: 189 EKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
           ++ P P EPKPEPPK+ E+PK +PP P  P+P  +P P  PA
Sbjct: 361 KEEPKPEEPKPEPPKK-EEPKPEPPKPEIPKPEVKPEPPKPA 401

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/96 (46%), Positives = 59/96 (61%), Gaps = 11/96 (11%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPE---KPKEPEKPKEKPPPPPE 212
           PPPP  +E  +P+ P  P     P+  E PKP  +PK+PE   +P +PE PK +PP   E
Sbjct: 264 PPPPPRREAPRPESPPPPPRKHAPRRSETPKPDPEPKQPEPKPEPPKPEPPKPEPPKQEE 323

Query: 213 PKPEPPKE----PEKPKEKPPPPPQPQ---PMPQPP 299
           PKPEPPK+    PE+PK KPP P +P+   P P+PP
Sbjct: 324 PKPEPPKQEELKPEEPKAKPPQPEEPKPEAPAPEPP 359

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 50/106 (47%), Positives = 63/106 (59%), Gaps = 15/106 (14%)
 Frame = +3

Query: 39  EPPPPPKPKE----PEKPK-EPVKPKEPE-KPKEQEKPKPKKP------KEPEKPKEP-- 176
           EPP P  PK+    PE PK E +KP+EP+ KP + E+PKP+ P      KE  KP+EP  
Sbjct: 312 EPPKPEPPKQEEPKPEPPKQEELKPEEPKAKPPQPEEPKPEAPAPEPPKKEEPKPEEPKP 371

Query: 177 EKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP-PHIP 311
           E PK++ P P  PKPE PK   KP  +PP P +  P P+PP P  P
Sbjct: 372 EPPKKEEPKPEPPKPEIPKPEVKP--EPPKPAESAPQPEPPKPEAP 415

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 46/104 (44%), Positives = 61/104 (58%), Gaps = 14/104 (13%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEP-VKPKEPEKPK---------EQEKPKPKKPKEPEKPKEPEKPK 188
           EP P P  +E  KP+EP  KP +PE+PK         ++E+PKP++PK PE PK+ E+PK
Sbjct: 323 EPKPEPPKQEELKPEEPKAKPPQPEEPKPEAPAPEPPKKEEPKPEEPK-PEPPKK-EEPK 380

Query: 189 EKPPPP----PEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
            +PP P    PE KPEPPK  E   +  PP P+   +P   P I
Sbjct: 381 PEPPKPEIPKPEVKPEPPKPAESAPQPEPPKPEAPKVPMVDPKI 424

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 45/96 (46%), Positives = 57/96 (59%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP 200
           K  E+    P  KP +PE+PK P  P  PE PK++E PKP++PK PE PK+ E+PK +PP
Sbjct: 330 KQEELKPEEPKAKPPQPEEPK-PEAP-APEPPKKEE-PKPEEPK-PEPPKK-EEPKPEPP 384

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
            P  PKPE   EP KP E  P P  P+P     P +
Sbjct: 385 KPEIPKPEVKPEPPKPAESAPQPEPPKPEAPKVPMV 420

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 38/98 (38%), Positives = 53/98 (54%), Gaps = 2/98 (2%)
 Frame = +3

Query: 12  GAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKE 191
           G+ +S    + PP P+P   + P+   +   P  P  +E P+P+ P  P +   P +  E
Sbjct: 235 GSRQSYGSYDSPPSPEPHRRDPPRS--ESPGPPPPPRREAPRPESPPPPPRKHAPRR-SE 291

Query: 192 KPPPPPEPK-PEPPKEPEKPK-EKPPPPPQPQPMPQPP 299
            P P PEPK PEP  EP KP+  KP PP Q +P P+PP
Sbjct: 292 TPKPDPEPKQPEPKPEPPKPEPPKPEPPKQEEPKPEPP 329

[34][TOP]
>UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae
            RepID=UPI000186983E
          Length = 1411

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 876  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 936  PPPPPPPPPPPPPPPPPPPPPPPPPPPGAP 965

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 42/92 (45%), Positives = 43/92 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 873  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
             PP  P  P   PPPPP P P P PPP  P +
Sbjct: 933  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGA 964

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 854  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 914  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 855  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 915  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 856  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 916  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 857  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 917  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 858  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 918  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 859  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 919  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 860  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 920  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 861  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 921  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 862  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 922  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 863  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 923  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 864  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 924  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 865  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 925  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 866  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 926  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 867  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 927  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 868  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 928  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 869  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 929  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 870  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 930  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 871  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 931  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 872  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P P P PPP  P
Sbjct: 932  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 41/90 (45%), Positives = 42/90 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 884  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P   PPPPP P   P PPP +P
Sbjct: 944  PPPPPPPPPPPPPPPPPPPGAPPPPPPALP 973

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 42/91 (46%), Positives = 42/91 (46%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 881  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
             PP  P  P   PPPPP P P   PPP  PA
Sbjct: 941  PPPPPPPPPPPPPPPPPPPPPPGAPPPPPPA 971

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 41/92 (44%), Positives = 42/92 (45%), Gaps = 2/92 (2%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 893  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952

Query: 222  EPPKEPEKPKEKPPPPPQ--PQPMPQPPPHIP 311
             PP  P  P   PPPPP   P   P PPP +P
Sbjct: 953  PPPPPPPPPPGAPPPPPPALPPGAPPPPPALP 984

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 40/91 (43%), Positives = 40/91 (43%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 892  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
             PP  P  P    PPPP P   P  PP  PA
Sbjct: 952  PPPPPPPPPPPGAPPPPPPALPPGAPPPPPA 982

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 39/89 (43%), Positives = 40/89 (44%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
            P P   +EP  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P 
Sbjct: 843  PAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902

Query: 225  PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 903  PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 32/70 (45%), Positives = 33/70 (47%)
 Frame = +3

Query: 102  EPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQ 281
            EP     +E   P  P  P  P  P  P   PPPPP P P PP  P  P   PPPPP P 
Sbjct: 842  EPAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901

Query: 282  PMPQPPPHIP 311
            P P PPP  P
Sbjct: 902  PPPPPPPPPP 911

[35][TOP]
>UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f.
           nagariensis RepID=Q9SBM1_VOLCA
          Length = 409

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 42/92 (45%), Positives = 43/92 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P+ P  P     P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 68  PPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPP 127

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            PP  P  P   PPPPP P P P PPP  P S
Sbjct: 128 PPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPS 159

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 43/94 (45%), Positives = 44/94 (46%), Gaps = 2/94 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPP--PPEP 215
           PPPPP P +P  P  P  P  P  P     P P  P  P  P  P  P   PPP  PP P
Sbjct: 70  PPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPP 129

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            P PP  P  P   PPPPP P P P PPP  P S
Sbjct: 130 PPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPS 163

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 88  PPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPP 147

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
             P  P  P   PPP P P P P PPP  P S
Sbjct: 148 PSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPS 179

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 42/94 (44%), Positives = 43/94 (45%), Gaps = 1/94 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP-PPPEP 215
           +PP PP P  P  P  PV P  P  P     P P  P  P  P  P  P   PP PPP P
Sbjct: 78  QPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPP 137

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            P PP  P  P   PPP P P P P PPP  P S
Sbjct: 138 NPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPS 171

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 41/92 (44%), Positives = 44/92 (47%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           E PPPP P  P  P+ P+ P     P     P P  P  P  P  P  P   PPPPP P 
Sbjct: 64  EHPPPPPPPPPPPPQPPLPPS----PSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPP 119

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
           P PP  P  P   PPPPP P P P PPP  P+
Sbjct: 120 PPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPS 151

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP PP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 93  PPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSP 152

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            PP  P  P   PPP P P P P PPP  P S
Sbjct: 153 -PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPS 183

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 41/97 (42%), Positives = 42/97 (43%), Gaps = 5/97 (5%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   P PPP P P
Sbjct: 99  PPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPP 158

Query: 222 EPPKEPE-----KPKEKPPPPPQPQPMPQPPPHIPAS 317
            PP  P       P   PPP P P P P+PPP  P S
Sbjct: 159 SPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPS 195

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 41/92 (44%), Positives = 42/92 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPP P P P
Sbjct: 111 PPPPPPPPPPPPPSPP--PPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSP 168

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            PP  P  P   PPP P P+P P PPP  P S
Sbjct: 169 -PPSPPPSPPPSPPPSPPPRPPPSPPPSPPPS 199

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 40/92 (43%), Positives = 40/92 (43%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P     P  P  P   PPP P P P
Sbjct: 113 PPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSP 172

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            PP  P  P   PPP P P P P PPP  P S
Sbjct: 173 -PPSPPPSPPPSPPPRPPPSPPPSPPPSPPPS 203

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 42/92 (45%), Positives = 43/92 (46%), Gaps = 2/92 (2%)
 Frame = +3

Query: 42  PP--PPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           PP  PPP P  PE P  P  P  P        P+P  P  P  P  P  P   PPPPP P
Sbjct: 52  PPGVPPPTPSGPEHPPPPPPPPPPP-------PQPPLPPSPSPPPPPPPPVPPPPPPPPP 104

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P PP  P  P   PPPPP P P P PPP  P
Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPP 136

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 40/90 (44%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP   P  P  P+ P  P  P  P  Q  P P  P  P  P  P  P   PPPPP P P
Sbjct: 51  PPPGVPPPTPSGPEHPPPPPPPPPPPPQP-PLPPSPSPPPPPPPPVPPPPPPPPPPPPPP 109

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PP PP P P P PPP  P
Sbjct: 110 SPPPPPPPPPPPPPSPPPPPPPPPPPPPNP 139

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 40/92 (43%), Positives = 41/92 (44%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP PP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPP P P P
Sbjct: 122 PPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPP-PSPPPSPPPSPPPSPPPSP 180

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            PP  P +P   PPP P P P P PPP  P S
Sbjct: 181 -PPSPPPRPPPSPPPSPPPSPPPSPPPRPPPS 211

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 39/91 (42%), Positives = 40/91 (43%), Gaps = 1/91 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P     P   P PPP P P
Sbjct: 117 PPPPPPPSPPPPPPPP--PPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPP 174

Query: 222 E-PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PP  P  P  +PPP P P P P PPP  P
Sbjct: 175 SPPPSPPPSPPPRPPPSPPPSPPPSPPPSPP 205

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 39/97 (40%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +3

Query: 27  IEILEPP--PPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP 200
           + ++E P  PPP    P  P   V P  P  P+    P P  P  P+ P  P      PP
Sbjct: 32  VALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPP 91

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PPP P P PP  P  P   PPPPP P P P P P  P
Sbjct: 92  PPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPP 128

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 39/93 (41%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P     P     P P  P  P  P  P  P   PPP P P+P
Sbjct: 130 PPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPPPSPPPRP 188

Query: 222 EPPKEPEKPKEKPP-PPPQPQPMPQPPPHIPAS 317
            P   P  P   PP PPP+P P P PP   P S
Sbjct: 189 PPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPS 221

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 39/90 (43%), Positives = 40/90 (44%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP  P P  P     P  P  PE P     P P  P +P  P  P  P   PPP P P P
Sbjct: 42  PPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPP-QPPLPPSPSPPPPPPPPVPPPPP 100

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPPPPP 130

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 37/89 (41%), Positives = 39/89 (43%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPP  P     P  P  P+ P  P     P P+ P  P     P  P   PPPPP P P 
Sbjct: 46  PPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPP 105

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PP     P   PPPPP P P P PPP  P
Sbjct: 106 PPPPSPPPPPPPPPPPPPSPPPPPPPPPP 134

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 35/91 (38%), Positives = 41/91 (45%), Gaps = 1/91 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P +P     P  P  P     P+P     P  P+ P      P PPP   P
Sbjct: 176 PPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPP 235

Query: 222 EPPKEPEKPKEKPPPPPQPQ-PMPQPPPHIP 311
            PP  P  P+  PP PP P+ P P PPP +P
Sbjct: 236 FPPPSPPPPRPPPPAPPPPRPPPPSPPPPLP 266

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 39/98 (39%), Positives = 42/98 (42%), Gaps = 6/98 (6%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           L PPP P P  P  P        P KP     P P+ P     P  P  P   PP PP P
Sbjct: 275 LPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPP 334

Query: 216 KPEPPKEP---EKPKEKPPP---PPQPQPMPQPPPHIP 311
            P PP+ P     P   PPP   PP+P P P PPP  P
Sbjct: 335 SPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSPPPRPP 372

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/100 (38%), Positives = 42/100 (42%), Gaps = 8/100 (8%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP------P 203
           PPPPP P  P  P  P     P  P       P  P     P  P +P   PP      P
Sbjct: 141 PPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSP 200

Query: 204 PPEPKPEPPKEPEKPKEKP--PPPPQPQPMPQPPPHIPAS 317
           PP P P PP  P  P  +P  P PP P+P P+ PP  P S
Sbjct: 201 PPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPS 240

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 36/92 (39%), Positives = 42/92 (45%), Gaps = 2/92 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPP-PPPEP 215
           P PPP+P     P  P  P     P+    P P  P+ P   P  P  P  +PP PPP P
Sbjct: 182 PSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSP 241

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P  P  P  P  +PPPP  P P+P PP   P
Sbjct: 242 PPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPP 273

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 36/92 (39%), Positives = 42/92 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P+ P  P  P  P+ P       +P P++P  P     P +P    PPPP P P
Sbjct: 200 PPPSPPPRPPPSPNPP-SPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPP 258

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
             P  P  P   PPPP  P P P PP   P S
Sbjct: 259 PSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPS 290

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 37/91 (40%), Positives = 41/91 (45%), Gaps = 1/91 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEP-EKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           PPP P P  P  PK P  P  P  +P     P P+ P     P  P  P   PP PP P 
Sbjct: 287 PPPSPLPPSPRPPK-PSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPS 345

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P PP+ P      P PPP P P P+PP   P
Sbjct: 346 PNPPRPPPPSPSPPKPPPPPSPPPRPPRRPP 376

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 38/91 (41%), Positives = 41/91 (45%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P  P  P     P     P P  P  P  P  P  P  +PPP P P P 
Sbjct: 139 PPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPRPPPSPPPSP- 196

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
           PP  P  P  +PPP P P P P+PP   P S
Sbjct: 197 PPSPPPSPPPRPPPSPNP-PSPRPPSPSPPS 226

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 36/93 (38%), Positives = 39/93 (41%), Gaps = 1/93 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P     P+ P  P     P P     P  P  P  P  +PP P  P P
Sbjct: 168 PPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSP 227

Query: 222 E-PPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
             PP+ P  P   PPPP  P P P PP   P S
Sbjct: 228 RPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPS 260

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 35/90 (38%), Positives = 40/90 (44%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P     P+ P  P     P+P  P  P     P +P   PP PP P+P
Sbjct: 188 PPPSPPPSPPPSPPPSPPPRPPPSPNPPS-PRPPSPSPPSPRPPPRRPPFPPPSPPPPRP 246

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P      P PPP   P P PPP +P
Sbjct: 247 PPPAPPPPRPPPPSPPPPLPPPPSPPPPLP 276

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 39/109 (35%), Positives = 42/109 (38%), Gaps = 19/109 (17%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPPE 212
           PPPPP P  P  P     P  P  P     P P     P  P +P     P   P PPP 
Sbjct: 144 PPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPS 203

Query: 213 PKPEPPKEPEKPKEKPP----------------PPPQPQPMPQPPPHIP 311
           P P PP  P  P  +PP                PPP P P P+PPP  P
Sbjct: 204 PPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPP-PRPPPPAP 251

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 40/95 (42%), Positives = 44/95 (46%), Gaps = 2/95 (2%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKP-KEPEKPKEKPPPPPE 212
           L PPP P P  P  P  P     P  P     P+P KP  P  P   P  P   PP PP 
Sbjct: 265 LPPPPSPPPPLPPPPSPPPPSPPPPSPLPPS-PRPPKPSPPNNPFPRPPPPNPPPPRPPP 323

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQP-MPQPPPHIPA 314
           P P PP+ P  P   PP PP P P  P+PPP  P+
Sbjct: 324 PSPNPPRPPP-PSPPPPRPPPPSPNPPRPPPPSPS 357

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 37/92 (40%), Positives = 40/92 (43%), Gaps = 1/92 (1%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP-EKPKEKPPPPPEPKP 221
           PPPP P  P  P  P  P  P  P     P   +P +P  P  P  +P    PPPP P P
Sbjct: 266 PPPPSPPPPLPP--PPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPP 323

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
             P  P  P   PPPP  P P P PP   P S
Sbjct: 324 PSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPS 355

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 38/91 (41%), Positives = 41/91 (45%), Gaps = 1/91 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK-EPEKPKEPEKPKEKPPPPPEPK 218
           P PPP    P  P  P+ P     P     P P  P   P KP  P  P  +PPPP  P 
Sbjct: 259 PSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPP 318

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P PP  P  P    PPPP P P P+PPP  P
Sbjct: 319 PRPP--PPSPNPPRPPPPSPPP-PRPPPPSP 346

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 37/94 (39%), Positives = 38/94 (40%), Gaps = 2/94 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P+ P     P  P     P P  P     P  P  P   PP P  PKP
Sbjct: 242 PPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKP 301

Query: 222 EPPKE--PEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            PP    P  P   PPPP  P P P PP   P S
Sbjct: 302 SPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPS 335

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 35/91 (38%), Positives = 39/91 (42%), Gaps = 1/91 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPK-EPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           PPP P P  P  P   P  P+ P +      P P  P+ P     P +P    PPPP P 
Sbjct: 208 PPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPP 267

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P  P  P  P   PPPP  P P P PP   P
Sbjct: 268 PPSPPPPLPPPPSPPPPSPPPPSPLPPSPRP 298

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 37/94 (39%), Positives = 39/94 (41%), Gaps = 4/94 (4%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPP----PP 209
           PPP P P  P  P  P     P  P     P P  P  P  P  P  P   PPP    PP
Sbjct: 237 PPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPP--PPLPPPPSPPPPSPPPPSPLPP 294

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P+P  P  P  P  +PPPP  P P P PP   P
Sbjct: 295 SPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNP 328

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 40/91 (43%), Gaps = 2/91 (2%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQE-KPKPKKPKEPEKPK-EPEKPKEKPPPPPEPK 218
           P PPKP  P  P     P  P  P+     P P +P  P  P   P  P   PP PP P 
Sbjct: 296 PRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPS 355

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P PPK P  P   P PP +P   P+ PP  P
Sbjct: 356 PSPPKPPPPPSPPPRPPRRPPRPPRRPPTAP 386

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 36/90 (40%), Positives = 44/90 (48%), Gaps = 1/90 (1%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPK-EPEKPKEKPPPPPEPKP 221
           PP P+P +P  P  P  P+ P       +P P  P  P  P   P  P+  PP P  P+P
Sbjct: 293 PPSPRPPKPSPPNNPF-PRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRP 351

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  PK  PPP P P+P P+ PP  P
Sbjct: 352 -PPPSPSPPKPPPPPSPPPRP-PRRPPRPP 379

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 36/96 (37%), Positives = 40/96 (41%), Gaps = 7/96 (7%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP--- 215
           PPP +       + P  P  P  P     P    P  P  P+ P  P   PPPPP+P   
Sbjct: 24  PPPRRSPVVALVETPAAPP-PGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLP 82

Query: 216 ----KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
                P PP  P  P   PPPPP P P P PPP  P
Sbjct: 83  PSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPP 118

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 37/100 (37%), Positives = 41/100 (41%), Gaps = 11/100 (11%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEP-EKPKEPEKPKEKPPPPPEPKP 221
           P PP  + P  P  P  P+ P       +P P  P  P   P  P  P   PP PP P P
Sbjct: 227 PRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSP 286

Query: 222 EPPK----EPEKPKEKPP------PPPQPQPMPQPPPHIP 311
            PP      P  PK  PP      PPP   P P+PPP  P
Sbjct: 287 PPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSP 326

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 35/94 (37%), Positives = 41/94 (43%), Gaps = 5/94 (5%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PP P+P  P +P  P     P +P     P P+ P     P  P  P   PP PP P P 
Sbjct: 224 PPSPRPP-PRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPP 282

Query: 225 PPKEPE----KPKEKPPPPPQP-QPMPQPPPHIP 311
           PP  P      P  +PP P  P  P P+PPP  P
Sbjct: 283 PPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNP 316

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 34/86 (39%), Positives = 38/86 (44%)
 Frame = +3

Query: 54  PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPK 233
           P  K P +    V   E         P P  P     P  P  P+  PPPPP P P PP+
Sbjct: 20  PARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPP-PPPPQ 78

Query: 234 EPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P  P   PPPPP P P+P PPP  P
Sbjct: 79  PPLPPSPSPPPPP-PPPVPPPPPPPP 103

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 25/65 (38%), Positives = 28/65 (43%), Gaps = 2/65 (3%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPV-KPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           PPP P P  P  P  P  +P  P   P     P P  PK P  P  P +P  +PP PP  
Sbjct: 322 PPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSPPPRPPRRPPRPPRR 381

Query: 216 KPEPP 230
            P  P
Sbjct: 382 PPTAP 386

[36][TOP]
>UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q0P2_IXOSC
          Length = 170

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 42/92 (45%), Positives = 43/92 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 12  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            PP  P  P   PPPPP P P P PPP +  S
Sbjct: 72  PPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTS 103

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 61  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 62  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 63  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 64  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 5   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 65  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 6   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 66  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 7   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 67  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 8   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 68  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 9   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 69  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 35/86 (40%), Positives = 37/86 (43%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 29  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPP 299
            PP         PPPPP P+ +   P
Sbjct: 89  PPP---------PPPPPPPRLVTSRP 105

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 32/84 (38%), Positives = 36/84 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 33  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQ 293
            PP  P     +P      +P+P+
Sbjct: 93  PPPPPPRLVTSRPLSALFARPVPR 116

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 35/102 (34%), Positives = 39/102 (38%), Gaps = 12/102 (11%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 37  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96

Query: 222 EPPKEPEKPKEKPPPPPQPQ------------PMPQPPPHIP 311
            P     +P       P P+            P P+PP + P
Sbjct: 97  PPRLVTSRPLSALFARPVPRDLREMVWSGGDSPAPEPPFYAP 138

[37][TOP]
>UniRef100_A9PFE4 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
           RepID=A9PFE4_POPTR
          Length = 206

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 53/104 (50%), Positives = 60/104 (57%)
 Frame = +3

Query: 9   CGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK 188
           C   K+++ +E   P KPK PEKPKEP KP +PEK           PKEPEKPKEPEKPK
Sbjct: 63  CKGGKAVKCIEIKVPEKPKPPEKPKEPEKPNQPEK-----------PKEPEKPKEPEKPK 111

Query: 189 EKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPASC 320
           E   PPP PKP P         KP PPP   P+P PPP  P +C
Sbjct: 112 E---PPPAPKPAP---------KPAPPP---PVPCPPPVYPRTC 140

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 46/82 (56%), Positives = 53/82 (64%), Gaps = 1/82 (1%)
 Frame = +3

Query: 69  PEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK-PEPPKEPEK 245
           PEK K  +  K  +  K  E   P+KPK PEKPKEPEKP +    P +PK PE PKEPEK
Sbjct: 54  PEKIKNKICCKGGKAVKCIEIKVPEKPKPPEKPKEPEKPNQ----PEKPKEPEKPKEPEK 109

Query: 246 PKEKPPPPPQPQPMPQPPPHIP 311
           PKE PPP P+P P P PPP +P
Sbjct: 110 PKE-PPPAPKPAPKPAPPPPVP 130

[38][TOP]
>UniRef100_Q31F57 TonB protein n=1 Tax=Thiomicrospira crunogena XCL-2
           RepID=Q31F57_THICR
          Length = 285

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 45/90 (50%), Positives = 58/90 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 67  EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 125

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           PEP  EP KP+ KP P P+P+P P+P P +
Sbjct: 126 PEPKPEP-KPEPKPEPKPEPKPEPKPEPKL 154

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 51  EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 109

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 110 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 136

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 55  EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 113

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 114 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 140

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 59  EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 117

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 118 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 144

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 63  EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 121

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 122 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 148

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 45/91 (49%), Positives = 60/91 (65%), Gaps = 1/91 (1%)
 Frame = +3

Query: 33  ILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           + +P P P+PK   KP EP KP+   +PK + KP+PK   +PE   EP KP+ KP P PE
Sbjct: 47  VTQPEPKPEPKPEPKP-EP-KPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPE 103

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PKPEP  EP+ +PK +P P P+P+P P+P P
Sbjct: 104 PKPEPKPEPKPEPKPEPKPEPKPEPKPEPKP 134

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 44/95 (46%), Positives = 59/95 (62%), Gaps = 2/95 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 71  EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 129

Query: 219 PEPPKEPE-KPKEKPPPPPQPQP-MPQPPPHIPAS 317
           PEP  EP+ +PK +P P P+P+P +   P   PA+
Sbjct: 130 PEPKPEPKPEPKPEPKPEPKPEPKLDSQPVETPAT 164

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 44/91 (48%), Positives = 54/91 (59%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+PK PE   EP KP+   +PK + KP+PK   +PE PK   KP+ KP P PEPK
Sbjct: 81  KPEPKPEPK-PEPKPEP-KPEPKPEPKPEPKPEPKPEPKPE-PKPEPKPEPKPEPKPEPK 137

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PEP  EP KP+ KP P    QP+  P    P
Sbjct: 138 PEPKPEP-KPEPKPEPKLDSQPVETPATKQP 167

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 37/83 (44%), Positives = 48/83 (57%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 87  EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 145

Query: 219 PEPPKEPEKPKEKPPPPPQPQPM 287
           PEP  EP+   +    P   QP+
Sbjct: 146 PEPKPEPKLDSQPVETPATKQPI 168

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 38/89 (42%), Positives = 48/89 (53%), Gaps = 3/89 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK    PE PK   KP+ KP P PEPK
Sbjct: 95  EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPK----PE-PKPEPKPEPKPEPKPEPK 149

Query: 219 PEPPKEP---EKPKEKPPPPPQPQPMPQP 296
           PEP  +    E P  K P   + +  P P
Sbjct: 150 PEPKLDSQPVETPATKQPIVKKERRRPNP 178

[39][TOP]
>UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7PKI2_IXOSC
          Length = 154

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 61  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 62  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 3   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 63  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 4   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 64  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 5   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 65  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 6   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 66  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 7   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 67  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 8   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 68  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 9   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 69  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 10  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 70  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 11  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 71  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 12  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 72  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 13  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 73  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 14  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 74  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 15  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 75  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 16  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 76  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 42/90 (46%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 17  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 77  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 40/90 (44%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 23  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P    H+P
Sbjct: 83  PPPPPPPPPPPPPPPPPPPPPPPPQREHLP 112

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 38/85 (44%), Positives = 40/85 (47%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 30  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQP 296
            PP  P  P   PPPPPQ + +P P
Sbjct: 90  PPPPPPPPPPPPPPPPPQREHLPVP 114

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 39/87 (44%), Positives = 39/87 (44%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 28  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PP  P  P   PPPPP PQ    P P
Sbjct: 88  PPPPPPPPPPPPPPPPPPPQREHLPVP 114

[40][TOP]
>UniRef100_UPI0000E45EA3 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus
           purpuratus RepID=UPI0000E45EA3
          Length = 267

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 93  EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 151

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 152 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 178

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 97  EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 155

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 156 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 182

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 101 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 159

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 160 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 186

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 105 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 163

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 164 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 190

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 109 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 167

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 168 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 194

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 113 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 171

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 172 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 198

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 117 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 175

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 176 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 202

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 121 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 179

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 180 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 206

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 125 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 183

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 184 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 210

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 129 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 187

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 188 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 214

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 133 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 191

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 192 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 218

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 46/91 (50%), Positives = 58/91 (63%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 137 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 195

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PEP  EP KP+ KP P P+P+P P+P   IP
Sbjct: 196 PEPKPEP-KPEPKPEPKPEPKPEPKPNFFIP 225

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 47/96 (48%), Positives = 63/96 (65%), Gaps = 1/96 (1%)
 Frame = +3

Query: 18  IKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKP 197
           IK ++  +P P P+PK   KP EP KP+   +PK + KP+PK   +PE   EP KP+ KP
Sbjct: 84  IKVVKSEKPEPKPEPKPEPKP-EP-KPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKP 140

Query: 198 PPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            P PEPKPEP  EP+ +PK +P P P+P+P P+P P
Sbjct: 141 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKP 176

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 44/94 (46%), Positives = 56/94 (59%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP 200
           + IEI++P      K   K K  V   E  +PK + KP+PK   +PE   EP KP+ KP 
Sbjct: 68  QEIEIVDPF-----KGNYKLKIKVVKSEKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPE 121

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P PEPKPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 122 PKPEPKPEPKPEP-KPEPKPEPKPEPKPEPKPEP 154

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 36/79 (45%), Positives = 46/79 (58%), Gaps = 6/79 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 157 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 215

Query: 219 PEP------PKEPEKPKEK 257
           PEP      PK  + P+ K
Sbjct: 216 PEPKPNFFIPKNEDIPEAK 234

[41][TOP]
>UniRef100_C0MEM5 Putative cell surface-anchored protein n=1 Tax=Steptococcus equi
           subsp. zooepidemicus H70 RepID=C0MEM5_STRS7
          Length = 411

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 239 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 297

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 298 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 324

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 243 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 301

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 302 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 328

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 247 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 305

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 306 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 332

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 251 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 309

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 310 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 336

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 255 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 313

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 314 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 340

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 259 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 317

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 318 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 344

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 263 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 321

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 322 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 348

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 45/88 (51%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 267 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 325

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 326 PEPKPEP-KPEPKPEPKPEPKPEPKPEP 352

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 44/87 (50%), Positives = 56/87 (64%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPKP
Sbjct: 236 PKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPKP 294

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP  EP KP+ KP P P+P+P P+P P
Sbjct: 295 EPKPEP-KPEPKPEPKPEPKPEPKPEP 320

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 45/91 (49%), Positives = 57/91 (62%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 271 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 329

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PEP  EP KP+ KP P P+P+P P+P    P
Sbjct: 330 PEPKPEP-KPEPKPEPKPEPKPEPKPEAKKP 359

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 43/88 (48%), Positives = 54/88 (61%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 279 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 337

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+ +   QP P
Sbjct: 338 PEPKPEP-KPEPKPEPKPEAKKPEQPKP 364

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/87 (48%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE PK   KP+ KP P PEPK
Sbjct: 283 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPE-PKPEPKPEPKPEPKPEPK 341

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           PEP  EP+ +PK +   P QP+PM +P
Sbjct: 342 PEPKPEPKPEPKPEAKKPEQPKPMTKP 368

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 44/95 (46%), Positives = 56/95 (58%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPK
Sbjct: 275 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPK 333

Query: 219 PEPPKEPE-KPKEKPPPPPQP------QPMPQPPP 302
           PEP  EP+ +PK +P P P+P      QP P   P
Sbjct: 334 PEPKPEPKPEPKPEPKPEPKPEAKKPEQPKPMTKP 368

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/96 (44%), Positives = 57/96 (59%), Gaps = 3/96 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   +PK + KP+PK   +PE PK   KP+ KP P PEPK
Sbjct: 287 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPE-PKPEPKPEPKPEPKPEPK 345

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMP---QPPPHIPAS 317
           PEP  EP KP+ K P  P+P   P   +P   +P++
Sbjct: 346 PEPKPEP-KPEAKKPEQPKPMTKPGAKKPEQSLPST 380

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 39/77 (50%), Positives = 50/77 (64%)
 Frame = +3

Query: 72  EKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPK 251
           + PK   KP+   +PK + KP+PK   +PE   EP KP+ KP P PEPKPEP  EP KP+
Sbjct: 234 DTPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPKPEPKPEP-KPE 291

Query: 252 EKPPPPPQPQPMPQPPP 302
            KP P P+P+P P+P P
Sbjct: 292 PKPEPKPEPKPEPKPEP 308

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 40/77 (51%), Positives = 49/77 (63%)
 Frame = +3

Query: 72  EKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPK 251
           EK K      +PE PK + KP+PK   +PE   EP KP+ KP P PEPKPEP  EP KP+
Sbjct: 227 EKLKHCQDTPKPE-PKPEPKPEPKPEPKPEPKPEP-KPEPKPEPKPEPKPEPKPEP-KPE 283

Query: 252 EKPPPPPQPQPMPQPPP 302
            KP P P+P+P P+P P
Sbjct: 284 PKPEPKPEPKPEPKPEP 300

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 33/81 (40%), Positives = 45/81 (55%), Gaps = 7/81 (8%)
 Frame = +3

Query: 81  KEPVKPKEPEKPKEQEKPKPKKPKE-PEKPKEPEKPKE-----KPPPPPEPKPEPPKEPE 242
           +E +  +   K  +QE+   K  KE  E   + EK K      KP P PEPKPEP  EP+
Sbjct: 194 QEKLNAELQAKLAKQEELNAKLQKEIDELNAQLEKLKHCQDTPKPEPKPEPKPEPKPEPK 253

Query: 243 -KPKEKPPPPPQPQPMPQPPP 302
            +PK +P P P+P+P P+P P
Sbjct: 254 PEPKPEPKPEPKPEPKPEPKP 274

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 27/68 (39%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   +PK   KP+   +PK + KP+PK + K+PE+PK   KP  K P    P
Sbjct: 319 EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEAKKPEQPKPMTKPGAKKPEQSLP 378

Query: 216 KPEPPKEP 239
                + P
Sbjct: 379 STGDIRNP 386

[42][TOP]
>UniRef100_Q01979 Proline-rich protein n=1 Tax=Triticum aestivum RepID=Q01979_WHEAT
          Length = 378

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 46/88 (52%), Positives = 56/88 (63%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP EP KP+    PK   KP+ + +P PK   +PE   EP KP+ KP P PEPK
Sbjct: 150 EPKPEPKP-EPMKPEPKPMPKPEPKPEPKPEPMPKPEPKPEPKPEPIKPEPKPMPKPEPK 208

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP  PK +P P P+P+PMP+P P
Sbjct: 209 PEPKPEP-MPKPEPKPEPKPEPMPKPEP 235

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 43/88 (48%), Positives = 56/88 (63%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   KP+   +PK    PK + KP+PK P+   KP+   +PK +P P PEPK
Sbjct: 94  EPKPEPKPEPIPKPEPKPEPKPDPMPKPEPKPEPK-PEPMPKPEPKPEPKPEPMPKPEPK 152

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 153 PEPKPEPMKPEPKPMPKPEPKPEPKPEP 180

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 44/94 (46%), Positives = 57/94 (60%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK------KPKEPEKPKEPEKPKEKPP 200
           EP P PKP+   KP+   +PK    PK + KP+PK      +PK   KP+   +PK +P 
Sbjct: 122 EPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMKPEPKPMPKPEPKPEPKPEPM 181

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P PEPKPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 182 PKPEPKPEPKPEPIKPEPKPMPKPEPKPEPKPEP 215

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 46/92 (50%), Positives = 58/92 (63%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPP 209
           EP P P+PK   KP EP+KP+    PK + KP+PK    PK   KP+   +P  KP P P
Sbjct: 179 EPMPKPEPKPEPKP-EPIKPEPKPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKP 237

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 238 EPKPEPMPKPEPKPEPKPYPMPKPEPKPEPKP 269

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 45/96 (46%), Positives = 58/96 (60%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-------KPKEPEKPKEPEKPKEKP 197
           EP P PKP+   KP+   +PK    PK + KP+PK       +PK   KP+   KP+ KP
Sbjct: 234 EPKPEPKPEPMPKPEPKPEPKPYPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKP 293

Query: 198 PPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            P PEPKPEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 294 EPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKP 329

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 44/89 (49%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KP+   KP+   +PK + KP+P    EP+   +PE P  KP P PEPK
Sbjct: 270 EPMPKPEPKPEPKPEPMPKPEPKPEPKPEPKPEPMPKPEPKPEPKPE-PMPKPEPKPEPK 328

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE KPK  P P P+P+PMP+P P
Sbjct: 329 PEPMPKPEPKPKPLPKPEPKPEPMPKPEP 357

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 44/92 (47%), Positives = 55/92 (59%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP+   KP+   +PK    PK + KP+PK    PK   KP+   +P  KP P P
Sbjct: 220 EPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPYPMPKPEPKPEPKPEPMPKPEPKP 279

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE KP+ KP P P+P P P+P P
Sbjct: 280 EPKPEPMPKPEPKPEPKPEPKPEPMPKPEPKP 311

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 44/92 (47%), Positives = 57/92 (61%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE---KPKEPEKPKEKPPPPP 209
           EP P PKP+   KP+   +PK    PK + KP+PK   +PE   KP+   +PK +P P P
Sbjct: 262 EPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKP 321

Query: 210 EPKPEPPKEP-EKPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP  KP+ KP P P+P+P P+P P
Sbjct: 322 EPKPEPKPEPMPKPEPKPKPLPKPEPKPEPMP 353

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 43/94 (45%), Positives = 58/94 (61%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE---KPKEPEKPKEKPPPPP 209
           EP P PKP+   KP+   +PK   KP+   KP+PK   +PE   KP+   +PK +P P P
Sbjct: 276 EPKPEPKPEPMPKPEPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKP 335

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           EPKP+P  +PE   +P  KP P P+P+P P+PPP
Sbjct: 336 EPKPKPLPKPEPKPEPMPKPEPKPEPEPKPEPPP 369

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 44/92 (47%), Positives = 55/92 (59%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP+   KP+   +PK    PK + KP+PK    PK   KP+    P  KP P P
Sbjct: 206 EPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPYPMPKPEPKP 265

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 266 EPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKP 297

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 44/92 (47%), Positives = 54/92 (58%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP    KP+   +PK    PK + KP+PK    PK   KP+   +PK +P P P
Sbjct: 248 EPKPEPKPYPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPKPEPMPKP 307

Query: 210 EPKPEPPKEP-EKPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP  KP+ KP P P+P P P+P P
Sbjct: 308 EPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKP 339

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 44/94 (46%), Positives = 56/94 (59%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P PKP+   +PK    PK   KP+ + +P PK   +PE   EP KP+ KP P PEPK
Sbjct: 114 KPDPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMKPEPKPMPKPEPK 173

Query: 219 PEPPKEP-----EKPKEKPPP-PPQPQPMPQPPP 302
           PEP  EP      KP+ KP P  P+P+PMP+P P
Sbjct: 174 PEPKPEPMPKPEPKPEPKPEPIKPEPKPMPKPEP 207

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = +3

Query: 30  EILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPP-- 203
           E ++P P P PK   KP+   +P    +PK + KP+P KP+    PK   KP+ KP P  
Sbjct: 158 EPMKPEPKPMPKPEPKPEPKPEPMPKPEPKPEPKPEPIKPEPKPMPKPEPKPEPKPEPMP 217

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PEPKPEP  EP  PK +P P P+P+PMP+P P
Sbjct: 218 KPEPKPEPKPEP-MPKPEPKPEPKPEPMPKPEP 249

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 44/92 (47%), Positives = 54/92 (58%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP+   KP+    PK    PK + KP+PK    PK   KP+    P  KP P P
Sbjct: 66  EPKPLPKPEPMPKPEPKPLPKPEPMPKPEPKPEPKPEPIPKPEPKPEPKPDPMPKPEPKP 125

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 126 EPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKP 157

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/90 (48%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPK-EQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           EP P P+PK   KP+   KP+   +PK E  KP+PK   +PE   EP+ +P  KP P PE
Sbjct: 130 EPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMKPEPKPMPKPEPKPEPKPEPMPKPEPKPE 189

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PKPEP K   KP  KP P P+P+P P P P
Sbjct: 190 PKPEPIKPEPKPMPKPEPKPEPKPEPMPKP 219

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 45/93 (48%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP+   KP+   +PK    PK + KP+PK    PK   KP+   +P  KP P P
Sbjct: 80  EPKPLPKPEPMPKPEPKPEPKPEPIPKPEPKPEPKPDPMPKPEPKPEPKPEPMPKPEPKP 139

Query: 210 EPKPEPPKEPE-KPKEKPPP-PPQPQPMPQPPP 302
           EPKPEP  +PE KP+ KP P  P+P+PMP+P P
Sbjct: 140 EPKPEPMPKPEPKPEPKPEPMKPEPKPMPKPEP 172

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 46/93 (49%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-EPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   KP+   +PK EP KP+ +  PKP+   EP KP+   KP+ KP P PEP
Sbjct: 136 EPKPEPKPEPMPKPEPKPEPKPEPMKPEPKPMPKPEPKPEP-KPEPMPKPEPKPEPKPEP 194

Query: 216 -KPEP---PKEPEKPKEKPPPPPQPQPMPQPPP 302
            KPEP   PK   KP+ KP P P+P+P P+P P
Sbjct: 195 IKPEPKPMPKPEPKPEPKPEPMPKPEPKPEPKP 227

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 45/103 (43%), Positives = 56/103 (54%), Gaps = 4/103 (3%)
 Frame = +3

Query: 6   GCGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEP 176
           G G  + +   EP P P P+   +PK    PK    PK + KP PK    PK   KP   
Sbjct: 27  GRGLAEKLPEPEPKPTPYPEPKPQPKPEPMPKPEPMPKPEPKPLPKPEPMPKPEPKPLPK 86

Query: 177 EKPKEKPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            +P  KP P PEPKPEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 87  PEPMPKPEPKPEPKPEPIPKPEPKPEPKPDPMPKPEPKPEPKP 129

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/94 (44%), Positives = 55/94 (58%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-----KPKEPEKPKEPEKPKEKPPP 203
           EP P PKP+   KP+   KP+    PK +  PKP+     KP+   KP+   +PK +P P
Sbjct: 46  EPKPQPKPEPMPKPEPMPKPEPKPLPKPEPMPKPEPKPLPKPEPMPKPEPKPEPKPEPIP 105

Query: 204 PPEPKPEPPKEP-EKPKEKPPPPPQPQPMPQPPP 302
            PEPKPEP  +P  KP+ KP P P+P P P+P P
Sbjct: 106 KPEPKPEPKPDPMPKPEPKPEPKPEPMPKPEPKP 139

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 41/96 (42%), Positives = 58/96 (60%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEK---PKEPEKPKEKPPPPP 209
           EP P P+PK   KP+   KP+   +PK +  PKP+   EP+    PK   KP+ KP P P
Sbjct: 214 EPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPYPMPKPEPKPEPKPEPMP 273

Query: 210 EPKPEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
           +P+P+P  +PE     +PK +P P P+P+PMP+P P
Sbjct: 274 KPEPKPEPKPEPMPKPEPKPEPKPEPKPEPMPKPEP 309

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 42/87 (48%), Positives = 53/87 (60%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +P    +PK   KP+   KP+PK   +PE   +PE PK KP P PEPK
Sbjct: 290 EPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPE-PKPKPLPKPEPK 348

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           PEP  +PE PK +P P P+P P  +PP
Sbjct: 349 PEPMPKPE-PKPEPEPKPEPPPKGKPP 374

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/89 (48%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-EPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   KP+   +PK EP KP+ +  PKP+   EP KP+   KP+ KP P PEP
Sbjct: 171 EPKPEPKPEPMPKPEPKPEPKPEPIKPEPKPMPKPEPKPEP-KPEPMPKPEPKPEPKPEP 229

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P+P  +PE PK +P P P+P+P P+P P
Sbjct: 230 MPKPEPKPE-PKPEPMPKPEPKPEPKPYP 257

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 42/96 (43%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEK---PKEPEKPKEKPPPPP 209
           EP P P+PK   KP    KP+   +PK +  PKP+   EP+    PK   KP+ KP P P
Sbjct: 242 EPMPKPEPKPEPKPYPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPKP 301

Query: 210 EPKPEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
           EP P+P  +PE      PK +P P P+P+PMP+P P
Sbjct: 302 EPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEP 337

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 41/92 (44%), Positives = 56/92 (60%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEK---PKEPEKPKEKPPPPP 209
           EP P P+PK   KP+   KP+    PK +  PKP+   EP+    PK   KP+ KP P P
Sbjct: 60  EPMPKPEPKPLPKPEPMPKPEPKPLPKPEPMPKPEPKPEPKPEPIPKPEPKPEPKPDPMP 119

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+P+P  +PE  PK +P P P+P+PMP+P P
Sbjct: 120 KPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEP 151

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 41/96 (42%), Positives = 56/96 (58%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEK---PKEPEKPKEKPPPPP 209
           EP P P+PK   KP+   KP+   +PK    PKP+   EP+    PK   KP+ KP P P
Sbjct: 228 EPMPKPEPKPEPKPEPMPKPEPKPEPKPYPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMP 287

Query: 210 EPKPEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
           +P+P+P  +PE      PK +P P P+P+PMP+P P
Sbjct: 288 KPEPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEP 323

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 43/92 (46%), Positives = 54/92 (58%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEK---PKEPEKPKEKPPP-P 206
           EP P P+PK   KP    KP+   +PK +  PKP+   EP+    PK   KP+ KP P  
Sbjct: 102 EPIPKPEPKPEPKPDPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMK 161

Query: 207 PEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEPKP P  EP KP+ KP P P+P+P P+P P
Sbjct: 162 PEPKPMPKPEP-KPEPKPEPMPKPEPKPEPKP 192

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 41/92 (44%), Positives = 53/92 (57%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP---EKPKEKPPPPP 209
           EP P PKP+   +PK    PK   KP+ + +P PK   +PE   EP    +PK +P P P
Sbjct: 198 EPKPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPYP 257

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            PKPEP  EP+ +P  KP P P+P+P P P P
Sbjct: 258 MPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKP 289

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 41/93 (44%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEK---PKEPEKPKEKPPPPP 209
           EP P P+PK   KP+   KP+   +PK +  PKP+   EP+    PK   KP+ KP P P
Sbjct: 74  EPMPKPEPKPLPKPEPMPKPEPKPEPKPEPIPKPEPKPEPKPDPMPKPEPKPEPKPEPMP 133

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPM-PQPPP 302
           +P+P+P  +PE  PK +P P P+P+PM P+P P
Sbjct: 134 KPEPKPEPKPEPMPKPEPKPEPKPEPMKPEPKP 166

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 41/86 (47%), Positives = 52/86 (60%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P PK   KP EP KP+   KP+ + +PKP+   +PE   EP+    KP P P PK
Sbjct: 112 EPKPDPMPKPEPKP-EP-KPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMKPEPKPMPK 169

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQP 296
           PEP  EP KP+  P P P+P+P P+P
Sbjct: 170 PEPKPEP-KPEPMPKPEPKPEPKPEP 194

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 40/93 (43%), Positives = 52/93 (55%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-----KPKEPEKPKEPEKPKEKPPP 203
           +P P PKP+   KP+    PK    PK + KP PK     KP+   +PK    PK +P P
Sbjct: 52  KPEPMPKPEPMPKPEPKPLPKPEPMPKPEPKPLPKPEPMPKPEPKPEPKPEPIPKPEPKP 111

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P+P P P  EP KP+ KP P P+P+P P+P P
Sbjct: 112 EPKPDPMPKPEP-KPEPKPEPMPKPEPKPEPKP 143

[43][TOP]
>UniRef100_C5P993 Putative uncharacterized protein n=1 Tax=Coccidioides posadasii
           C735 delta SOWgp RepID=C5P993_COCP7
          Length = 841

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 46/92 (50%), Positives = 57/92 (61%), Gaps = 5/92 (5%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPK 218
           PPPPP P +PE P+EP KP+ P  P+   KP PK   EP++ ++PE KP+ KP P PEP 
Sbjct: 237 PPPPPPPPQPEPPREPPKPQRPPSPQPPPKPTPKPAPEPQQERKPEPKPEPKPEPKPEPG 296

Query: 219 PEPPKEPEKPKEKPPPPP----QPQPMPQPPP 302
            E    PE PK  P P P    +P+P PQPPP
Sbjct: 297 VEATPTPE-PKPVPKPEPRVETKPEPKPQPPP 327

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/96 (41%), Positives = 52/96 (54%), Gaps = 7/96 (7%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPP------ 203
           PPPP     P  P  P  P +PE P+E     P KP+ P  P+ P KP  KP P      
Sbjct: 225 PPPPRSHPSPPPPPPPPPPPQPEPPRE-----PPKPQRPPSPQPPPKPTPKPAPEPQQER 279

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
            PEPKPEP  EP+ +P  +  P P+P+P+P+P P +
Sbjct: 280 KPEPKPEPKPEPKPEPGVEATPTPEPKPVPKPEPRV 315

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 43/103 (41%), Positives = 56/103 (54%), Gaps = 10/103 (9%)
 Frame = +3

Query: 39  EPP-PPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EPP  PPKP+ P  P+ P KP     P+ Q++ KP +PK   KP+   +P  +  P PEP
Sbjct: 247 EPPREPPKPQRPPSPQPPPKPTPKPAPEPQQERKP-EPKPEPKPEPKPEPGVEATPTPEP 305

Query: 216 KPEPPKEPE---KPKEKPPPPPQ------PQPMPQPPPHIPAS 317
           KP P  EP    KP+ KP PPP+      P+P  + PP  P S
Sbjct: 306 KPVPKPEPRVETKPEPKPQPPPEPKQELKPEPKQEAPPSPPPS 348

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 36/91 (39%), Positives = 49/91 (53%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P+    P  P  P  P        P+P+ P+EP KP+ P  P+  P P P+P PE
Sbjct: 223 PPPPPPRSHPSPPPPPPPPPP--------PQPEPPREPPKPQRPPSPQPPPKPTPKPAPE 274

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
           P +E      KP P P+P+P P+P P + A+
Sbjct: 275 PQQE-----RKPEPKPEPKPEPKPEPGVEAT 300

[44][TOP]
>UniRef100_Q5LX13 PaxA, putative n=1 Tax=Ruegeria pomeroyi RepID=Q5LX13_SILPO
          Length = 456

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+PK EPE   EP    EPE KP+ + KP+P+   EPE   EPE KP+ +P P P
Sbjct: 161 EPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEP 220

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE +PK +P P P+P+P P+P P
Sbjct: 221 EPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEP 252

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+PK EPE   EP    EPE KP+ + KP+P+   EPE   EPE KP+ +P P P
Sbjct: 167 EPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEP 226

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE +PK +P P P+P+P P+P P
Sbjct: 227 EPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEP 258

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+PK EPE   EP    EPE KP+ + KP+P+   EPE   EPE KP+ +P P P
Sbjct: 173 EPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEP 232

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE +PK +P P P+P+P P+P P
Sbjct: 233 EPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEP 264

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 49/97 (50%), Positives = 62/97 (63%), Gaps = 3/97 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+PK EPE   EP    EPE KP+ + KP+P+   EPE   EPE KP+ +P P P
Sbjct: 179 EPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEP 238

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPASC 320
           EPKPEP  +PE P+ KP P P+P+P P+P P    +C
Sbjct: 239 EPKPEPEPKPE-PEPKPEPEPKPEPEPKPEPEPENAC 274

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 43/89 (48%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPK 218
           P P PKP+   KP+   KP+   KP+ + KP+P+   EPE   EPE KP+ +P P PEPK
Sbjct: 158 PEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPK 217

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE +PK +P P P+P+P P+P P
Sbjct: 218 PEPEPKPEPEPKPEPEPKPEPEPKPEPEP 246

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 43/89 (48%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPK 218
           P P P+PK   +PK   +PK   +PK + +PKP    EPE   EPE KP+ +P P PEPK
Sbjct: 156 PTPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKP----EPEPKPEPEPKPEPEPKPEPEPK 211

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE +PK +P P P+P+P P+P P
Sbjct: 212 PEPEPKPEPEPKPEPEPKPEPEPKPEPEP 240

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 38/74 (51%), Positives = 46/74 (62%), Gaps = 2/74 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+PK EPE   EP    EPE KP+ + KP+P+   EPE   EPE PK +P P PE
Sbjct: 203 EPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPE-PKPEPEPKPE 261

Query: 213 PKPEPPKEPEKPKE 254
           P+P+P  EPE   E
Sbjct: 262 PEPKPEPEPENACE 275

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +3

Query: 171 EPEKPKEKPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           E E     P P PEPKPEP  +PE +PK +P P P+P+P P+P P
Sbjct: 148 EVELDTGAPTPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEP 192

[45][TOP]
>UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium
           modesticaldum Ice1 RepID=B0TGJ1_HELMI
          Length = 256

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 43/93 (46%), Positives = 46/93 (49%)
 Frame = +3

Query: 33  ILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           I+ PPPPP P  P  P  P  P  P  P     P P  P  P +P  P  P   PPPPP 
Sbjct: 22  IIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPP 81

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P P PP  P  P   PPPPP P+P P PPP  P
Sbjct: 82  PPPPPPPPPPPPPPPPPPPP-PRPCPPPPPARP 113

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 43/97 (44%), Positives = 47/97 (48%), Gaps = 4/97 (4%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P+P  P  P  P  P  P   PPPPP P P
Sbjct: 34  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPP 93

Query: 222 EPPKEPEKPKEKPPPPP-QPQPMPQPPPH---IPASC 320
            PP  P  P+  PPPPP +P P P PP H   +P  C
Sbjct: 94  PPPPPPPPPRPCPPPPPARPCPPPCPPKHECGLPEPC 130

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 43/97 (44%), Positives = 45/97 (46%)
 Frame = +3

Query: 30  EILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP 209
           E + PPPPP P  P  P  P  P  P  P     P P  P  P  P  P +P   PPPPP
Sbjct: 20  ERIIPPPPPPPPPPPPPPPPPPPPPPPPP-----PPPPPPPPPPPPPPPPRPCPPPPPPP 74

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPASC 320
            P P PP  P      PPPPP P P P PPP  P  C
Sbjct: 75  PPPPPPPPPP------PPPPPPPPPPPPPPPPPPRPC 105

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 40/92 (43%), Positives = 42/92 (45%), Gaps = 3/92 (3%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEP---VKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           PP   PK P  P  P   + P  P  P     P P  P  P  P  P  P   PPPPP P
Sbjct: 5   PPTGYPKVPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           +P PP  P  P   PPPPP P P P PPP  P
Sbjct: 65  RPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 36/89 (40%), Positives = 41/89 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P+P
Sbjct: 45  PPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 104

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
            PP  P +P   P PP     +P+P P +
Sbjct: 105 CPPPPPARPCPPPCPPKHECGLPEPCPQV 133

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 32/64 (50%), Positives = 33/64 (51%)
 Frame = +3

Query: 129 KPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           KP    PK P  P  PE+    PPPPP P P PP  P  P   PPPPP P P P PPP  
Sbjct: 4   KPPTGYPKVPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63

Query: 309 PASC 320
           P  C
Sbjct: 64  PRPC 67

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 36/92 (39%), Positives = 40/92 (43%), Gaps = 2/92 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEK--PPPPPEP 215
           PPPPP P  P +P  P  P  P  P     P P  P  P  P  P  P     PPPP  P
Sbjct: 54  PPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARP 113

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P PP  P+     P P PQ +P+   P  IP
Sbjct: 114 CP-PPCPPKHECGLPEPCPQVEPIAGEPMPIP 144

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 32/86 (37%), Positives = 37/86 (43%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P+P  P  P +P  P  P +     PEP P
Sbjct: 72  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPCPPKHECGLPEPCP 131

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPP 299
           +      +P   PP  P P PMP  P
Sbjct: 132 QVEPIAGEPMPIPPCAPMPMPMPMEP 157

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 37/95 (38%), Positives = 40/95 (42%), Gaps = 5/95 (5%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK- 218
           PPPPP P  P  P  P  P  P  P     P P  P  P +P  P  P    PPP  PK 
Sbjct: 68  PPPPPPPPPPPPPPPPPPPPPPPPP-----PPPPPPPPPPRPCPPPPPARPCPPPCPPKH 122

Query: 219 ----PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
               PEP  + E    +P P P   PMP P P  P
Sbjct: 123 ECGLPEPCPQVEPIAGEPMPIPPCAPMPMPMPMEP 157

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/95 (37%), Positives = 40/95 (42%), Gaps = 9/95 (9%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKE-----PEKPKEKPPPP 206
           PPPPP P  P  P  P  P  P  P+    P P +P  P  P +     PE   +  P  
Sbjct: 78  PPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPCPPKHECGLPEPCPQVEPIA 137

Query: 207 PEPKPEPPKEPEKPKEKPPPP----PQPQPMPQPP 299
            EP P PP  P  P   P  P    P P PMP PP
Sbjct: 138 GEPMPIPPCAP-MPMPMPMEPIGRQPLPIPMPMPP 171

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 41/109 (37%), Positives = 45/109 (41%), Gaps = 16/109 (14%)
 Frame = +3

Query: 42  PPPPPK-PKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK------EPEKPKEPEKPKEKPP 200
           PPPPP  P  P  P  P  P  P +P     P P  PK      EP    EP   +  P 
Sbjct: 88  PPPPPPPPPPPPPPPRPCPPPPPARP----CPPPCPPKHECGLPEPCPQVEPIAGEPMPI 143

Query: 201 PPPEPKPEP-PKEP--EKPKEKPPPPPQPQPMP------QPPPHIPASC 320
           PP  P P P P EP   +P   P P P   PMP      +P  H PA C
Sbjct: 144 PPCAPMPMPMPMEPIGRQPLPIPMPMPPCAPMPVEPVAREPMEHRPAPC 192

[46][TOP]
>UniRef100_C5YTY7 Putative uncharacterized protein Sb08g008200 n=1 Tax=Sorghum
           bicolor RepID=C5YTY7_SORBI
          Length = 205

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 43/89 (48%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KP+   KP+   KP  + KPKPKKP+   KP+   +PK +P P PEP 
Sbjct: 107 EPKPEPQPKPITKPEPKPKPEPMPKPMPEPKPKPKKPEPKPKPEPKPEPKPEPEPKPEPL 166

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+P  +PE KPK +P P P+P+P P+P P
Sbjct: 167 PKPEPKPEPKPKPEPKPEPKPEPKPEPMP 195

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 47/92 (51%), Positives = 58/92 (63%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P P PK   KP+   KP    +PK + +P PK   EP+ KPK+PE PK KP P PEP
Sbjct: 97  EPHPEPSPKPEPKPEPQPKPITKPEPKPKPEPMPKPMPEPKPKPKKPE-PKPKPEPKPEP 155

Query: 216 KPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE   KP+ KP P P+P+P P+P P
Sbjct: 156 KPEPEPKPEPLPKPEPKPEPKPKPEPKPEPKP 187

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 41/91 (45%), Positives = 56/91 (61%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   +PK   KP+   KP+   KP P+   +P+KP+   KP+ KP P PEP+
Sbjct: 101 EPSPKPEPKPEPQPKPITKPEPKPKPEPMPKPMPEPKPKPKKPEPKPKPEPKPEPKPEPE 160

Query: 219 PEP---PKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+P   PK   KP+ KP P P+P+P P+P P
Sbjct: 161 PKPEPLPKPEPKPEPKPKPEPKPEPKPEPKP 191

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 39/87 (44%), Positives = 54/87 (62%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P PKP+   +PK   +PK    P+   KP+PK   +P+   +PE PK KP P P+P P
Sbjct: 76  PQPEPKPEPKPEPKPRPEPKTEPHPEPSPKPEPKPEPQPKPITKPE-PKPKPEPMPKPMP 134

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP  +P+KP+ KP P P+P+P P+P P
Sbjct: 135 EPKPKPKKPEPKPKPEPKPEPKPEPEP 161

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 48/95 (50%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKP 197
           K I   EP P P+P     P+   KPK+PE KPK + KP+PK   EPE PK    PK +P
Sbjct: 115 KPITKPEPKPKPEPMPKPMPEPKPKPKKPEPKPKPEPKPEPK--PEPE-PKPEPLPKPEP 171

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P P+PKPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 172 KPEPKPKPEPKPEP-KPEPKPEPMPKPKPEPKPEP 205

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 39/88 (44%), Positives = 53/88 (60%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +P+   +P     PK + KP+P+ PK   KP+   KP+  P P PEPK
Sbjct: 79  EPKPEPKPEPKPRPEPKTEPHPEPSPKPEPKPEPQ-PKPITKPEPKPKPEPMPKPMPEPK 137

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+P K   KPK +P P P+P+P P+P P
Sbjct: 138 PKPKKPEPKPKPEPKPEPKPEPEPKPEP 165

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 43/94 (45%), Positives = 56/94 (59%)
 Frame = +3

Query: 30  EILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP 209
           E+ +P P PKP EP+   +P+   EP   K + KP+PK   EP+    PE P  KP P P
Sbjct: 56  ELPQPEPQPKP-EPQPQPQPLPQPEP---KPEPKPEPKPRPEPKTEPHPE-PSPKPEPKP 110

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           EP+P+P  +PE PK KP P P+P P P+P P  P
Sbjct: 111 EPQPKPITKPE-PKPKPEPMPKPMPEPKPKPKKP 143

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 37/91 (40%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KP--KEKPPPPP 209
           EP P P+P    +PK   KP+   +P+ + +P P+   +PE   EP+ KP  K +P P P
Sbjct: 67  EPQPQPQPLPQPEPKPEPKPEPKPRPEPKTEPHPEPSPKPEPKPEPQPKPITKPEPKPKP 126

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP P+P  EP+   +KP P P+P+P P+P P
Sbjct: 127 EPMPKPMPEPKPKPKKPEPKPKPEPKPEPKP 157

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 40/92 (43%), Positives = 55/92 (59%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK---EPE-KPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP 206
           EP P P+PK    PE  PK   KP+   KP  + +PKPK    P+   EP+   +KP P 
Sbjct: 87  EPKPRPEPKTEPHPEPSPKPEPKPEPQPKPITKPEPKPKPEPMPKPMPEPKPKPKKPEPK 146

Query: 207 PEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+P+P+P  +PE P+ KP P P+P+P P+P P
Sbjct: 147 PKPEPKPEPKPE-PEPKPEPLPKPEPKPEPKP 177

[47][TOP]
>UniRef100_A2Y1S3 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2Y1S3_ORYSI
          Length = 360

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 46/91 (50%), Positives = 56/91 (61%), Gaps = 2/91 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP    KPK   +PK   KP+ + +PKP+ +PK   KPK   KP  KP P PEP
Sbjct: 115 EPKPEPKPYPEPKPKPKQEPKPEPKPEHKAEPKPEPEPKPYPKPKPEPKPGPKPEPKPEP 174

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPPH 305
           KP P  +PE KPK  P P P+P+P P+P PH
Sbjct: 175 KPHPEPKPEPKPKPVPHPEPKPEPKPEPKPH 205

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 45/95 (47%), Positives = 58/95 (61%), Gaps = 6/95 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P PKPK   KP+   +PK   KP  + KPKPK+  +PE KP+   +PK +P P P P
Sbjct: 97  EPKPEPKPKPEPKPEPKPEPKPEPKPYPEPKPKPKQEPKPEPKPEHKAEPKPEPEPKPYP 156

Query: 216 KPEP-----PKEPEKPKEKPPPPPQPQPMPQPPPH 305
           KP+P     PK   KP+ KP P P+P+P P+P PH
Sbjct: 157 KPKPEPKPGPKPEPKPEPKPHPEPKPEPKPKPVPH 191

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 48/99 (48%), Positives = 57/99 (57%), Gaps = 10/99 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP    KP+   +PK   KPK + KP+PK   +PE    PE KPK K  P PEP
Sbjct: 79  EPKPEPKPYPEPKPETKPEPKPEPKPKPEPKPEPKPEPKPEPKPYPEPKPKPKQEPKPEP 138

Query: 216 KPE----PPKEPE-----KPKEKPPPPPQPQPMPQPPPH 305
           KPE    P  EPE     KPK +P P P+P+P P+P PH
Sbjct: 139 KPEHKAEPKPEPEPKPYPKPKPEPKPGPKPEPKPEPKPH 177

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 45/91 (49%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P+PK   KP   +KP+   +PK   KP+PK   EPE   +PE PK +P P PEPKP
Sbjct: 192 PEPKPEPKPEPKPHPELKPEPKPEPKLHPKPEPKPHPEPEPKLKPE-PKPEPKPEPEPKP 250

Query: 222 EPPKEPE---KPKEKPPPPPQPQPMPQPPPH 305
           EP  EP+   KP  KP P P+P P P+P PH
Sbjct: 251 EPNPEPKPEPKPYPKPKPEPKPVPKPEPIPH 281

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 46/95 (48%), Positives = 57/95 (60%), Gaps = 6/95 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P PKP+   +PK   +PK   KPK + KP PK   +PE    PE   +PK KP P P
Sbjct: 133 EPKPEPKPEHKAEPKPEPEPKPYPKPKPEPKPGPKPEPKPEPKPHPEPKPEPKPKPVPHP 192

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQ--PMPQPPPH 305
           EPKPEP  EP+  P+ KP P P+P+  P P+P PH
Sbjct: 193 EPKPEPKPEPKPHPELKPEPKPEPKLHPKPEPKPH 227

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 45/97 (46%), Positives = 56/97 (57%), Gaps = 7/97 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-------KPKEPEKPKEKP 197
           EP P PKP+   KP+   +PK   KP  + KP+PK   +PE       KPK    PK +P
Sbjct: 237 EPKPEPKPEPEPKPEPNPEPKPEPKPYPKPKPEPKPVPKPEPIPHPGPKPKPKPDPKLEP 296

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
            P PEPKP P  EPE PK KP P P+P+P P+P P +
Sbjct: 297 KPHPEPKPHPMPEPE-PKPKPEPKPEPKPYPEPKPKL 332

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 47/103 (45%), Positives = 62/103 (60%), Gaps = 14/103 (13%)
 Frame = +3

Query: 36  LEPPPPPKPK-------EPE-KPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEK 182
           LEP P PKPK       +PE KP+   +PK   +PK + KP+PK   KPK   KP+   +
Sbjct: 56  LEPKPKPKPKPHPKHESKPEPKPEPKPEPKPYPEPKPETKPEPKPEPKPKPEPKPEPKPE 115

Query: 183 PKEKPPPPPEPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           PK +P P PEPKP+P +EP+   KP+ K  P P+P+P P P P
Sbjct: 116 PKPEPKPYPEPKPKPKQEPKPEPKPEHKAEPKPEPEPKPYPKP 158

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 44/94 (46%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK-----PKEPEKPKEPEKPKEKPPP 203
           EP P PKPK    P+   +PK   KP  + KP+PK      PK   KP    +PK KP P
Sbjct: 179 EPKPEPKPKPVPHPEPKPEPKPEPKPHPELKPEPKPEPKLHPKPEPKPHPEPEPKLKPEP 238

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            PEPKPEP  +PE  P+ KP P P P+P P+P P
Sbjct: 239 KPEPKPEPEPKPEPNPEPKPEPKPYPKPKPEPKP 272

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 42/98 (42%), Positives = 56/98 (57%), Gaps = 10/98 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---------KPKEPEKPKEPEKPKE 191
           EP P P+PK   KP+   +PK   +PK + KP+PK         KPK  ++PK   KP+ 
Sbjct: 83  EPKPYPEPKPETKPEPKPEPKPKPEPKPEPKPEPKPEPKPYPEPKPKPKQEPKPEPKPEH 142

Query: 192 KPPPPPEPKPEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           K  P PEP+P+P PK   +PK  P P P+P+P P P P
Sbjct: 143 KAEPKPEPEPKPYPKPKPEPKPGPKPEPKPEPKPHPEP 180

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 42/94 (44%), Positives = 55/94 (58%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKP-KKPKEPEKPKEPEKPKEKPPPPPEP 215
           +P P PKPK  ++PK   KP+   +PK + +PKP  KPK   KP    +PK +P P PEP
Sbjct: 121 KPYPEPKPKPKQEPKPEPKPEHKAEPKPEPEPKPYPKPKPEPKPGPKPEPKPEPKPHPEP 180

Query: 216 KPEPPKEP-----EKPKEKPPPPPQPQPMPQPPP 302
           KPEP  +P      KP+ KP P P P+  P+P P
Sbjct: 181 KPEPKPKPVPHPEPKPEPKPEPKPHPELKPEPKP 214

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 43/94 (45%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-----KPKEKPPP 203
           EP P PKP+   +PK   +PK   KPK    P+PK   +PE    PE     KP+ K  P
Sbjct: 161 EPKPGPKPEPKPEPKPHPEPKPEPKPKPVPHPEPKPEPKPEPKPHPELKPEPKPEPKLHP 220

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            PEPKP P  EP+ KP+ KP P P+P+P P+P P
Sbjct: 221 KPEPKPHPEPEPKLKPEPKPEPKPEPEPKPEPNP 254

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 41/91 (45%), Positives = 56/91 (61%), Gaps = 2/91 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+PK   KPK    P+   +PK + KP P+ KP+   +PK   KP+ KP P PEP
Sbjct: 173 EPKPHPEPKPEPKPKPVPHPEPKPEPKPEPKPHPELKPEPKPEPKLHPKPEPKPHPEPEP 232

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPPH 305
           K +P  +PE KP+ +P P P P+P P+P P+
Sbjct: 233 KLKPEPKPEPKPEPEPKPEPNPEPKPEPKPY 263

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPPP 209
           E PP  +PK   KPK   K +   +PK + KP+PK   +PK   KP+   +PK KP P P
Sbjct: 51  EKPPELEPKPKPKPKPHPKHESKPEPKPEPKPEPKPYPEPKPETKPEPKPEPKPKPEPKP 110

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP KP  +P P P+ +P P+P P
Sbjct: 111 EPKPEPKPEP-KPYPEPKPKPKQEPKPEPKP 140

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 46/97 (47%), Positives = 55/97 (56%), Gaps = 6/97 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKPK   KP    +P     PK + KP PK +PK   +PK    P+ +P P PEP
Sbjct: 259 EPKPYPKPKPEPKPVPKPEPIPHPGPKPKPKPDPKLEPKPHPEPKPHPMPEPEPKPKPEP 318

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQP----PPHIP 311
           KPEP   PE KPK KP P P P+P+  P    PPH+P
Sbjct: 319 KPEPKPYPEPKPKLKPEPKPGPKPIAPPKKHKPPHMP 355

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/91 (47%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           L P P PKP    +PK  +KP+   +PK + +PKP+   EP KP+    PK KP P P P
Sbjct: 218 LHPKPEPKPHPEPEPK--LKPEPKPEPKPEPEPKPEPNPEP-KPEPKPYPKPKPEPKPVP 274

Query: 216 KPEPPKEP-EKPKEKPPPPPQPQPMPQPPPH 305
           KPEP   P  KPK KP P  +P+P P+P PH
Sbjct: 275 KPEPIPHPGPKPKPKPDPKLEPKPHPEPKPH 305

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/94 (46%), Positives = 55/94 (58%), Gaps = 4/94 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPPP 209
           EP P P+PK   KPK   KP     PK + KP+PK   +PK   KPK    P+ KP P P
Sbjct: 145 EPKPEPEPKPYPKPKPEPKPG----PKPEPKPEPKPHPEPKPEPKPKPVPHPEPKPEPKP 200

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
           EPKP P  +PE KP+ K  P P+P+P P+P P +
Sbjct: 201 EPKPHPELKPEPKPEPKLHPKPEPKPHPEPEPKL 234

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 42/95 (44%), Positives = 54/95 (56%), Gaps = 8/95 (8%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-------KPKEKPP 200
           P P P+PK   KP+   +PK   +PK + KPKP    EP+   +PE       KP+ KP 
Sbjct: 156 PKPKPEPKPGPKPEPKPEPKPHPEPKPEPKPKPVPHPEPKPEPKPEPKPHPELKPEPKPE 215

Query: 201 PPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P   PKPEP   PE +PK KP P P+P+P P+P P
Sbjct: 216 PKLHPKPEPKPHPEPEPKLKPEPKPEPKPEPEPKP 250

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 41/90 (45%), Positives = 53/90 (58%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+   KP+   +PK   +PK +  P+PK +PK   KPK   KP  KP P P P
Sbjct: 223 EPKPHPEPEPKLKPEPKPEPKPEPEPKPEPNPEPKPEPKPYPKPKPEPKPVPKPEPIPHP 282

Query: 216 KPEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
            P+P PK   K + KP P P+P PMP+P P
Sbjct: 283 GPKPKPKPDPKLEPKPHPEPKPHPMPEPEP 312

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 40/90 (44%), Positives = 51/90 (56%), Gaps = 1/90 (1%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           L+P P P+PK   +PK    P+   +PK   KPKP+ PK   KP+    P  KP P P+P
Sbjct: 234 LKPEPKPEPKPEPEPKPEPNPEPKPEPKPYPKPKPE-PKPVPKPEPIPHPGPKPKPKPDP 292

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           K EP   PE KP   P P P+P+P P+P P
Sbjct: 293 KLEPKPHPEPKPHPMPEPEPKPKPEPKPEP 322

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 2/73 (2%)
 Frame = +3

Query: 93  KPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPKPEPPKEPEKPKEKPPP 266
           KP E E KPK + KP PK   +PE   EP+ +PK  P P PE KPEP  EP KPK +P P
Sbjct: 52  KPPELEPKPKPKPKPHPKHESKPEPKPEPKPEPKPYPEPKPETKPEPKPEP-KPKPEPKP 110

Query: 267 PPQPQPMPQPPPH 305
            P+P+P P+P P+
Sbjct: 111 EPKPEPKPEPKPY 123

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 34/78 (43%), Positives = 41/78 (52%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P PKP    +PK   +PK    P+ + KPKP+   EP+   EP KPK KP P P PKP
Sbjct: 284 PKPKPKPDPKLEPKPHPEPKPHPMPEPEPKPKPEPKPEPKPYPEP-KPKLKPEPKPGPKP 342

Query: 222 EPPKEPEKPKEKPPPPPQ 275
             P +  KP   PP   Q
Sbjct: 343 IAPPKKHKPPHMPPATNQ 360

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 33/81 (40%), Positives = 41/81 (50%), Gaps = 1/81 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEPK 218
           P P PKPK    PK   KP    KP    +P+PK   EP+ +PK   +PK K  P P+P 
Sbjct: 280 PHPGPKPKPKPDPKLEPKPHPEPKPHPMPEPEPKPKPEPKPEPKPYPEPKPKLKPEPKPG 339

Query: 219 PEPPKEPEKPKEKPPPPPQPQ 281
           P+P   P+K K    PP   Q
Sbjct: 340 PKPIAPPKKHKPPHMPPATNQ 360

[48][TOP]
>UniRef100_Q1E0Q2 Putative uncharacterized protein n=1 Tax=Coccidioides immitis
           RepID=Q1E0Q2_COCIM
          Length = 835

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 46/104 (44%), Positives = 61/104 (58%), Gaps = 12/104 (11%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPPE 212
           PPPPP P +PE P+EP KP+ P  P+   KP PK   EP++ ++PE   +P+ +  P PE
Sbjct: 239 PPPPPPPPQPEPPREPPKPQRPPSPQPPPKPTPKPAPEPQQERKPEPKPEPEVEATPTPE 298

Query: 213 PKPEPPKEPE---KPKEKPPPPPQ------PQPMPQPPPHIPAS 317
           PKP P  EP    KP+ KP PPP+      P+P  + PP  P S
Sbjct: 299 PKPVPKPEPRVETKPEPKPQPPPEPKQELKPEPKQEAPPSPPPS 342

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 42/99 (42%), Positives = 51/99 (51%), Gaps = 13/99 (13%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP--EPK 218
           PPPP P+    P  P  P  P  P+ +   +P KP+ P  P+ P KP  KP P P  E K
Sbjct: 223 PPPPPPRSHPSPPPPPPPPPPPPPQPEPPREPPKPQRPPSPQPPPKPTPKPAPEPQQERK 282

Query: 219 PEPPKEPE-----KPKEKPPPPPQ------PQPMPQPPP 302
           PEP  EPE      P+ KP P P+      P+P PQPPP
Sbjct: 283 PEPKPEPEVEATPTPEPKPVPKPEPRVETKPEPKPQPPP 321

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 39/96 (40%), Positives = 52/96 (54%), Gaps = 7/96 (7%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP    P  P  P  P  P        P+P+ P+EP KP+ P  P+  PPP P PKP
Sbjct: 223 PPPPPPRSHPSPPPPPPPPPPPP-------PQPEPPREPPKPQRPPSPQ--PPPKPTPKP 273

Query: 222 EP-PKEPEKPKEKP------PPPPQPQPMPQPPPHI 308
            P P++  KP+ KP       P P+P+P+P+P P +
Sbjct: 274 APEPQQERKPEPKPEPEVEATPTPEPKPVPKPEPRV 309

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 39/90 (43%), Positives = 53/90 (58%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EPP P +P  P+ P +P  PK   +P+++ KP+PK   E E    PE KP  KP P  E 
Sbjct: 253 EPPKPQRPPSPQPPPKPT-PKPAPEPQQERKPEPKPEPEVEATPTPEPKPVPKPEPRVET 311

Query: 216 KPEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP P+ P +PK++  P P+ +  P PPP
Sbjct: 312 KPEPKPQPPPEPKQELKPEPKQEAPPSPPP 341

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 35/90 (38%), Positives = 42/90 (46%), Gaps = 3/90 (3%)
 Frame = +3

Query: 42  PPPPPKPKEP--EKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP-PPPE 212
           PPP   P+ P  + P           P  Q  P    P  P     P  P   PP PPP 
Sbjct: 187 PPPNSGPQFPGGQYPGGQFPGGHQYYPGAQY-PGGHTPPPPPPRSHPSPPPPPPPPPPPP 245

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+PEPP+EP KP+  P P P P+P P+P P
Sbjct: 246 PQPEPPREPPKPQRPPSPQPPPKPTPKPAP 275

[49][TOP]
>UniRef100_C3ESF6 Cell surface protein n=1 Tax=Bacillus thuringiensis serovar kurstaki
            str. T03a001 RepID=C3ESF6_BACTK
          Length = 3302

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 52/107 (48%), Positives = 75/107 (70%), Gaps = 10/107 (9%)
 Frame = +3

Query: 21   KSIEILEPPPPP--KPKEPEKPKEP-VKPKEPEKPKEQEKPK-PKKPK-EPEKPKEPEKP 185
            + ++I E P  P  KP+EP++PKEP VKP+EP++PKE ++PK PK+P+ +PE PKEP++P
Sbjct: 3131 EDLKIPEEPKEPEVKPEEPKEPKEPEVKPEEPKEPKEPKEPKEPKEPEVKPEGPKEPKEP 3190

Query: 186  KEKPPPPPEP-----KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            + KP  P EP     KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3191 EVKPEDPKEPKEPEVKPEEPKEPKEPEVKPEDPKEPKE-PEVKPEEP 3236

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 52/98 (53%), Positives = 69/98 (70%), Gaps = 12/98 (12%)
 Frame = +3

Query: 54   PKPKE----PEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPEKPKEPEKPKEKPPPPPE 212
            PK KE    PE+PKEP VKP+EP++PKE E KP+ PK+PKEP++PKEP++P+ KP  P E
Sbjct: 3127 PKTKEDLKIPEEPKEPEVKPEEPKEPKEPEVKPEEPKEPKEPKEPKEPKEPEVKPEGPKE 3186

Query: 213  PK-----PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PK     PE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3187 PKEPEVKPEDPKEPKEPEVKPEEPKEPKE-PEVKPEDP 3223

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 50/107 (46%), Positives = 69/107 (64%), Gaps = 13/107 (12%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKE 191
            +K  E  EP  P  KP+EP++PKEP +PKEP++P E +   PK+PKEPE KP++P++PKE
Sbjct: 3144 VKPEEPKEPKEPEVKPEEPKEPKEPKEPKEPKEP-EVKPEGPKEPKEPEVKPEDPKEPKE 3202

Query: 192  --------KPPPPPEPKPEPPKEPEKPKEKPPPP---PQPQPMPQPP 299
                    K P  PE KPE PKEP++P+ KP  P    +P+  P+ P
Sbjct: 3203 PEVKPEEPKEPKEPEVKPEDPKEPKEPEVKPEEPKDLKKPEVKPEKP 3249

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 49/98 (50%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +3

Query: 36   LEPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPE-KPKEPEKPKE----KP 197
            LEP     PK  E  K P +PKEPE KP+E     PK+PKEPE KP+EP++PKE    K 
Sbjct: 3119 LEPTVTILPKTKEDLKIPEEPKEPEVKPEE-----PKEPKEPEVKPEEPKEPKEPKEPKE 3173

Query: 198  PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3174 PKEPEVKPEGPKEPKEPEVKPEDPKEPKE-PEVKPEEP 3210

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 41/80 (51%), Positives = 55/80 (68%), Gaps = 7/80 (8%)
 Frame = +3

Query: 48   PPPKPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEP---EKPKEKPPPP 206
            P  KP++P++PKEP VKP+EP++PKE E KP+ PK+PKEPE KP+EP   +KP+ KP  P
Sbjct: 3190 PEVKPEDPKEPKEPEVKPEEPKEPKEPEVKPEDPKEPKEPEVKPEEPKDLKKPEVKPEKP 3249

Query: 207  PEPKPEPPKEPEKPKEKPPP 266
                 +  KEP+   EK  P
Sbjct: 3250 EVRLEKLIKEPQVKVEKELP 3269

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/85 (43%), Positives = 52/85 (61%), Gaps = 9/85 (10%)
 Frame = +3

Query: 72   EKPKEPVKPKEPEKPKEQEKPK-PKKPKEPE-KPKEPEKPKEKPPPPPEPK-PEPPKEPE 242
            +K   P++P     PK +E  K P++PKEPE KP+EP++PKE    P EPK P+ PKEP+
Sbjct: 3113 DKINPPLEPTVTILPKTKEDLKIPEEPKEPEVKPEEPKEPKEPEVKPEEPKEPKEPKEPK 3172

Query: 243  KPKEK------PPPPPQPQPMPQPP 299
            +PKE       P  P +P+  P+ P
Sbjct: 3173 EPKEPEVKPEGPKEPKEPEVKPEDP 3197

[50][TOP]
>UniRef100_C3Y8Z5 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae
            RepID=C3Y8Z5_BRAFL
          Length = 1332

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 44/98 (44%), Positives = 53/98 (54%), Gaps = 7/98 (7%)
 Frame = +3

Query: 39   EPPPPPKPKEPEKPKEP-VKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPP 206
            +PPPPP P++   P  P ++  +P KP     PKP     P  P KP  P  PK  PPPP
Sbjct: 1222 KPPPPPPPRKQTTPPPPKIEKLKPPKPTPSPSPKPPPTPSPPSPPKPSPPAPPKPSPPPP 1281

Query: 207  PEPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPPHIP 311
            P+P P PP +P     PK  PPPPP+P P P P P  P
Sbjct: 1282 PKPSPPPPPKPSPPAPPKPSPPPPPKPSPPPPPKPSPP 1319

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/93 (47%), Positives = 49/93 (52%), Gaps = 6/93 (6%)
 Frame = +3

Query: 27   IEILEPPPP-----PKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPK 188
            IE L+PP P     PKP     P  P KP  P  PK    P PK  P  P KP  P  PK
Sbjct: 1240 IEKLKPPKPTPSPSPKPPPTPSPPSPPKPSPPAPPKPSPPPPPKPSPPPPPKPSPPAPPK 1299

Query: 189  EKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPM 287
              PPPPP+P P PP     PK  PPPPP+P+P+
Sbjct: 1300 PSPPPPPKPSPPPP-----PKPSPPPPPRPKPL 1327

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 44/111 (39%), Positives = 54/111 (48%), Gaps = 7/111 (6%)
 Frame = +3

Query: 3    KGCGAIKSIEILEPP-----PPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKP 167
            KG GA   +E+         P  K ++   P    KP  P  P++Q  P P K ++ + P
Sbjct: 1187 KGKGATSRVELYPGRLEKLFPGTKRRKIRGPTIQKKPPPPPPPRKQTTPPPPKIEKLKPP 1246

Query: 168  KEPEKPKEKPPPPPEPKPEPPK--EPEKPKEKPPPPPQPQPMPQPPPHIPA 314
            K    P  KPPP P P P PPK   P  PK  PPPPP+P P P P P  PA
Sbjct: 1247 KPTPSPSPKPPPTPSP-PSPPKPSPPAPPKPSPPPPPKPSPPPPPKPSPPA 1296

[51][TOP]
>UniRef100_C4ZJ39 Protein TolA n=1 Tax=Thauera sp. MZ1T RepID=C4ZJ39_THASP
          Length = 320

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 52/99 (52%), Positives = 61/99 (61%), Gaps = 11/99 (11%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-EPEKPKEQEKPK-----PKKPKEPEKPKEPEKPKEKPP 200
           EP P PKP+   +PK   KP+  PE PK Q KP+     P+K  EP KP EP KP+ KP 
Sbjct: 82  EPKPEPKPEPKPEPKPEPKPEPRPEPPKPQAKPEIVAKAPEKKPEPPKP-EPPKPEPKPQ 140

Query: 201 PPPEPKPEPPKEPE---KPKEKPPPPPQ--PQPMPQPPP 302
           P PEPKPEP  EP+   KP+ KP P PQ  P+P PQP P
Sbjct: 141 PKPEPKPEPKPEPKPQPKPEPKPEPKPQAKPEPKPQPKP 179

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 47/91 (51%), Positives = 56/91 (61%), Gaps = 5/91 (5%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKP----KEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPP 203
           EP P PKP+  PE PK   KP    K PEK  E  KP+P KP+   +PK   KP+ KP P
Sbjct: 94  EPKPEPKPEPRPEPPKPQAKPEIVAKAPEKKPEPPKPEPPKPEPKPQPKPEPKPEPKPEP 153

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQP 296
            P+PKPEP  EP KP+ KP P PQP+P  +P
Sbjct: 154 KPQPKPEPKPEP-KPQAKPEPKPQPKPDTKP 183

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 46/96 (47%), Positives = 58/96 (60%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKP--------KEPEKPKEPEKPKEK 194
           EP P PKP+   +PK   KP+   +PK + +P+P KP        K PEK  EP KP+  
Sbjct: 74  EPKPEPKPEPKPEPKPEPKPEPKPEPKPEPRPEPPKPQAKPEIVAKAPEKKPEPPKPE-- 131

Query: 195 PPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PP PEPKP+P  EP KP+ KP P PQP+P P+P P
Sbjct: 132 -PPKPEPKPQPKPEP-KPEPKPEPKPQPKPEPKPEP 165

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 39/94 (41%), Positives = 55/94 (58%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK------EKPP 200
           +P P P+P+   +PK   KP+   +PK + KP+PK    PE PK   KP+      EK P
Sbjct: 66  QPAPEPRPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPRPEPPKPQAKPEIVAKAPEKKP 125

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PP+P+P  P+   +PK +P P P+P+P PQP P
Sbjct: 126 EPPKPEPPKPEPKPQPKPEPKPEPKPEPKPQPKP 159

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 41/96 (42%), Positives = 54/96 (56%), Gaps = 13/96 (13%)
 Frame = +3

Query: 54  PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP--------- 206
           P    P+   EP +P+   +PK + KP+PK   +PE   EP KP+ +P PP         
Sbjct: 60  PAAARPQPAPEP-RPEPKPEPKPEPKPEPKPEPKPEPKPEP-KPEPRPEPPKPQAKPEIV 117

Query: 207 ---PEPKPEPPK-EPEKPKEKPPPPPQPQPMPQPPP 302
              PE KPEPPK EP KP+ KP P P+P+P P+P P
Sbjct: 118 AKAPEKKPEPPKPEPPKPEPKPQPKPEPKPEPKPEP 153

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 31/65 (47%), Positives = 39/65 (60%)
 Frame = +3

Query: 120 EQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           E+  P   +P+   +P+   KP+ KP P PEPKPEP  EP KP+ KP P P+P P PQ  
Sbjct: 56  ERSAPAAARPQPAPEPRPEPKPEPKPEPKPEPKPEPKPEP-KPEPKPEPRPEP-PKPQAK 113

Query: 300 PHIPA 314
           P I A
Sbjct: 114 PEIVA 118

[52][TOP]
>UniRef100_B5UPB3 Cell surface protein n=1 Tax=Bacillus cereus AH1134
            RepID=B5UPB3_BACCE
          Length = 3373

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 53/107 (49%), Positives = 73/107 (68%), Gaps = 14/107 (13%)
 Frame = +3

Query: 21   KSIEILEPPPPP--KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            + ++I E P  P  KP++P++PKEP VKP+EP++PKE E KP+ PK+PKEPE KP++P++
Sbjct: 3152 EDLKIPEEPKEPEVKPEDPKEPKEPEVKPEEPKEPKEPEVKPEEPKEPKEPEVKPEDPKE 3211

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
            PKE        K P  PE KPE PKEPE   E+P  P +P+  P+ P
Sbjct: 3212 PKEPEVKPEEPKEPKEPEVKPEEPKEPEVKPEEPKEPKEPEVKPEDP 3258

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 53/108 (49%), Positives = 72/108 (66%), Gaps = 16/108 (14%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE-KPKEPVKPKEPE-KPKEQEKPK--------PKKPKE----PEKPKE 173
            ++P  P +PKEPE KP+EP +PKEPE KP+E ++PK        PK+PKE    PE+PKE
Sbjct: 3165 VKPEDPKEPKEPEVKPEEPKEPKEPEVKPEEPKEPKEPEVKPEDPKEPKEPEVKPEEPKE 3224

Query: 174  PEKPKEKPPPPPEP--KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P++P+ KP  P EP  KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3225 PKEPEVKPEEPKEPEVKPEEPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3271

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/108 (48%), Positives = 72/108 (66%), Gaps = 16/108 (14%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE-KPKEPVKPKEPE-KPKEQEKPK--------PKKPKEPE-KPKEPEK 182
            ++P  P +PKEPE KP+EP +PKEPE KP++ ++PK        PK+PKEPE KP+EP++
Sbjct: 3178 VKPEEPKEPKEPEVKPEEPKEPKEPEVKPEDPKEPKEPEVKPEEPKEPKEPEVKPEEPKE 3237

Query: 183  PKEKPPPPPEP-----KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P+ KP  P EP     KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3238 PEVKPEEPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3284

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 52/108 (48%), Positives = 72/108 (66%), Gaps = 16/108 (14%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE-KPKEPVKPKEPE-KPKEQEKP-----KPKKPKEPE-KPKEPEKPKE 191
            ++P  P +PKEPE KP++P +PKEPE KP+E ++P     KP++PKEPE KP+EP++PKE
Sbjct: 3191 VKPEEPKEPKEPEVKPEDPKEPKEPEVKPEEPKEPKEPEVKPEEPKEPEVKPEEPKEPKE 3250

Query: 192  --------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
                    K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3251 PEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEEP 3297

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 52/108 (48%), Positives = 71/108 (65%), Gaps = 16/108 (14%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE-KPKEPVKPKEPE-KPKEQEKPK-----PKKPKEPE----KPKEPEK 182
            ++P  P +PKEPE KP+EP +PKEPE KP+E ++P+     PK+PKEPE     PKEP++
Sbjct: 3204 VKPEDPKEPKEPEVKPEEPKEPKEPEVKPEEPKEPEVKPEEPKEPKEPEVKPEDPKEPKE 3263

Query: 183  PKEKPPPPPEP-----KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P+ KP  P EP     KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3264 PEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEEPKEPKE-PEVKPEEP 3310

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/108 (47%), Positives = 69/108 (63%), Gaps = 14/108 (12%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQEKPKPKKPKEPE----KPKEPE 179
            +K  E  EP  P  KP++P++PKEP VKP+EP++PKE E  KP++PKEPE    +PKEP+
Sbjct: 3191 VKPEEPKEPKEPEVKPEDPKEPKEPEVKPEEPKEPKEPEV-KPEEPKEPEVKPEEPKEPK 3249

Query: 180  KPKEKPPPPPEPK--------PEPPKEPEKPKEKPPPPPQPQPMPQPP 299
            +P+ KP  P EPK        P+ PKEPE   E P  P +P+  P+ P
Sbjct: 3250 EPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEEP 3297

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 51/100 (51%), Positives = 70/100 (70%), Gaps = 13/100 (13%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE----KPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE----KPKEPEK 182
            ++P  P +PKEPE    +PKEP VKP+EP++PKE E KP+ PK+PKEPE     PKEP++
Sbjct: 3217 VKPEEPKEPKEPEVKPEEPKEPEVKPEEPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE 3276

Query: 183  PKEKPPPPPEPK-PE-PPKEPEKPKEKPPPPPQPQPMPQP 296
            P+ KP  P EPK PE  P+EP++PKE    P +P+ + +P
Sbjct: 3277 PEVKPEDPKEPKEPEVKPEEPKEPKEPEVKPEEPKDLKKP 3316

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 47/89 (52%), Positives = 66/89 (74%), Gaps = 7/89 (7%)
 Frame = +3

Query: 48   PPPKPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEKPKEKPPPPPEP 215
            P  KP+EP++PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++PKE     PE 
Sbjct: 3238 PEVKPEEPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-----PEV 3292

Query: 216  KPEPPKEPEKPKEKPPPP---PQPQPMPQ 293
            KPE PKEP++P+ KP  P    +P+  P+
Sbjct: 3293 KPEEPKEPKEPEVKPEEPKDLKKPEVKPE 3321

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 43/81 (53%), Positives = 61/81 (75%), Gaps = 6/81 (7%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE-KPKEPVKPKEPE-KPKEQEKPKPK--KPKEPEKPKEPE-KPKE-KP 197
            ++P  P +PKEPE KP++P +PKEPE KP++ ++PK    KP++P++PKEPE KP+E K 
Sbjct: 3240 VKPEEPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEEPKE 3299

Query: 198  PPPPEPKPEPPKEPEKPKEKP 260
            P  PE KPE PK+ +KP+ KP
Sbjct: 3300 PKEPEVKPEEPKDLKKPEVKP 3320

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 48/102 (47%), Positives = 61/102 (59%), Gaps = 10/102 (9%)
 Frame = +3

Query: 36   LEPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPE-KPKEPEKPKE------ 191
            LEP     PK  E  K P +PKEPE KP++     PK+PKEPE KP+EP++PKE      
Sbjct: 3140 LEPTVTILPKTKEDLKIPEEPKEPEVKPED-----PKEPKEPEVKPEEPKEPKEPEVKPE 3194

Query: 192  --KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
              K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3195 EPKEPKEPEVKPEDPKEPKEPEVKPEEPKEPKE-PEVKPEEP 3235

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 42/89 (47%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 48   PPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPK-EPEKPKEKPPPPPEPKPE 224
            PP +P     PK     K PE+PKE E  KP+ PKEP++P+ +PE+PKE  P  PE KPE
Sbjct: 3138 PPLEPTVTILPKTKEDLKIPEEPKEPEV-KPEDPKEPKEPEVKPEEPKE--PKEPEVKPE 3194

Query: 225  PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3195 EPKEPKEPEVKPEDPKEPKE-PEVKPEEP 3222

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 36/82 (43%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = +3

Query: 72   EKPKEPVKPKEPEKPKEQEKPK-PKKPKEPE-KPKEPEKPKEKPPPPPEPKPEPPKEPEK 245
            +K   P++P     PK +E  K P++PKEPE KP++P++PKE     PE KPE PKEP++
Sbjct: 3134 DKINPPLEPTVTILPKTKEDLKIPEEPKEPEVKPEDPKEPKE-----PEVKPEEPKEPKE 3188

Query: 246  PKEKPPPPPQPQPMPQPPPHIP 311
            P+ KP  P +P+  P+  P  P
Sbjct: 3189 PEVKPEEPKEPKE-PEVKPEDP 3209

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 41/81 (50%), Positives = 53/81 (65%), Gaps = 4/81 (4%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE-KPKEPVKPKEPE-KPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPP 206
            ++P  P +PKEPE KP++P +PKEPE KP+E     PK+PKEPE KP+EP K  +KP   
Sbjct: 3266 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEE-----PKEPKEPEVKPEEP-KDLKKPEVK 3319

Query: 207  PEPKPEP-PKEPEKPKEKPPP 266
            PE + E   KEP+   EK  P
Sbjct: 3320 PEVRLEKLIKEPQAKVEKELP 3340

[53][TOP]
>UniRef100_Q8SAT0 Proline-rich protein (Fragment) n=1 Tax=Saccharum officinarum
           RepID=Q8SAT0_SACOF
          Length = 230

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 50/96 (52%), Positives = 60/96 (62%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPK-EPV-KPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P PK   KPK EPV KPK   KP+ + KP PK   +PE   +PE KP+ KP P P
Sbjct: 82  EPQPKPTPKPEPKPKPEPVPKPKPEPKPEPEPKPHPKPEPKPEPEPKPEPKPEPKPEPKP 141

Query: 210 EPKPEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE     KP+ KP P P+P+P P+P P
Sbjct: 142 EPKPEPLPKPEPQPEPKPEPKPEPVPKPEPKPEPKP 177

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 44/89 (49%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK   KP+   KP+ Q +PKP+   EP    EP KP+ KP P PEPK
Sbjct: 126 EPKPEPKPEPKPEPKPEPKPEPLPKPEPQPEPKPEPKPEPVPKPEP-KPEPKPEPKPEPK 184

Query: 219 PEPPKEP-EKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP  KP+ +P P P+P+P+P+P P
Sbjct: 185 PEPKPEPLPKPEPEPKPEPKPEPLPKPEP 213

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 44/89 (49%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           +P P P PK   +PK   KP+   KP+   KPKP+   EPE KP    +PK +P P PEP
Sbjct: 72  QPQPEPLPKPEPQPKPTPKPEPKPKPEPVPKPKPEPKPEPEPKPHPKPEPKPEPEPKPEP 131

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P+P P
Sbjct: 132 KPEPKPEP-KPEPKPEPLPKPEPQPEPKP 159

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 43/90 (47%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP-EKPKEKPPPPPEP 215
           +P P PKP+   KP    +PK   +PK + KP+PK   +PE   EP  KP+ +P P PEP
Sbjct: 102 KPKPEPKPEPEPKPHPKPEPKPEPEPKPEPKPEPKPEPKPEPKPEPLPKPEPQPEPKPEP 161

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 162 KPEPVPKPEPKPEPKPEPKPEPKPEPKPEP 191

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 43/87 (49%), Positives = 55/87 (63%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P+PK   KP+   KP+   KPK + KP+P+ PK   KP+   +P+ KP P PEPKP
Sbjct: 79  PKPEPQPKPTPKPEPKPKPEPVPKPKPEPKPEPE-PKPHPKPEPKPEPEPKPEPKPEPKP 137

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP  EP KP+  P P PQP+P P+P P
Sbjct: 138 EPKPEP-KPEPLPKPEPQPEPKPEPKP 163

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 44/91 (48%), Positives = 55/91 (60%), Gaps = 4/91 (4%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPPPE 212
           P P P+PK   KP+   +P+   KP+ Q KP PK   KPK    PK   +PK +P P P 
Sbjct: 57  PQPEPQPKPEPKPEPQPQPEPLPKPEPQPKPTPKPEPKPKPEPVPKPKPEPKPEPEPKPH 116

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PKPEP  EPE KP+ KP P P+P+P P+P P
Sbjct: 117 PKPEPKPEPEPKPEPKPEPKPEPKPEPKPEP 147

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 43/90 (47%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP+   +P+    PK   KP+ + KP+PK   +PE   EP+ +P  KP P PEP
Sbjct: 98  EPVPKPKPEPKPEPEPKPHPKPEPKPEPEPKPEPKPEPKPEPKPEPKPEPLPKPEPQPEP 157

Query: 216 KPEPPKEP-EKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP  KP+ KP P P+P+P P+P P
Sbjct: 158 KPEPKPEPVPKPEPKPEPKPEPKPEPKPEP 187

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 43/90 (47%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   KP+   KP+P+   +PE KP+   KP+ KP P PEP
Sbjct: 120 EPKPEPEPKPEPKPEPKPEPKPEPKPEPLPKPEPQPEPKPEPKPEPVPKPEPKPEPKPEP 179

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP+ +P  KP P P+P+P P+P P
Sbjct: 180 KPEPKPEPKPEPLPKPEPEPKPEPKPEPLP 209

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 43/91 (47%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPP 209
           EP P P PK   KP+   KP+   +PK + KP+PK    PK   +P+   +PK +P P P
Sbjct: 110 EPEPKPHPKPEPKPEPEPKPEPKPEPKPEPKPEPKPEPLPKPEPQPEPKPEPKPEPVPKP 169

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP KP+ KP P P+P P P+P P
Sbjct: 170 EPKPEPKPEP-KPEPKPEPKPEPLPKPEPEP 199

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEK---PKEQEKPKPK---KPKEPEKPKEPEKPKEKP 197
           EP P P+PK EP+   EP+   EP+    PK + KPKP+   KPK   KP+   KP  KP
Sbjct: 60  EPQPKPEPKPEPQPQPEPLPKPEPQPKPTPKPEPKPKPEPVPKPKPEPKPEPEPKPHPKP 119

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P PEP+P+P  +PE PK +P P P+P+P+P+P P
Sbjct: 120 EPKPEPEPKPEPKPE-PKPEPKPEPKPEPLPKPEP 153

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 41/92 (44%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE---KPKEPEKPKEKPPPPP 209
           EP P P+PK   KP+   +P+   +PK + KP+PK   +PE   KP+   +PK +P P P
Sbjct: 106 EPKPEPEPKPHPKPEPKPEPEPKPEPKPEPKPEPKPEPKPEPLPKPEPQPEPKPEPKPEP 165

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            PKPEP  EP+ +PK +P P P+P+P+P+P P
Sbjct: 166 VPKPEPKPEPKPEPKPEPKPEPKPEPLPKPEP 197

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 44/92 (47%), Positives = 55/92 (59%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P PKP+   KP+   +PK   KP+   KP+PK   +PE   EP+   KP+  P P P
Sbjct: 138 EPKPEPKPEPLPKPEPQPEPKPEPKPEPVPKPEPKPEPKPEPKPEPKPEPKPEPLPKPEP 197

Query: 210 EPKPEPPKEP-EKPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP  KP+ KP P P+P+P P P P
Sbjct: 198 EPKPEPKPEPLPKPEPKPEPKPEPKPEPLPKP 229

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 41/89 (46%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPK 218
           P P PKP+   KP+   +PK   KP+ + +P PK   +PE   EP+ +P  KP P PEPK
Sbjct: 117 PKPEPKPEPEPKPEPKPEPKPEPKPEPKPEPLPKPEPQPEPKPEPKPEPVPKPEPKPEPK 176

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+ +PK +P P P+P+P P+P P
Sbjct: 177 PEPKPEPKPEPKPEPLPKPEPEPKPEPKP 205

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 55/92 (59%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK---PKEKPPPPP 209
           EP P P+P+    PK   +PK   KP+ + KP+P    +PE   EPE    PK +P P P
Sbjct: 66  EPKPEPQPQPEPLPKPEPQPKPTPKPEPKPKPEPVPKPKPEPKPEPEPKPHPKPEPKPEP 125

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  EP+ +PK +P P P P+P PQP P
Sbjct: 126 EPKPEPKPEPKPEPKPEPKPEPLPKPEPQPEP 157

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 40/87 (45%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK-PKEKPPPPPEP 215
           +P P PKP+   +PK   KP+   KP+ + +PKP+   EP+   +PE  PK +P P PEP
Sbjct: 144 KPEPLPKPEPQPEPKPEPKPEPVPKPEPKPEPKPEPKPEPKPEPKPEPLPKPEPEPKPEP 203

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQ 293
           KPEP  +PE KP+ KP P P+P P P+
Sbjct: 204 KPEPLPKPEPKPEPKPEPKPEPLPKPE 230

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 32/66 (48%), Positives = 41/66 (62%), Gaps = 1/66 (1%)
 Frame = +3

Query: 108 EKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEK-PKEKPPPPPQPQP 284
           E P+ + +PKP+   EP+   EP  PK +P P P PKPEP  +PE  PK KP P P+P+P
Sbjct: 55  ELPQPEPQPKPEPKPEPQPQPEP-LPKPEPQPKPTPKPEPKPKPEPVPKPKPEPKPEPEP 113

Query: 285 MPQPPP 302
            P P P
Sbjct: 114 KPHPKP 119

[54][TOP]
>UniRef100_C7EZF0 Proline-rich protein n=1 Tax=Triticum aestivum RepID=C7EZF0_WHEAT
          Length = 378

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 43/88 (48%), Positives = 55/88 (62%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   +PK    PK   KP+ + +P PK   +PE   EP KP+ KP P PEPK
Sbjct: 160 EPKPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMKPEPKPVPKPEPK 219

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+P  EP  PK +P P P+P+PMP+P P
Sbjct: 220 PDPKPEP-MPKPEPKPEPKPEPMPKPEP 246

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 43/88 (48%), Positives = 56/88 (63%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KP+   KP+    PK + KP+PK P+   KP+   +PK +P P PEPK
Sbjct: 140 EPMPKPEPKPEPKPEPMPKPEPKPMPKPEPKPEPK-PEPMPKPEPKPEPKPEPMPKPEPK 198

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 199 PEPKPEPMKPEPKPVPKPEPKPDPKPEP 226

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 43/88 (48%), Positives = 55/88 (62%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP+   KP+   +PK    PK + KP+PK P    KP+   +PK +P P PEPK
Sbjct: 217 EPKPDPKPEPMPKPEPKPEPKPEPMPKPEPKPEPK-PYPMPKPEPKPEPKPEPMPKPEPK 275

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 276 PEPKPEPMKPEPKPMPKPEPKPEPKPEP 303

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 43/91 (47%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P PKP+   +PK    PK   KP+ + +P PK   +PE   EP KP+ KP P PEPK
Sbjct: 237 KPEPMPKPEPKPEPKPYPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMKPEPKPMPKPEPK 296

Query: 219 PEPPKEP---EKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP    +PK  P P P+P+PMP+P P
Sbjct: 297 PEPKPEPMPKPEPKPMPKPEPKPEPMPKPEP 327

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 46/90 (51%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-EPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   KP+   +PK EP KP+ +  PKP+   EP KP+   KP+ KP P PEP
Sbjct: 259 EPKPEPKPEPMPKPEPKPEPKPEPMKPEPKPMPKPEPKPEP-KPEPMPKPEPKPMPKPEP 317

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE KP+  P P P+P+PMP+P P
Sbjct: 318 KPEPMPKPEPKPEPLPKPEPKPEPMPKPEP 347

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 46/92 (50%), Positives = 58/92 (63%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPP 209
           EP P P+PK   KP EP+KP+    PK + KP+PK    PK   KP    +PK +P P P
Sbjct: 267 EPMPKPEPKPEPKP-EPMKPEPKPMPKPEPKPEPKPEPMPKPEPKPMPKPEPKPEPMPKP 325

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE KP+  P P P+P+PMP+P P
Sbjct: 326 EPKPEPLPKPEPKPEPMPKPEPKPEPMPKPEP 357

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 45/95 (47%), Positives = 56/95 (58%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-------KPKEPEKPKEPEKPKEKP 197
           EP P PKP    KP+   +PK    PK + KP+PK       +PK   KP+   KP+ KP
Sbjct: 104 EPKPEPKPYPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKP 163

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P PEPKPEP  EP  PK +P P P+P+PMP+P P
Sbjct: 164 MPKPEPKPEPKPEP-MPKPEPKPEPKPEPMPKPEP 197

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 44/94 (46%), Positives = 57/94 (60%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP+   KP+   +PK    PK + KP+PK    PK   KP+   +P  KP P P
Sbjct: 76  EPKPMPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPYPMPKPEPKPEPKPEPMPKPEPKP 135

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE   +PK +P P P+P+PMP+P P
Sbjct: 136 EPKPEPMPKPEPKPEPKPEPMPKPEPKPMPKPEP 169

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 43/89 (48%), Positives = 55/89 (61%), Gaps = 2/89 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPK 218
           P P PKP+   +P    +PK   KP+   KP+PK   +PE   +PE KP  KP P PEPK
Sbjct: 115 PKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPMPKPEPKPEPK 174

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 175 PEPMPKPEPKPEPKPEPMPKPEPKPEPKP 203

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 44/94 (46%), Positives = 56/94 (59%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP+   KP+   +PK    PK + KP+PK    PK   KP+   +P  KP P P
Sbjct: 90  EPKPEPKPEPMPKPEPKPEPKPYPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKP 149

Query: 210 EPKPEPPKEPEK---PKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE    PK +P P P+P+PMP+P P
Sbjct: 150 EPKPEPMPKPEPKPMPKPEPKPEPKPEPMPKPEP 183

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 45/93 (48%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KP EP+KP+    PK + KP PK P+   KP+   +PK +P P PEPK
Sbjct: 190 EPMPKPEPKPEPKP-EPMKPEPKPVPKPEPKPDPK-PEPMPKPEPKPEPKPEPMPKPEPK 247

Query: 219 PEP-----PKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP     PK   KP+ KP P P+P+P P+P P
Sbjct: 248 PEPKPYPMPKPEPKPEPKPEPMPKPEPKPEPKP 280

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 44/95 (46%), Positives = 58/95 (61%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEPE-KPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP---EKPKEKPPPP 206
           +P P P+P +PE KP    +PK   KP+   KP+PK   +PE   EP    +PK +P P 
Sbjct: 275 KPEPKPEPMKPEPKPMPKPEPKPEPKPEPMPKPEPKPMPKPEPKPEPMPKPEPKPEPLPK 334

Query: 207 PEPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           PEPKPEP  +PE   +P  KP P P+P+P P+PPP
Sbjct: 335 PEPKPEPMPKPEPKPEPMPKPEPKPEPEPKPEPPP 369

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 40/89 (44%), Positives = 53/89 (59%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P PK   KP+   +P    +PK + KP+P KP+    PK   KP  KP P P+P+
Sbjct: 172 EPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMKPEPKPVPKPEPKPDPKPEPMPKPE 231

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+P  +PE  PK +P P P+P PMP+P P
Sbjct: 232 PKPEPKPEPMPKPEPKPEPKPYPMPKPEP 260

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/92 (47%), Positives = 56/92 (60%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P PK   KP+   +P +PE PK   KP+PK   +PE   +PE KP  KP P PEP
Sbjct: 263 EPKPEPMPKPEPKPEPKPEPMKPE-PKPMPKPEPKPEPKPEPMPKPEPKPMPKPEPKPEP 321

Query: 216 KPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
            P+P  +PE   KP+ KP P P+P+P P+P P
Sbjct: 322 MPKPEPKPEPLPKPEPKPEPMPKPEPKPEPMP 353

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 43/91 (47%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPPE 212
           P P PKP+   KP+    PK    PK + KP+PK    PK   KP+    P  KP P PE
Sbjct: 63  PKPEPKPEPMPKPEPKPMPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPYPMPKPEPKPE 122

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PKPEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 123 PKPEPMPKPEPKPEPKPEPMPKPEPKPEPKP 153

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 45/91 (49%), Positives = 57/91 (62%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPK-EQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPE 212
           EP P P+PK   KP+   KP+   +PK E  KP+PK   +PE KP    +P  KP P PE
Sbjct: 176 EPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMKPEPKPVPKPEPKPDPKPEPMPKPEPKPE 235

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PKPEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 236 PKPEPMPKPEPKPEPKPYPMPKPEPKPEPKP 266

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 44/100 (44%), Positives = 57/100 (57%), Gaps = 1/100 (1%)
 Frame = +3

Query: 6   GCGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKP 185
           G G  + +   EP P P P+   +PK    PK    PK + KP+P    EP+   +PE P
Sbjct: 27  GRGLAEKLPEPEPKPTPYPEPKPEPKPEPMPKPEPMPKPEPKPEPMPKPEPKPMPKPE-P 85

Query: 186 KEKPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
             KP P PEPKPEP  +PE KP+ KP P P+P+P P+P P
Sbjct: 86  MPKPEPKPEPKPEPMPKPEPKPEPKPYPMPKPEPKPEPKP 125

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/95 (45%), Positives = 54/95 (56%), Gaps = 8/95 (8%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE---KPKEPEKPKEKPPPPPE 212
           P P P+PK    PK    PK   KP+   KP+PK   +PE   KP+   +PK +P P PE
Sbjct: 45  PEPKPEPKPEPMPKPEPMPKPEPKPEPMPKPEPKPMPKPEPMPKPEPKPEPKPEPMPKPE 104

Query: 213 PKPEP-----PKEPEKPKEKPPPPPQPQPMPQPPP 302
           PKPEP     PK   KP+ KP P P+P+P P+P P
Sbjct: 105 PKPEPKPYPMPKPEPKPEPKPEPMPKPEPKPEPKP 139

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 41/92 (44%), Positives = 57/92 (61%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEK---PKEPEKPKEKPPPPP 209
           EP P P+PK   KP+   KP+   +PK +  PKP+   EP+    PK   KP+ KP P P
Sbjct: 70  EPMPKPEPKPMPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPYPMPKPEPKPEPKPEPMP 129

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+P+P  +PE  PK +P P P+P+PMP+P P
Sbjct: 130 KPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEP 161

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/91 (46%), Positives = 55/91 (60%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   KP+   KP+   +PK +  PKP+ PK   KP+   +PK +P P PEPK
Sbjct: 126 EPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPE-PKPMPKPEPKPEPKPEPMPKPEPK 184

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PEP  EP  PK +P P P+P+PM   P  +P
Sbjct: 185 PEPKPEP-MPKPEPKPEPKPEPMKPEPKPVP 214

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 41/92 (44%), Positives = 56/92 (60%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEK---PKEPEKPKEKPPPPP 209
           EP P P+PK   KP    KP+   +PK +  PKP+   EP+    PK   KP+ KP P P
Sbjct: 98  EPMPKPEPKPEPKPYPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMP 157

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+P+P  +PE KP+ KP P P+P+P P+P P
Sbjct: 158 KPEPKPMPKPEPKPEPKPEPMPKPEPKPEPKP 189

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 44/90 (48%), Positives = 53/90 (58%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPP-PPE 212
           EP P P PK   KP    +PK   KP+   KP+PK   +PE   +PE KP+ KP P  PE
Sbjct: 150 EPKPEPMPKPEPKPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMKPE 209

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PKP P  EP KP  KP P P+P+P P+P P
Sbjct: 210 PKPVPKPEP-KPDPKPEPMPKPEPKPEPKP 238

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/90 (47%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-EPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP+   KP+   +PK EP KP+ +  PKP+ PK   KP+   KP+ KP P PEP
Sbjct: 182 EPKPEPKPEPMPKPEPKPEPKPEPMKPEPKPVPKPE-PKPDPKPEPMPKPEPKPEPKPEP 240

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            P+P  +PE KP   P P P+P+P P+P P
Sbjct: 241 MPKPEPKPEPKPYPMPKPEPKPEPKPEPMP 270

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P PKP+   +P    +PK   KP+   KP+PK   +PE   +PE PK +P P P PK
Sbjct: 58  KPEPMPKPEPKPEPMPKPEPKPMPKPEPMPKPEPKPEPKPEPMPKPE-PKPEPKPYPMPK 116

Query: 219 PEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+    PK +P P P+P+PMP+P P
Sbjct: 117 PEPKPEPKPEPMPKPEPKPEPKPEPMPKPEP 147

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 41/94 (43%), Positives = 56/94 (59%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEK---PKEPEKPKEKPPPPP 209
           EP P P+PK   KP+   KP+   +PK    PKP+   EP+    PK   KP+ KP P P
Sbjct: 84  EPMPKPEPKPEPKPEPMPKPEPKPEPKPYPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMP 143

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           +P+P+P  +PE   KP+ KP P P+P+P P+P P
Sbjct: 144 KPEPKPEPKPEPMPKPEPKPMPKPEPKPEPKPEP 177

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/89 (48%), Positives = 53/89 (59%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P PK   KP+   +P +PE PK   KP+PK   +PE   +PE PK +P P P PK
Sbjct: 186 EPKPEPMPKPEPKPEPKPEPMKPE-PKPVPKPEPKPDPKPEPMPKPE-PKPEPKPEPMPK 243

Query: 219 PEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
           PEP  EP+  P  KP P P+P+P P P P
Sbjct: 244 PEPKPEPKPYPMPKPEPKPEPKPEPMPKP 272

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 41/88 (46%), Positives = 51/88 (57%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKP    KP+   +PK    PK + KP+PK   EP KP+    PK +P P P+P+
Sbjct: 245 EPKPEPKPYPMPKPEPKPEPKPEPMPKPEPKPEPKP--EPMKPEPKPMPKPEPKPEPKPE 302

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P P  EP KP  KP P P+P P P+P P
Sbjct: 303 PMPKPEP-KPMPKPEPKPEPMPKPEPKP 329

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 42/95 (44%), Positives = 54/95 (56%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE-- 212
           EP P P PK   KP+   +P    +PK + KP+P KP+    PK   KP+ KP P P+  
Sbjct: 249 EPKPYPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMKPEPKPMPKPEPKPEPKPEPMPKPE 308

Query: 213 ----PKPEPPKEP-EKPKEKPPPPPQPQPMPQPPP 302
               PKPEP  EP  KP+ KP P P+P+P P+P P
Sbjct: 309 PKPMPKPEPKPEPMPKPEPKPEPLPKPEPKPEPMP 343

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 44/93 (47%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPE-KPKEPVKPKEPEKPKEQEKPKPKKPKEPE---KPKEPEKPKEKPPPP 206
           +P P P+P +PE KP    +PK   KP+   KP+PK   +PE   KP+   +PK  P P 
Sbjct: 198 KPEPKPEPMKPEPKPVPKPEPKPDPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPYPMPK 257

Query: 207 PEPKPEPPKEPEKPKEKPPPPPQPQPM-PQPPP 302
           PEPKPEP  EP  PK +P P P+P+PM P+P P
Sbjct: 258 PEPKPEPKPEP-MPKPEPKPEPKPEPMKPEPKP 289

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 42/95 (44%), Positives = 53/95 (55%), Gaps = 4/95 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK---PKEPEKPKEPEKPKEKPPPPP 209
           EP P PKP+   KP+   +PK    PK + KP+PK    PK   KP    +PK +P P P
Sbjct: 118 EPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPEPKPEPMPKPEPKPMPKPEPKPEPKPEP 177

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHIP 311
            PKPEP  EP+ +P  KP P P+P+P P  P   P
Sbjct: 178 MPKPEPKPEPKPEPMPKPEPKPEPKPEPMKPEPKP 212

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 41/92 (44%), Positives = 54/92 (58%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P PK    PK   KP+   KP+ +  PKP+   +PE   EP+ +P  KP P PEP
Sbjct: 50  EPKPEPMPKPEPMPKPEPKPEPMPKPEPKPMPKPEPMPKPEPKPEPKPEPMPKPEPKPEP 109

Query: 216 KPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           KP P  +PE   +PK +P P P+P+P P+P P
Sbjct: 110 KPYPMPKPEPKPEPKPEPMPKPEPKPEPKPEP 141

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/90 (45%), Positives = 53/90 (58%), Gaps = 3/90 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP---EKPKEKPPPPP 209
           EP P PKP+   +PK    PK   KP  + +PKP+   +PE   EP    +PK +P P P
Sbjct: 286 EPKPMPKPEPKPEPKPEPMPKPEPKPMPKPEPKPEPMPKPEPKPEPLPKPEPKPEPMPKP 345

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           EPKPEP  +PE PK +P P P+P P  +PP
Sbjct: 346 EPKPEPMPKPE-PKPEPEPKPEPPPKGKPP 374

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 40/88 (45%), Positives = 50/88 (56%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P PKP    +PK   KP+   KP+   KP+PK    PE   +PE PK  P P P PKP
Sbjct: 35  PEPEPKPTPYPEPKPEPKPEPMPKPEPMPKPEPK----PEPMPKPE-PKPMPKPEPMPKP 89

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPH 305
           EP     KP+ KP P P+P+P P+P P+
Sbjct: 90  EP-----KPEPKPEPMPKPEPKPEPKPY 112

[55][TOP]
>UniRef100_C0MCG6 Putative collagen-binding surface-anchored protein FneD n=1
           Tax=Steptococcus equi subsp. zooepidemicus H70
           RepID=C0MCG6_STRS7
          Length = 528

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 43/92 (46%), Positives = 60/92 (65%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP+   KP+   KP+   KP+ Q KP+P+   EP+   EP+ KP+ +P P P+P
Sbjct: 352 KPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQP 411

Query: 216 KPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE   KP+ KP P P+P+PMP+P P
Sbjct: 412 KPEPQPKPEPQPKPEPKPMPKPEPKPMPKPEP 443

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 44/92 (47%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP+   KP+   KP+   KP+ Q KP+P+   EP+   EP+ KP+ KP P PEP
Sbjct: 376 KPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPKPMPKPEP 435

Query: 216 KPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           KP P  EP+   KP+ KP P P+P+PMP+P P
Sbjct: 436 KPMPKPEPKPMPKPEPKPMPKPEPKPMPKPEP 467

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 42/89 (47%), Positives = 59/89 (66%), Gaps = 2/89 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPK 218
           P P PKP+   KP+   KP+   KP+ Q KP+P+   EP+   EP+ KP+ +P P P+PK
Sbjct: 347 PEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPK 406

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE +PK +P P P+P+PMP+P P
Sbjct: 407 PEPQPKPEPQPKPEPQPKPEPKPMPKPEP 435

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 43/94 (45%), Positives = 60/94 (63%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP+   KP+   KP+   KP+ Q KP+P+   EP+   EP+ KP+ +P P P+P
Sbjct: 358 KPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQP 417

Query: 216 KPEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE     KP+ KP P P+P+PMP+P P
Sbjct: 418 KPEPQPKPEPKPMPKPEPKPMPKPEPKPMPKPEP 451

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 43/91 (47%), Positives = 58/91 (63%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P PKP+   KP+   KP+   KP+ Q KP+P+   EP+   EP+ PK +P P PEPK
Sbjct: 370 KPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQ-PKPEPQPKPEPK 428

Query: 219 PEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           P P  EP+   KP+ KP P P+P+PMP+P P
Sbjct: 429 PMPKPEPKPMPKPEPKPMPKPEPKPMPKPEP 459

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 41/90 (45%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P P+   KP+   KP+   KP+ Q KP+P+   EP+   EP+ KP+ +P P P+P
Sbjct: 340 DPEPKPMPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQP 399

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE +PK +P P P+PQP P+P P
Sbjct: 400 KPEPQPKPEPQPKPEPQPKPEPQPKPEPKP 429

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 41/90 (45%), Positives = 58/90 (64%), Gaps = 1/90 (1%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           L+P P PKP    +PK   +PK   +PK + +PKP+   +PE   +PE P+ KP P P+P
Sbjct: 337 LKPDPEPKPMPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPE-PQPKPEPQPKP 395

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+P  EP+ KP+ +P P PQP+P PQP P
Sbjct: 396 EPQPKPEPQPKPEPQPKPEPQPKPEPQPKP 425

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 43/92 (46%), Positives = 57/92 (61%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           +P P PKP+   KP+   KP+   KP+ Q KP+P+   EP+   EP+   KP+ KP P P
Sbjct: 382 KPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPKPMPKPEPKPMPKP 441

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQP 296
           EPKP P  EP+   KP+ KP P P+P+P PQP
Sbjct: 442 EPKPMPKPEPKPMPKPEPKPMPKPEPKPAPQP 473

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 41/94 (43%), Positives = 56/94 (59%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           +P P P P+   KP   +KP    KP  + +PKP+   +PE   +PE   KP+ +P P P
Sbjct: 320 DPEPKPMPEPQPKPDPELKPDPEPKPMPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEP 379

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           +PKPEP  +PE   KP+ +P P PQP+P PQP P
Sbjct: 380 QPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKP 413

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 4/91 (4%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPPE 212
           P P PKP    KP    KP    +PK + +PKP+   +PE   +PE   KP+ +P P P+
Sbjct: 327 PEPQPKPDPELKPDPEPKPMPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQ 386

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PKPEP  +PE +PK +P P P+PQP P+P P
Sbjct: 387 PKPEPQPKPEPQPKPEPQPKPEPQPKPEPQP 417

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/88 (48%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P PKP+   KP+   KP+   KP+ Q KP+PK   +PE PK   KP+ KP P PEPK
Sbjct: 394 KPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPKPMPKPE-PKPMPKPEPKPMPKPEPK 452

Query: 219 PEPPKEPEK-PKEKPPPPPQPQPMPQPP 299
           P P  EP+  PK +P P PQP+  PQ P
Sbjct: 453 PMPKPEPKPMPKPEPKPAPQPEVKPQKP 480

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 45/98 (45%), Positives = 59/98 (60%), Gaps = 10/98 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPK---EPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKP 197
           EP P P+PK   +PK   EP    +PE KP  + KP P+   +PE   +PE   KP+ +P
Sbjct: 310 EPKPDPEPKPDPEPKPMPEPQPKPDPELKPDPEPKPMPEPQPKPEPQPKPEPQPKPEPQP 369

Query: 198 PPPPEPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
            P P+PKPEP  +PE   KP+ +P P PQP+P PQP P
Sbjct: 370 KPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQPKP 407

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 41/94 (43%), Positives = 55/94 (58%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP--KPKKPKEPEKPKEPE---KPKEKPPP 203
           +P P P P+   KP   +KP    KP  + KP  +PK   EP+   +PE    P+ KP P
Sbjct: 288 DPEPKPMPEPQPKPDPELKPDPEPKPDPEPKPDPEPKPMPEPQPKPDPELKPDPEPKPMP 347

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            P+PKPEP  +PE +PK +P P P+PQP P+P P
Sbjct: 348 EPQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQP 381

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 42/93 (45%), Positives = 54/93 (58%), Gaps = 4/93 (4%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPP 206
           L+P P PKP    KP    KP     P+ Q KP P+   +PE    PE   KP+ +P P 
Sbjct: 305 LKPDPEPKPDPEPKPDPEPKPM----PEPQPKPDPELKPDPEPKPMPEPQPKPEPQPKPE 360

Query: 207 PEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PKPEP  +PE +PK +P P P+PQP P+P P
Sbjct: 361 PQPKPEPQPKPEPQPKPEPQPKPEPQPKPEPQP 393

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK-PKEKPPPPPEP 215
           +P P P+ K   +PK   +PK   +PK   +P+PK   E +   EP+  P+ +P P P+P
Sbjct: 298 QPKPDPELKPDPEPKPDPEPKPDPEPKPMPEPQPKPDPELKPDPEPKPMPEPQPKPEPQP 357

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE +PK +P P P+PQP P+P P
Sbjct: 358 KPEPQPKPEPQPKPEPQPKPEPQPKPEPQP 387

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 41/94 (43%), Positives = 56/94 (59%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPK---EPVKPKEPE-KPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPP 203
           +P P P+PK   +PK   EP    +PE KP  + KP P+   +PE KP    +PK  P  
Sbjct: 278 QPKPDPEPKPDPEPKPMPEPQPKPDPELKPDPEPKPDPEPKPDPEPKPMPEPQPKPDPEL 337

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            P+P+P+P  EP+ KP+ +P P PQP+P PQP P
Sbjct: 338 KPDPEPKPMPEPQPKPEPQPKPEPQPKPEPQPKP 371

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 40/94 (42%), Positives = 50/94 (53%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-----KPKEPEKPKEKPPP 203
           E  PP KPK    PK   +PK   +PK   +PKP    +P+     KP    KP  +P P
Sbjct: 260 EAGPPEKPKLDPAPKPEPQPKPDPEPKPDPEPKPMPEPQPKPDPELKPDPEPKPDPEPKP 319

Query: 204 PPEPKPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
            PEPKP P  +P+  P+ KP P P+P P PQP P
Sbjct: 320 DPEPKPMPEPQPKPDPELKPDPEPKPMPEPQPKP 353

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 37/97 (38%), Positives = 54/97 (55%), Gaps = 8/97 (8%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK---PKEKPPPP 206
           L+P P P+P+    P+    P+    P+ Q KP P+   +PE   +PE    P+ KP P 
Sbjct: 269 LDPAPKPEPQPKPDPEPKPDPEPKPMPEPQPKPDPELKPDPEPKPDPEPKPDPEPKPMPE 328

Query: 207 PEPKPEPPKEPEK-----PKEKPPPPPQPQPMPQPPP 302
           P+PKP+P  +P+      P+ +P P PQP+P PQP P
Sbjct: 329 PQPKPDPELKPDPEPKPMPEPQPKPEPQPKPEPQPKP 365

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 37/92 (40%), Positives = 53/92 (57%), Gaps = 7/92 (7%)
 Frame = +3

Query: 48  PPPKPKEPEKPKEPV----KPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           P P P E  + K P     +   PEKPK    PKP+   +P+   +P+ P+ KP P P+P
Sbjct: 241 PKPLPGEDGQTKYPKGESGEAGPPEKPKLDPAPKPEPQPKPDPEPKPD-PEPKPMPEPQP 299

Query: 216 KPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           KP+P  +P+   KP  +P P P+P+PMP+P P
Sbjct: 300 KPDPELKPDPEPKPDPEPKPDPEPKPMPEPQP 331

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 35/77 (45%), Positives = 44/77 (57%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+PK   +PK   KP    +PK   KP+PK   +PE PK   KP+ KP P PEPK
Sbjct: 410 QPKPEPQPKPEPQPKPEPKPMPKPEPKPMPKPEPKPMPKPE-PKPMPKPEPKPMPKPEPK 468

Query: 219 PEPPKEPEKPKEKPPPP 269
           P P  +PE   +KP  P
Sbjct: 469 PAP--QPEVKPQKPTKP 483

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 38/80 (47%), Positives = 46/80 (57%), Gaps = 1/80 (1%)
 Frame = +3

Query: 60  PKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK-EPEKPKEPEKPKEKPPPPPEPKPEPPKE 236
           PK+PE   +P   K P KP   E  + K PK E  +   PEKPK  P P PEP+P+P  E
Sbjct: 226 PKKPESGPKPPGGKNP-KPLPGEDGQTKYPKGESGEAGPPEKPKLDPAPKPEPQPKPDPE 284

Query: 237 PEKPKEKPPPPPQPQPMPQP 296
           P KP  +P P P+PQP P P
Sbjct: 285 P-KPDPEPKPMPEPQPKPDP 303

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 37/90 (41%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +3

Query: 45  PPPPKPKEPEK-PKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P PP  K P+  P E  + K P K +  E   P+KPK    PK   +PK  P P P+P+P
Sbjct: 233 PKPPGGKNPKPLPGEDGQTKYP-KGESGEAGPPEKPKLDPAPKPEPQPKPDPEPKPDPEP 291

Query: 222 EPPKEPEK---PKEKPPPPPQPQPMPQPPP 302
           +P  EP+    P+ KP P P+P P P+P P
Sbjct: 292 KPMPEPQPKPDPELKPDPEPKPDPEPKPDP 321

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 29/72 (40%), Positives = 40/72 (55%)
 Frame = +3

Query: 87  PVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPP 266
           P KP+   KP   + PKP  P E  + K P+    +  PP +PK +P  +PE P+ KP P
Sbjct: 226 PKKPESGPKPPGGKNPKPL-PGEDGQTKYPKGESGEAGPPEKPKLDPAPKPE-PQPKPDP 283

Query: 267 PPQPQPMPQPPP 302
            P+P P P+P P
Sbjct: 284 EPKPDPEPKPMP 295

[56][TOP]
>UniRef100_C3CQZ5 Cell surface protein n=1 Tax=Bacillus thuringiensis Bt407
            RepID=C3CQZ5_BACTU
          Length = 3395

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 49/104 (47%), Positives = 70/104 (67%), Gaps = 14/104 (13%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEP-VKPKEPEKPKEQEKPK-PKKPKE-------PEKPKEPEKPKEK 194
            P  P +PK+P++PKEP VKP++P++PKE ++PK PK+PK+       PE PKEP++P+ K
Sbjct: 3156 PEDPKEPKDPKEPKEPEVKPEDPKEPKEPKEPKEPKEPKDPKEPEVKPEDPKEPKEPEVK 3215

Query: 195  PPPPPEP-----KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P  P EP     KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3216 PEDPKEPKDPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3258

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/113 (46%), Positives = 75/113 (66%), Gaps = 15/113 (13%)
 Frame = +3

Query: 18   IKSIEILEPPPPPKPKEPEKPKEP----VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEP 176
            +K  +  EP  P +PKEP++PK+P    VKP++P++PKE E KP+ PK+PK+PE KP++P
Sbjct: 3173 VKPEDPKEPKEPKEPKEPKEPKDPKEPEVKPEDPKEPKEPEVKPEDPKEPKDPEVKPEDP 3232

Query: 177  EKPKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            ++PKE        K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3233 KEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3284

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 50/112 (44%), Positives = 71/112 (63%), Gaps = 21/112 (18%)
 Frame = +3

Query: 39   EPPPPPKPKEPE-------KPKEPVKPKEPEKPKEQEKPK-----PKKPKEPE-KPKEPE 179
            EP  P +PKEPE       +PKEP +PKEP++PK+ ++P+     PK+PKEPE KP++P+
Sbjct: 3161 EPKDPKEPKEPEVKPEDPKEPKEPKEPKEPKEPKDPKEPEVKPEDPKEPKEPEVKPEDPK 3220

Query: 180  KPKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            +PK+        K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3221 EPKDPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3271

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 52/110 (47%), Positives = 70/110 (63%), Gaps = 19/110 (17%)
 Frame = +3

Query: 39   EPPPPPKPKEPE-KPKEPVKPKEPE-KPKEQEKPK--------PKKPKEPE-KPKEPEKP 185
            EP  P  PKEPE KP++P +PKEPE KP++ ++PK        PK+PKEPE KP++P++P
Sbjct: 3189 EPKEPKDPKEPEVKPEDPKEPKEPEVKPEDPKEPKDPEVKPEDPKEPKEPEVKPEDPKEP 3248

Query: 186  KE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            KE        K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3249 KEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3297

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/111 (47%), Positives = 75/111 (67%), Gaps = 13/111 (11%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            +K  +  EP  P  KP++P++PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++
Sbjct: 3214 VKPEDPKEPKDPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3273

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PKE        K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3274 PKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3323

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/111 (47%), Positives = 75/111 (67%), Gaps = 13/111 (11%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            +K  +  EP  P  KP++P++PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++
Sbjct: 3227 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3286

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PKE        K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3287 PKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3336

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 48/95 (50%), Positives = 62/95 (65%), Gaps = 3/95 (3%)
 Frame = +3

Query: 36   LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP--KPKKPKEPEKPKEPEKPKE-KPPPP 206
            LEP     PK  E  K P  PKEP+ PKE ++P  KP+ PKEP++PKEP++PKE K P  
Sbjct: 3139 LEPTVTILPKTKEDFKIPEDPKEPKDPKEPKEPEVKPEDPKEPKEPKEPKEPKEPKDPKE 3198

Query: 207  PEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3199 PEVKPEDPKEPKEPEVKPEDPKEPKD-PEVKPEDP 3232

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/111 (46%), Positives = 75/111 (67%), Gaps = 13/111 (11%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            +K  +  EP  P  KP++P++PK+P VKP++P++PKE E KP+ PK+PKEPE KP++P++
Sbjct: 3201 VKPEDPKEPKEPEVKPEDPKEPKDPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3260

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PKE        K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3261 PKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3310

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 48/100 (48%), Positives = 62/100 (62%), Gaps = 14/100 (14%)
 Frame = +3

Query: 54   PKPKE----PEKPKEPVKPKEPEKP--KEQEKPKPKKPKEPEKPKEPEKPKE-------- 191
            PK KE    PE PKEP  PKEP++P  K ++  +PK+PKEP++PKEP+ PKE        
Sbjct: 3147 PKTKEDFKIPEDPKEPKDPKEPKEPEVKPEDPKEPKEPKEPKEPKEPKDPKEPEVKPEDP 3206

Query: 192  KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            K P  PE KPE PKEP+ P+ KP  P +P+  P+  P  P
Sbjct: 3207 KEPKEPEVKPEDPKEPKDPEVKPEDPKEPKE-PEVKPEDP 3245

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/104 (47%), Positives = 66/104 (63%), Gaps = 16/104 (15%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE----KPKE 173
            +K  +  EP  P  KP++P++PKEP VKP++P++PKE E KP+ PK+PKEPE     PKE
Sbjct: 3240 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3299

Query: 174  PEKPKEKPPPPPEPK--------PEPPKEPEKPKEKPPPPPQPQ 281
            P++P+ KP  P EPK        P+ PKEPE   E P    QP+
Sbjct: 3300 PKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKDLKQPE 3343

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 37/92 (40%), Positives = 55/92 (59%), Gaps = 8/92 (8%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQEKPKPKKPKEPEKPK-EPEKPK 188
            +K  +  EP  P  KP++P++PKEP VKP++P++PKE E  KP+ PKEP++P+ +PE PK
Sbjct: 3279 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPE-VKPEDPKEPKEPEVKPEDPK 3337

Query: 189  EKPPPPPE-----PKPEPPKEPEKPKEKPPPP 269
            +   P         +P+   E E PK     P
Sbjct: 3338 DLKQPEVRLEKLIKEPQVKTERELPKTGAASP 3369

[57][TOP]
>UniRef100_Q6AVC2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=Q6AVC2_ORYSJ
          Length = 360

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 46/95 (48%), Positives = 59/95 (62%), Gaps = 6/95 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   +PK + KP+PK +PK   +PK   KP+ KP P PE 
Sbjct: 83  EPKPYPEPKPETKPELKPEPKPNPEPKPEPKPEPKPEPKPYPEPKPKPKPEPKPEPKPEH 142

Query: 216 KPEPPKEPE-----KPKEKPPPPPQPQPMPQPPPH 305
           KPEP  EPE     KPK +P P P+P+P P+P PH
Sbjct: 143 KPEPKPEPEPKPYPKPKPEPKPGPKPEPKPEPKPH 177

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 50/105 (47%), Positives = 61/105 (58%), Gaps = 16/105 (15%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK---EPE-KPKEQEKPKPKKPKEPEKPKEPE-------KP 185
           EP P P+PK   KP+   +PK   EP+ KPK + KP+PK   +PE   EPE       KP
Sbjct: 101 EPKPNPEPKPEPKPEPKPEPKPYPEPKPKPKPEPKPEPKPEHKPEPKPEPEPKPYPKPKP 160

Query: 186 KEKPPPPPEPKPEPPKEPE-----KPKEKPPPPPQPQPMPQPPPH 305
           + KP P PEPKPEP   PE     KPK  P P P+P+P P+P PH
Sbjct: 161 EPKPGPKPEPKPEPKPHPEPKPEPKPKPVPHPEPKPEPKPEPKPH 205

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 45/95 (47%), Positives = 56/95 (58%), Gaps = 6/95 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P PKP+   +PK   +PK   KPK + KP PK   +PE    PE   +PK KP P P
Sbjct: 133 EPKPEPKPEHKPEPKPEPEPKPYPKPKPEPKPGPKPEPKPEPKPHPEPKPEPKPKPVPHP 192

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPPH 305
           EPKPEP  EP+   +PK +P P P+  P P+P PH
Sbjct: 193 EPKPEPKPEPKPHPEPKPEPKPEPKLHPKPEPKPH 227

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 48/94 (51%), Positives = 59/94 (62%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK---EPE-KPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPP 203
           EP P PKPK    PE KP+   +PK   +PK + KP+PK   +PE    PE +PK KP P
Sbjct: 179 EPKPEPKPKPVPHPEPKPEPKPEPKPHPEPKPEPKPEPKLHPKPEPKPHPEPEPKLKPEP 238

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            PEPKPEP  +PE KP+ KP P P P+P P+P P
Sbjct: 239 KPEPKPEPEPKPEPKPEPKPEPKPYPKPKPEPKP 272

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/91 (49%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE---KPKEPEKPKEKPPPPPE 212
           P P P+PK   KP    KP+   +PK   KP+PK   EPE   KP+   +PK +P P PE
Sbjct: 192 PEPKPEPKPEPKPHPEPKPEPKPEPKLHPKPEPKPHPEPEPKLKPEPKPEPKPEPEPKPE 251

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPPH 305
           PKPEP  EP KP  KP P P+P P P+P PH
Sbjct: 252 PKPEPKPEP-KPYPKPKPEPKPVPKPKPIPH 281

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 45/93 (48%), Positives = 54/93 (58%), Gaps = 3/93 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE---KPKEPEKPKEKPPPPP 209
           EP P P+PK   KP+   +PK   KPK + KP PK    P    KPK    PK +P P P
Sbjct: 241 EPKPEPEPKPEPKPEPKPEPKPYPKPKPEPKPVPKPKPIPHPGPKPKPKPDPKLEPKPHP 300

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           EPKP P  EPE PK KP P P+P+P P+P P +
Sbjct: 301 EPKPHPMPEPE-PKPKPEPKPEPKPYPEPKPKL 332

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 43/90 (47%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKP-KKPKEPEKPKEPEKPKEKPPPPPEP 215
           +P P PKPK   +PK   KP+   +PK + +PKP  KPK   KP    +PK +P P PEP
Sbjct: 121 KPYPEPKPKPKPEPKPEPKPEHKPEPKPEPEPKPYPKPKPEPKPGPKPEPKPEPKPHPEP 180

Query: 216 KPEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP PK    P+ KP P P+P+P P+P P
Sbjct: 181 KPEPKPKPVPHPEPKPEPKPEPKPHPEPKP 210

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPE 212
           LEP P PKPK   K +   +PK   KP+ +  P+PK   +PE KP+    P+ KP P PE
Sbjct: 56  LEPKPKPKPKPHPKHESKPEPKPEPKPEPKPYPEPKPETKPELKPEPKPNPEPKPEPKPE 115

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PKPEP   PE KPK KP P P+P+P  +P P
Sbjct: 116 PKPEPKPYPEPKPKPKPEPKPEPKPEHKPEP 146

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 44/94 (46%), Positives = 55/94 (58%), Gaps = 4/94 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   KP+  + PK   KP  + +PK K   +PE   EPE KP+ KP P PEP
Sbjct: 201 EPKPHPEPKPEPKPEPKLHPKPEPKPHPEPEPKLKPEPKPEPKPEPEPKPEPKPEPKPEP 260

Query: 216 KPEPPKEPEK---PKEKPPPPPQPQPMPQPPPHI 308
           KP P  +PE    PK KP P P P+P P+P P +
Sbjct: 261 KPYPKPKPEPKPVPKPKPIPHPGPKPKPKPDPKL 294

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/94 (45%), Positives = 55/94 (58%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-----KPKEPEKPKEKPPP 203
           EP P PKP+   +PK   +PK   KPK    P+PK   +PE     +PK   KP+ K  P
Sbjct: 161 EPKPGPKPEPKPEPKPHPEPKPEPKPKPVPHPEPKPEPKPEPKPHPEPKPEPKPEPKLHP 220

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            PEPKP P  EP+ KP+ KP P P+P+P P+P P
Sbjct: 221 KPEPKPHPEPEPKLKPEPKPEPKPEPEPKPEPKP 254

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/95 (44%), Positives = 57/95 (60%), Gaps = 6/95 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-----KPKEKPPP 203
           EP P PKP    KP+   KP    +PK + KP+PK   EP+   +PE     KP+ KP P
Sbjct: 169 EPKPEPKPHPEPKPEPKPKPVPHPEPKPEPKPEPKPHPEPKPEPKPEPKLHPKPEPKPHP 228

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPH 305
            PEPK +P  +PE KP+ +P P P+P+P P+P P+
Sbjct: 229 EPEPKLKPEPKPEPKPEPEPKPEPKPEPKPEPKPY 263

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 43/91 (47%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKPK   KP    +PK   KP  + KP+PK PK    P+   +PK +P P PEPK
Sbjct: 151 EPKPYPKPKPEPKPGPKPEPKPEPKPHPEPKPEPK-PKPVPHPEPKPEPKPEPKPHPEPK 209

Query: 219 PEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+   KP+ KP P P+P+  P+P P
Sbjct: 210 PEPKPEPKLHPKPEPKPHPEPEPKLKPEPKP 240

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 47/97 (48%), Positives = 55/97 (56%), Gaps = 6/97 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKPK   KP    KP     PK + KP PK +PK   +PK    P+ +P P PEP
Sbjct: 259 EPKPYPKPKPEPKPVPKPKPIPHPGPKPKPKPDPKLEPKPHPEPKPHPMPEPEPKPKPEP 318

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQP----PPHIP 311
           KPEP   PE KPK KP P P P+P+  P    PPH+P
Sbjct: 319 KPEPKPYPEPKPKLKPEPKPGPKPIAPPNKHKPPHMP 355

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 41/89 (46%), Positives = 54/89 (60%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           E  P PKP+   +PK   +PK   KP+ + +PKP    +PE   EP+ +PK  P P P+P
Sbjct: 71  ESKPEPKPEPKPEPKPYPEPKPETKPELKPEPKPNPEPKPEPKPEPKPEPKPYPEPKPKP 130

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP KP+ KP P P+P+P P P P
Sbjct: 131 KPEPKPEP-KPEHKPEPKPEPEPKPYPKP 158

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 45/92 (48%), Positives = 58/92 (63%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-EPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           +P P P+PK   +PK   KP+ +PE KP  + KP+PK   +PE    PE KPK KP P P
Sbjct: 77  KPEPKPEPKPYPEPKPETKPELKPEPKPNPEPKPEPKPEPKPEPKPYPEPKPKPKPEPKP 136

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPE   EP+ +P+ KP P P+P+P P P P
Sbjct: 137 EPKPEHKPEPKPEPEPKPYPKPKPEPKPGPKP 168

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 42/90 (46%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+   KP+   +PK   +PK + KP+PK +PK   KPK   KP  KP P P P
Sbjct: 223 EPKPHPEPEPKLKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPKPKPEPKPVPKPKPIPHP 282

Query: 216 KPEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
            P+P PK   K + KP P P+P PMP+P P
Sbjct: 283 GPKPKPKPDPKLEPKPHPEPKPHPMPEPEP 312

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 42/88 (47%), Positives = 54/88 (61%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           E PP  +PK   KPK   K +   +PK + KP+PK   EP+   +PE  K +P P PEPK
Sbjct: 51  EKPPELEPKPKPKPKPHPKHESKPEPKPEPKPEPKPYPEPKPETKPEL-KPEPKPNPEPK 109

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP KP+ KP P P+P+P P+P P
Sbjct: 110 PEPKPEP-KPEPKPYPEPKPKPKPEPKP 136

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 43/99 (43%), Positives = 54/99 (54%), Gaps = 10/99 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-----KPKEKPPP 203
           EP P PKP+    PK   KP    +PK + +PKP+   EPE   EP+     +PK  P P
Sbjct: 207 EPKPEPKPEPKLHPKPEPKPHPEPEPKLKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPKP 266

Query: 204 PPEPKPEPPKEP-----EKPKEKPPPPPQPQPMPQPPPH 305
            PEPKP P  +P      KPK KP P  +P+P P+P PH
Sbjct: 267 KPEPKPVPKPKPIPHPGPKPKPKPDPKLEPKPHPEPKPH 305

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 41/93 (44%), Positives = 53/93 (56%), Gaps = 3/93 (3%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           L+P P P+PK   +PK   KP+   +PK   KPKP+ PK   KPK    P  KP P P+P
Sbjct: 234 LKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPKPKPE-PKPVPKPKPIPHPGPKPKPKPDP 292

Query: 216 KPEPPKEPEK---PKEKPPPPPQPQPMPQPPPH 305
           K EP   PE    P  +P P P+P+P P+P P+
Sbjct: 293 KLEPKPHPEPKPHPMPEPEPKPKPEPKPEPKPY 325

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 42/92 (45%), Positives = 51/92 (55%), Gaps = 3/92 (3%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           L P P PKP    +PK   +PK   KP+ + KP+PK   +PE PK   KPK +P P P+P
Sbjct: 218 LHPKPEPKPHPEPEPKLKPEPKPEPKPEPEPKPEPKPEPKPE-PKPYPKPKPEPKPVPKP 276

Query: 216 KPEP---PKEPEKPKEKPPPPPQPQPMPQPPP 302
           KP P   PK   KP  K  P P P+P P P P
Sbjct: 277 KPIPHPGPKPKPKPDPKLEPKPHPEPKPHPMP 308

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 42/90 (46%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKP EP+   EP    +PE KP+ +  P+PK   +PE   EP KP  +P P P+P
Sbjct: 75  EPKPEPKP-EPKPYPEPKPETKPELKPEPKPNPEPKPEPKPEPKPEP-KPYPEPKPKPKP 132

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+P  +PE KP+ KP P P+P P P+P P
Sbjct: 133 EPKPEPKPEHKPEPKPEPEPKPYPKPKPEP 162

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 35/73 (47%), Positives = 47/73 (64%), Gaps = 2/73 (2%)
 Frame = +3

Query: 93  KPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPE-KPKEKPPP 266
           KP E E KPK + KP PK   +PE   EP KP+ KP P P+P+ +P  +PE KP  +P P
Sbjct: 52  KPPELEPKPKPKPKPHPKHESKPEPKPEP-KPEPKPYPEPKPETKPELKPEPKPNPEPKP 110

Query: 267 PPQPQPMPQPPPH 305
            P+P+P P+P P+
Sbjct: 111 EPKPEPKPEPKPY 123

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 34/78 (43%), Positives = 40/78 (51%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P PKP    +PK   +PK    P+ + KPKP+   EP+   EP KPK KP P P PKP
Sbjct: 284 PKPKPKPDPKLEPKPHPEPKPHPMPEPEPKPKPEPKPEPKPYPEP-KPKLKPEPKPGPKP 342

Query: 222 EPPKEPEKPKEKPPPPPQ 275
             P    KP   PP   Q
Sbjct: 343 IAPPNKHKPPHMPPATNQ 360

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 33/81 (40%), Positives = 40/81 (49%), Gaps = 1/81 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEPK 218
           P P PKPK    PK   KP    KP    +P+PK   EP+ +PK   +PK K  P P+P 
Sbjct: 280 PHPGPKPKPKPDPKLEPKPHPEPKPHPMPEPEPKPKPEPKPEPKPYPEPKPKLKPEPKPG 339

Query: 219 PEPPKEPEKPKEKPPPPPQPQ 281
           P+P   P K K    PP   Q
Sbjct: 340 PKPIAPPNKHKPPHMPPATNQ 360

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 27/60 (45%), Positives = 34/60 (56%)
 Frame = +3

Query: 126 EKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPH 305
           EKP   +PK   KPK   K + KP P PEPKPEP     KP  +P P  +P+  P+P P+
Sbjct: 51  EKPPELEPKPKPKPKPHPKHESKPEPKPEPKPEP-----KPYPEPKPETKPELKPEPKPN 105

[58][TOP]
>UniRef100_Q0DJU4 Os05g0226900 protein n=2 Tax=Oryza sativa RepID=Q0DJU4_ORYSJ
          Length = 358

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 46/95 (48%), Positives = 59/95 (62%), Gaps = 6/95 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+PK   KP+   +PK   +PK + KP+PK +PK   +PK   KP+ KP P PE 
Sbjct: 81  EPKPYPEPKPETKPELKPEPKPNPEPKPEPKPEPKPEPKPYPEPKPKPKPEPKPEPKPEH 140

Query: 216 KPEPPKEPE-----KPKEKPPPPPQPQPMPQPPPH 305
           KPEP  EPE     KPK +P P P+P+P P+P PH
Sbjct: 141 KPEPKPEPEPKPYPKPKPEPKPGPKPEPKPEPKPH 175

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 50/105 (47%), Positives = 61/105 (58%), Gaps = 16/105 (15%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK---EPE-KPKEQEKPKPKKPKEPEKPKEPE-------KP 185
           EP P P+PK   KP+   +PK   EP+ KPK + KP+PK   +PE   EPE       KP
Sbjct: 99  EPKPNPEPKPEPKPEPKPEPKPYPEPKPKPKPEPKPEPKPEHKPEPKPEPEPKPYPKPKP 158

Query: 186 KEKPPPPPEPKPEPPKEPE-----KPKEKPPPPPQPQPMPQPPPH 305
           + KP P PEPKPEP   PE     KPK  P P P+P+P P+P PH
Sbjct: 159 EPKPGPKPEPKPEPKPHPEPKPEPKPKPVPHPEPKPEPKPEPKPH 203

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 45/95 (47%), Positives = 56/95 (58%), Gaps = 6/95 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P PKP+   +PK   +PK   KPK + KP PK   +PE    PE   +PK KP P P
Sbjct: 131 EPKPEPKPEHKPEPKPEPEPKPYPKPKPEPKPGPKPEPKPEPKPHPEPKPEPKPKPVPHP 190

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPPH 305
           EPKPEP  EP+   +PK +P P P+  P P+P PH
Sbjct: 191 EPKPEPKPEPKPHPEPKPEPKPEPKLHPKPEPKPH 225

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 48/94 (51%), Positives = 59/94 (62%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK---EPE-KPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPP 203
           EP P PKPK    PE KP+   +PK   +PK + KP+PK   +PE    PE +PK KP P
Sbjct: 177 EPKPEPKPKPVPHPEPKPEPKPEPKPHPEPKPEPKPEPKLHPKPEPKPHPEPEPKLKPEP 236

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            PEPKPEP  +PE KP+ KP P P P+P P+P P
Sbjct: 237 KPEPKPEPEPKPEPKPEPKPEPKPYPKPKPEPKP 270

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/91 (49%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE---KPKEPEKPKEKPPPPPE 212
           P P P+PK   KP    KP+   +PK   KP+PK   EPE   KP+   +PK +P P PE
Sbjct: 190 PEPKPEPKPEPKPHPEPKPEPKPEPKLHPKPEPKPHPEPEPKLKPEPKPEPKPEPEPKPE 249

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPPH 305
           PKPEP  EP KP  KP P P+P P P+P PH
Sbjct: 250 PKPEPKPEP-KPYPKPKPEPKPVPKPKPIPH 279

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 45/93 (48%), Positives = 54/93 (58%), Gaps = 3/93 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE---KPKEPEKPKEKPPPPP 209
           EP P P+PK   KP+   +PK   KPK + KP PK    P    KPK    PK +P P P
Sbjct: 239 EPKPEPEPKPEPKPEPKPEPKPYPKPKPEPKPVPKPKPIPHPGPKPKPKPDPKLEPKPHP 298

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           EPKP P  EPE PK KP P P+P+P P+P P +
Sbjct: 299 EPKPHPMPEPE-PKPKPEPKPEPKPYPEPKPKL 330

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 43/90 (47%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKP-KKPKEPEKPKEPEKPKEKPPPPPEP 215
           +P P PKPK   +PK   KP+   +PK + +PKP  KPK   KP    +PK +P P PEP
Sbjct: 119 KPYPEPKPKPKPEPKPEPKPEHKPEPKPEPEPKPYPKPKPEPKPGPKPEPKPEPKPHPEP 178

Query: 216 KPEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP PK    P+ KP P P+P+P P+P P
Sbjct: 179 KPEPKPKPVPHPEPKPEPKPEPKPHPEPKP 208

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 44/94 (46%), Positives = 55/94 (58%), Gaps = 4/94 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   KP+  + PK   KP  + +PK K   +PE   EPE KP+ KP P PEP
Sbjct: 199 EPKPHPEPKPEPKPEPKLHPKPEPKPHPEPEPKLKPEPKPEPKPEPEPKPEPKPEPKPEP 258

Query: 216 KPEPPKEPEK---PKEKPPPPPQPQPMPQPPPHI 308
           KP P  +PE    PK KP P P P+P P+P P +
Sbjct: 259 KPYPKPKPEPKPVPKPKPIPHPGPKPKPKPDPKL 292

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/94 (45%), Positives = 55/94 (58%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-----KPKEPEKPKEKPPP 203
           EP P PKP+   +PK   +PK   KPK    P+PK   +PE     +PK   KP+ K  P
Sbjct: 159 EPKPGPKPEPKPEPKPHPEPKPEPKPKPVPHPEPKPEPKPEPKPHPEPKPEPKPEPKLHP 218

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            PEPKP P  EP+ KP+ KP P P+P+P P+P P
Sbjct: 219 KPEPKPHPEPEPKLKPEPKPEPKPEPEPKPEPKP 252

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/95 (44%), Positives = 57/95 (60%), Gaps = 6/95 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-----KPKEKPPP 203
           EP P PKP    KP+   KP    +PK + KP+PK   EP+   +PE     KP+ KP P
Sbjct: 167 EPKPEPKPHPEPKPEPKPKPVPHPEPKPEPKPEPKPHPEPKPEPKPEPKLHPKPEPKPHP 226

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPH 305
            PEPK +P  +PE KP+ +P P P+P+P P+P P+
Sbjct: 227 EPEPKLKPEPKPEPKPEPEPKPEPKPEPKPEPKPY 261

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 43/91 (47%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P PKPK   KP    +PK   KP  + KP+PK PK    P+   +PK +P P PEPK
Sbjct: 149 EPKPYPKPKPEPKPGPKPEPKPEPKPHPEPKPEPK-PKPVPHPEPKPEPKPEPKPHPEPK 207

Query: 219 PEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+   KP+ KP P P+P+  P+P P
Sbjct: 208 PEPKPEPKLHPKPEPKPHPEPEPKLKPEPKP 238

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 47/97 (48%), Positives = 55/97 (56%), Gaps = 6/97 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P PKPK   KP    KP     PK + KP PK +PK   +PK    P+ +P P PEP
Sbjct: 257 EPKPYPKPKPEPKPVPKPKPIPHPGPKPKPKPDPKLEPKPHPEPKPHPMPEPEPKPKPEP 316

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQP----PPHIP 311
           KPEP   PE KPK KP P P P+P+  P    PPH+P
Sbjct: 317 KPEPKPYPEPKPKLKPEPKPGPKPIAPPNKHKPPHMP 353

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 41/89 (46%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           E  P PKP+   +PK   +PK   KP+ + +PKP    +PE   EP KP+ KP P P+PK
Sbjct: 69  ESKPEPKPEPKPEPKPYPEPKPETKPELKPEPKPNPEPKPEPKPEP-KPEPKPYPEPKPK 127

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+P  +PE KP+ KP P P+P+P P P P
Sbjct: 128 PKPEPKPEPKPEHKPEPKPEPEPKPYPKP 156

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 45/92 (48%), Positives = 58/92 (63%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-EPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           +P P P+PK   +PK   KP+ +PE KP  + KP+PK   +PE    PE KPK KP P P
Sbjct: 75  KPEPKPEPKPYPEPKPETKPELKPEPKPNPEPKPEPKPEPKPEPKPYPEPKPKPKPEPKP 134

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPE   EP+ +P+ KP P P+P+P P P P
Sbjct: 135 EPKPEHKPEPKPEPEPKPYPKPKPEPKPGPKP 166

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/90 (47%), Positives = 53/90 (58%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPP--PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           E PP   PKPK    PK   KP+   +PK + KP P+ PK   KP+   +PK  P P PE
Sbjct: 51  EKPPELEPKPKPKPHPKHESKPEPKPEPKPEPKPYPE-PKPETKPELKPEPKPNPEPKPE 109

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PKPEP  EP KP  +P P P+P+P P+P P
Sbjct: 110 PKPEPKPEP-KPYPEPKPKPKPEPKPEPKP 138

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 42/90 (46%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+   KP+   +PK   +PK + KP+PK +PK   KPK   KP  KP P P P
Sbjct: 221 EPKPHPEPEPKLKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPKPKPEPKPVPKPKPIPHP 280

Query: 216 KPEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
            P+P PK   K + KP P P+P PMP+P P
Sbjct: 281 GPKPKPKPDPKLEPKPHPEPKPHPMPEPEP 310

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/93 (47%), Positives = 54/93 (58%), Gaps = 4/93 (4%)
 Frame = +3

Query: 36  LEPPPPPKP--KEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPP 206
           LEP P PKP  K   KP+   +PK   KP  + KP+ K   +PE    PE KP+ KP P 
Sbjct: 56  LEPKPKPKPHPKHESKPEPKPEPKPEPKPYPEPKPETKPELKPEPKPNPEPKPEPKPEPK 115

Query: 207 PEPKPEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEPKP P PK   KP+ KP P P+ +P P+P P
Sbjct: 116 PEPKPYPEPKPKPKPEPKPEPKPEHKPEPKPEP 148

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 43/99 (43%), Positives = 54/99 (54%), Gaps = 10/99 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-----KPKEKPPP 203
           EP P PKP+    PK   KP    +PK + +PKP+   EPE   EP+     +PK  P P
Sbjct: 205 EPKPEPKPEPKLHPKPEPKPHPEPEPKLKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPKP 264

Query: 204 PPEPKPEPPKEP-----EKPKEKPPPPPQPQPMPQPPPH 305
            PEPKP P  +P      KPK KP P  +P+P P+P PH
Sbjct: 265 KPEPKPVPKPKPIPHPGPKPKPKPDPKLEPKPHPEPKPH 303

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 41/93 (44%), Positives = 53/93 (56%), Gaps = 3/93 (3%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           L+P P P+PK   +PK   KP+   +PK   KPKP+ PK   KPK    P  KP P P+P
Sbjct: 232 LKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPKPKPE-PKPVPKPKPIPHPGPKPKPKPDP 290

Query: 216 KPEPPKEPEK---PKEKPPPPPQPQPMPQPPPH 305
           K EP   PE    P  +P P P+P+P P+P P+
Sbjct: 291 KLEPKPHPEPKPHPMPEPEPKPKPEPKPEPKPY 323

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 42/92 (45%), Positives = 51/92 (55%), Gaps = 3/92 (3%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           L P P PKP    +PK   +PK   KP+ + KP+PK   +PE PK   KPK +P P P+P
Sbjct: 216 LHPKPEPKPHPEPEPKLKPEPKPEPKPEPEPKPEPKPEPKPE-PKPYPKPKPEPKPVPKP 274

Query: 216 KPEP---PKEPEKPKEKPPPPPQPQPMPQPPP 302
           KP P   PK   KP  K  P P P+P P P P
Sbjct: 275 KPIPHPGPKPKPKPDPKLEPKPHPEPKPHPMP 306

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 37/71 (52%), Positives = 46/71 (64%), Gaps = 5/71 (7%)
 Frame = +3

Query: 108 EKPKEQE-KPKPKK-PKEPEKPKEPEKPKEKPPPPPEPKPE--PPKEPE-KPKEKPPPPP 272
           EKP E E KPKPK  PK   KP+   +PK +P P PEPKPE  P  +PE KP  +P P P
Sbjct: 51  EKPPELEPKPKPKPHPKHESKPEPKPEPKPEPKPYPEPKPETKPELKPEPKPNPEPKPEP 110

Query: 273 QPQPMPQPPPH 305
           +P+P P+P P+
Sbjct: 111 KPEPKPEPKPY 121

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 34/78 (43%), Positives = 40/78 (51%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P PKP    +PK   +PK    P+ + KPKP+   EP+   EP KPK KP P P PKP
Sbjct: 282 PKPKPKPDPKLEPKPHPEPKPHPMPEPEPKPKPEPKPEPKPYPEP-KPKLKPEPKPGPKP 340

Query: 222 EPPKEPEKPKEKPPPPPQ 275
             P    KP   PP   Q
Sbjct: 341 IAPPNKHKPPHMPPATNQ 358

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 33/81 (40%), Positives = 40/81 (49%), Gaps = 1/81 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEPK 218
           P P PKPK    PK   KP    KP    +P+PK   EP+ +PK   +PK K  P P+P 
Sbjct: 278 PHPGPKPKPKPDPKLEPKPHPEPKPHPMPEPEPKPKPEPKPEPKPYPEPKPKLKPEPKPG 337

Query: 219 PEPPKEPEKPKEKPPPPPQPQ 281
           P+P   P K K    PP   Q
Sbjct: 338 PKPIAPPNKHKPPHMPPATNQ 358

[59][TOP]
>UniRef100_UPI00017B30F4 UPI00017B30F4 related cluster n=1 Tax=Tetraodon nigroviridis
           RepID=UPI00017B30F4
          Length = 501

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 40/98 (40%), Positives = 63/98 (64%), Gaps = 7/98 (7%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPK-------PKKPKEPEKPKEPEKPKEKPP 200
           P PPP+PK+P++P+ P KP +P++P    +PK       P+KP +P++P+ P+KP +   
Sbjct: 55  PHPPPRPKDPQRPQPPQKPSDPQRPHPPPRPKDPQRPQPPQKPSDPQRPQPPQKPSDPQR 114

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
           P P P+P+ P+ P+ P +KP  P +PQP PQ P   P+
Sbjct: 115 PHPPPRPKDPQRPQ-PPQKPSDPQRPQP-PQKPNDYPS 150

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 37/96 (38%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPK-PKKPKEPEKPKEPEKPKEKP 197
           KS +   P PP KP +P++P+ P KP +P++P    +PK P++P+ P+KP +P++P   P
Sbjct: 24  KSGDPQRPQPPQKPSDPQRPQPPQKPSDPQRPHPPPRPKDPQRPQPPQKPSDPQRPHPPP 83

Query: 198 PPPPEPKPEPPKEPEKP-KEKPPPPPQPQPMPQPPP 302
            P    +P+PP++P  P + +PP  P     P PPP
Sbjct: 84  RPKDPQRPQPPQKPSDPQRPQPPQKPSDPQRPHPPP 119

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 36/89 (40%), Positives = 60/89 (67%), Gaps = 3/89 (3%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPK-PKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           P PP KP +P++P  P +PK+P++P+  +KP  P++P  P +PK+P++P+    P    +
Sbjct: 43  PQPPQKPSDPQRPHPPPRPKDPQRPQPPQKPSDPQRPHPPPRPKDPQRPQPPQKPSDPQR 102

Query: 219 PEPPKEPEKPKEKPPPPPQPQ--PMPQPP 299
           P+PP++P  P ++P PPP+P+    PQPP
Sbjct: 103 PQPPQKPSDP-QRPHPPPRPKDPQRPQPP 130

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 31/86 (36%), Positives = 52/86 (60%), Gaps = 9/86 (10%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPK-------PKKPKEPEKPKEPEKPKE--K 194
           P PPP+PK+P++P+ P KP +P++P+  +KP        P +PK+P++P+ P+KP +  +
Sbjct: 79  PHPPPRPKDPQRPQPPQKPSDPQRPQPPQKPSDPQRPHPPPRPKDPQRPQPPQKPSDPQR 138

Query: 195 PPPPPEPKPEPPKEPEKPKEKPPPPP 272
           P PP +P   P  + E   +    PP
Sbjct: 139 PQPPQKPNDYPSCDVESNDKIQCGPP 164

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 21/54 (38%), Positives = 39/54 (72%), Gaps = 1/54 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPK-PKKPKEPEKPKEPEKPKEKP 197
           +P  P +P+ P+KP +P +P  P +PK+ ++P+ P+KP +P++P+ P+KP + P
Sbjct: 96  KPSDPQRPQPPQKPSDPQRPHPPPRPKDPQRPQPPQKPSDPQRPQPPQKPNDYP 149

[60][TOP]
>UniRef100_B7HBH1 Cell surface protein n=1 Tax=Bacillus cereus B4264 RepID=B7HBH1_BACC4
          Length = 3409

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/107 (48%), Positives = 73/107 (68%), Gaps = 13/107 (12%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            +K  +  EP  P  KP++P+ PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++
Sbjct: 3240 VKPEDPKEPKEPEVKPEDPKDPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3299

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
            PKE        K P  PE KPE PKEP++P+ KP  P +P+  P+ P
Sbjct: 3300 PKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEEPKEPEVKPENP 3346

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/111 (47%), Positives = 75/111 (67%), Gaps = 13/111 (11%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            +K  +  EP  P  KP++P++PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++
Sbjct: 3188 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3247

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PKE        K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3248 PKEPEVKPEDPKDPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3297

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 50/100 (50%), Positives = 70/100 (70%), Gaps = 12/100 (12%)
 Frame = +3

Query: 48   PPPKPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEKPKE-------- 191
            P  KP++P++PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++PKE        
Sbjct: 3160 PEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDP 3219

Query: 192  KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3220 KEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3258

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/111 (47%), Positives = 74/111 (66%), Gaps = 13/111 (11%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            +K  +  EP  P  KP++P++PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++
Sbjct: 3162 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3221

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PKE        K P  PE KPE PKEP++P+ KP  P  P+  P+  P  P
Sbjct: 3222 PKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKDPKE-PEVKPEDP 3271

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/111 (47%), Positives = 74/111 (66%), Gaps = 13/111 (11%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            +K  +  EP  P  KP++P++PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P+ 
Sbjct: 3201 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKD 3260

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PKE        K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3261 PKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3310

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/111 (47%), Positives = 74/111 (66%), Gaps = 13/111 (11%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            +K  +  EP  P  KP++P++PKEP VKP++P++PKE E KP+ PK PKEPE KP++P++
Sbjct: 3214 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKDPKEPEVKPEDPKE 3273

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PKE        K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3274 PKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3323

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/111 (45%), Positives = 71/111 (63%), Gaps = 19/111 (17%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE-KPKEPVKPKEPE-KPKEQEKPK--------PKKPKEPE-KPKEPEK 182
            ++P  P +PKEPE KP++P +PKEPE KP++ + PK        PK+PKEPE KP++P++
Sbjct: 3227 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKDPKEPEVKPEDPKEPKEPEVKPEDPKE 3286

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PKE        K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3287 PKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEEP 3336

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 50/111 (45%), Positives = 72/111 (64%), Gaps = 19/111 (17%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE-KPKEPVKPKEPE-KPKEQEKPK--------PKKPKEPE-KPKEPEK 182
            ++P  P +PKEPE KP++P +PKEPE KP++ ++PK        PK+PKEPE KP++P++
Sbjct: 3175 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3234

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PKE        K P  PE KPE PK+P++P+ KP  P +P+  P+  P  P
Sbjct: 3235 PKEPEVKPEDPKEPKEPEVKPEDPKDPKEPEVKPEDPKEPKE-PEVKPEDP 3284

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 46/92 (50%), Positives = 65/92 (70%), Gaps = 6/92 (6%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE-KPKEPVKPKEPE-KPKEQEKPKPK--KPKEPEKPKEPE-KPKE-KP 197
            ++P  P +PKEPE KP++P +PKEPE KP++ ++PK    KP++P++PKEPE KP++ K 
Sbjct: 3266 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3325

Query: 198  PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQ 293
            P  PE KPE PKEPE   E P  P +P+  P+
Sbjct: 3326 PKEPEVKPEEPKEPEVKPENPKEPKEPEVKPE 3357

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 48/105 (45%), Positives = 66/105 (62%), Gaps = 19/105 (18%)
 Frame = +3

Query: 54   PKPKEPEK-PKEPVKPKEPE-KPKEQEKPK--------PKKPKEPE-KPKEPEKPKE--- 191
            PK KE  K P++P +PKEPE KP++ ++PK        PK+PKEPE KP++P++PKE   
Sbjct: 3142 PKTKEDFKIPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEV 3201

Query: 192  -----KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
                 K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3202 KPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3245

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/101 (45%), Positives = 60/101 (59%), Gaps = 9/101 (8%)
 Frame = +3

Query: 36   LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKE------- 191
            LEP     PK  E  K P  PKEP++P E +   PK+PKEPE KP++P++PKE       
Sbjct: 3134 LEPTVTILPKTKEDFKIPEDPKEPKEP-EVKPEDPKEPKEPEVKPEDPKEPKEPEVKPED 3192

Query: 192  -KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3193 PKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3232

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 43/83 (51%), Positives = 57/83 (68%), Gaps = 3/83 (3%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE-KPKEPVKPKEPE-KPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPP 206
            ++P  P +PKEPE KP++P +PKEPE KP++     PK+PKEPE KP+EP++P+ KP  P
Sbjct: 3292 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPED-----PKEPKEPEVKPEEPKEPEVKPENP 3346

Query: 207  PEPKPEPPKEPEKPKEKPPPPPQ 275
             EPK EP  +PE   EK    PQ
Sbjct: 3347 KEPK-EPEVKPEVRLEKLIKEPQ 3368

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 37/85 (43%), Positives = 52/85 (61%), Gaps = 5/85 (5%)
 Frame = +3

Query: 72   EKPKEPVKPKEPEKPKEQEKPK----PKKPKEPE-KPKEPEKPKEKPPPPPEPKPEPPKE 236
            +K   P++P     PK +E  K    PK+PKEPE KP++P++PKE     PE KPE PKE
Sbjct: 3128 DKINPPLEPTVTILPKTKEDFKIPEDPKEPKEPEVKPEDPKEPKE-----PEVKPEDPKE 3182

Query: 237  PEKPKEKPPPPPQPQPMPQPPPHIP 311
            P++P+ KP  P +P+  P+  P  P
Sbjct: 3183 PKEPEVKPEDPKEPKE-PEVKPEDP 3206

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 32/79 (40%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE-KPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
            ++P  P +PKEPE KP++P +PKEPE   E+ K    KP+ P++PKEPE   E       
Sbjct: 3305 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEEPKEPEVKPENPKEPKEPEVKPEVRLEKLI 3364

Query: 213  PKPEPPKEPEKPKEKPPPP 269
             +P+   E E PK     P
Sbjct: 3365 KEPQVKTERELPKTGAASP 3383

[61][TOP]
>UniRef100_Q9M5X3 Proline-rich protein RiP-15 (Fragment) n=1 Tax=Oryza sativa
           RepID=Q9M5X3_ORYSA
          Length = 170

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 45/92 (48%), Positives = 56/92 (60%), Gaps = 1/92 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           E PP P+PK   KP     PK   KP+ + KP PK   +PE   EP+ +PK +P P PEP
Sbjct: 40  EKPPEPEPKPKPKPHPKPTPKPKPKPEPEPKPVPKPEPKPEPKPEPKPEPKPEPKPYPEP 99

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           KPEP  EP KP+ KP P P+P+P P+P P  P
Sbjct: 100 KPEPKPEP-KPEPKPEPKPEPEPKPEPKPKKP 130

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 46/94 (48%), Positives = 60/94 (63%), Gaps = 5/94 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPP-PE 212
           +P P P+PK   KP+   +PK   +PK + KP+PK   +PE   EPE KP+ KP  P PE
Sbjct: 74  KPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPKKPKPE 133

Query: 213 PKPEPPKEPEKPK---EKPPPPPQPQPMPQPPPH 305
           PKP P K+PEKPK   + P P P+P+P P+P PH
Sbjct: 134 PKPLPKKKPEKPKPEPKAPKPKPKPKPKPKPKPH 167

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 42/89 (47%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+PK   KP    KP+   +PK + KP+PK   EP+   +P+KPK +P P P+ K
Sbjct: 82  KPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPKKPKPEPKPLPKKK 141

Query: 219 PEPPK-EPEKPKEKPPPPPQPQPMPQPPP 302
           PE PK EP+ PK KP P P+P+P P P P
Sbjct: 142 PEKPKPEPKAPKPKPKPKPKPKPKPHPKP 170

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 46/92 (50%), Positives = 55/92 (59%), Gaps = 1/92 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKPK   KP    KPK   +PK   KP+PK   +PE   EP+ +PK  P P PEP
Sbjct: 44  EPEPKPKPKPHPKPTPKPKPKPEPEPKPVPKPEPKPEPKPEPKPEPKPEPKPYPEPKPEP 103

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           KPEP  EP KP+ KP P P+P+P P+ P   P
Sbjct: 104 KPEPKPEP-KPEPKPEPEPKPEPKPKKPKPEP 134

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 44/97 (45%), Positives = 57/97 (58%), Gaps = 6/97 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           +P P PKPK   +PK   KP+   +PK + KP+PK +PK   +PK   KP+ KP P PEP
Sbjct: 56  KPTPKPKPKPEPEPKPVPKPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEP 115

Query: 216 KPEPPKEPEKPKEKPPPPPQPQP-----MPQPPPHIP 311
           KPEP  +PE   +KP P P+P P      P+P P  P
Sbjct: 116 KPEPEPKPEPKPKKPKPEPKPLPKKKPEKPKPEPKAP 152

[62][TOP]
>UniRef100_Q9KK25 Surface protein PspC n=1 Tax=Streptococcus pneumoniae
           RepID=Q9KK25_STRPN
          Length = 763

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 53/104 (50%), Positives = 65/104 (62%), Gaps = 12/104 (11%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK-----EPEKP 185
           LE P P    +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK     +PEKP
Sbjct: 553 LEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 611

Query: 186 K-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           K E  P P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 612 KPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 655

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 55/117 (47%), Positives = 69/117 (58%), Gaps = 24/117 (20%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK----- 170
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK     
Sbjct: 570 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 628

Query: 171 EPEKPK-EKPPPPPEPKPEPPKEPEKPK-------EKPPPPPQPQ---PMPQPPPHI 308
           +PEKPK E  P P +PKPE   +PEKPK       EKP P  +PQ   P P+  P +
Sbjct: 629 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQLEKPKPEVKPQLEKPKPEVKPQL 685

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/114 (45%), Positives = 66/114 (57%), Gaps = 22/114 (19%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPK----------EPEKPKEQEKPKPKKPK-----EPEKPK 170
           LE P P    +PEKPK  VKP+          +PEKPK + KP+P+KPK     +PEKPK
Sbjct: 531 LEKPKPEVKPQPEKPKPEVKPQLEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPK 590

Query: 171 EPEKPK-EKPPPPPEPKPEPPK-----EPEKPK-EKPPPPPQPQPMPQPPPHIP 311
              KP+ EKP P  +P+PE PK     +PEKPK E  P P +P+P  +P P  P
Sbjct: 591 PEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 644

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 51/105 (48%), Positives = 65/105 (61%), Gaps = 13/105 (12%)
 Frame = +3

Query: 36  LEPPPPPKPK-EPEKPKEPVKPKEPEKPKEQ-----EKPKPKKPKEPEKPK-----EPEK 182
           ++P P P+ K + EKPK  VKP +PEKPK +     EKPKP+   +PEKPK     +PEK
Sbjct: 519 MQPSPQPEVKPQLEKPKPEVKP-QPEKPKPEVKPQLEKPKPEVKPQPEKPKPEVKPQPEK 577

Query: 183 PK-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           PK E  P P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 578 PKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 622

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/101 (48%), Positives = 64/101 (63%), Gaps = 10/101 (9%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPKEPEKP 185
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK   KP
Sbjct: 592 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 650

Query: 186 K-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPP 302
           + EKP P  +P+ E PK   KP+ EKP P  +PQ + +P P
Sbjct: 651 QPEKPKPEVKPQLEKPKPEVKPQLEKPKPEVKPQ-LEKPKP 690

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 44/94 (46%), Positives = 58/94 (61%), Gaps = 9/94 (9%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPKEPEKP 185
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK   KP
Sbjct: 603 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 661

Query: 186 K-EKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQP 284
           + EKP P  +P+ E PK   KP+ + P P   +P
Sbjct: 662 QLEKPKPEVKPQLEKPKPEVKPQLEKPKPDNSKP 695

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 43/99 (43%), Positives = 58/99 (58%), Gaps = 8/99 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-EPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKPPPPPE 212
           + P  P  K+P  PK  ++P  +PE   + EKPKP+   +PEKPK   KP+ EKP P  +
Sbjct: 502 DTPKEPGNKKPSAPKPGMQPSPQPEVKPQLEKPKPEVKPQPEKPKPEVKPQLEKPKPEVK 561

Query: 213 PKPEPPK-----EPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           P+PE PK     +PEKPK E  P P +P+P  +P P  P
Sbjct: 562 PQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 600

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/100 (44%), Positives = 56/100 (56%), Gaps = 11/100 (11%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPK----EPEKPKEQEKPKPKKPKEPEKPK-----EPEKPK-EK 194
           P  PKP     P+  VKP+    +PE   + EKPKP+   + EKPK     +PEKPK E 
Sbjct: 512 PSAPKPGMQPSPQPEVKPQLEKPKPEVKPQPEKPKPEVKPQLEKPKPEVKPQPEKPKPEV 571

Query: 195 PPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
            P P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 572 KPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 611

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 38/81 (46%), Positives = 50/81 (61%), Gaps = 4/81 (4%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKP 197
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+ +KPK PE   + EKPK E  
Sbjct: 625 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQLEKPK-PEVKPQLEKPKPEVK 682

Query: 198 PPPPEPKPEPPKEPEKPKEKP 260
           P   +PKP+  K P+   +KP
Sbjct: 683 PQLEKPKPDNSK-PQADDKKP 702

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 32/79 (40%), Positives = 42/79 (53%), Gaps = 4/79 (5%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPK-EPEKPKEKP 197
           E+   P  PKP+   +PEKPK  VKP + EKPK + KP+ +KPK   KP+ E  KP    
Sbjct: 636 EVKPQPEKPKPEVKPQPEKPKPEVKP-QLEKPKPEVKPQLEKPKPEVKPQLEKPKPDNSK 694

Query: 198 PPPPEPKPEPPKEPEKPKE 254
           P   + KP       K K+
Sbjct: 695 PQADDKKPSTTNNLSKDKQ 713

[63][TOP]
>UniRef100_Q9KK12 Surface protein PspC n=1 Tax=Streptococcus pneumoniae
           RepID=Q9KK12_STRPN
          Length = 584

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/104 (50%), Positives = 65/104 (62%), Gaps = 12/104 (11%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK-----EPEKP 185
           LE P P    +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK     +PEKP
Sbjct: 330 LEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 388

Query: 186 K-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           K E  P P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 389 KPEVNPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 432

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 54/109 (49%), Positives = 68/109 (62%), Gaps = 15/109 (13%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK----- 170
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK     
Sbjct: 347 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVNPQPEKPKPEVKP 405

Query: 171 EPEKPKEKPPPPPE-PKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           +PEKPK +  P PE PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 406 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 454

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 54/109 (49%), Positives = 68/109 (62%), Gaps = 15/109 (13%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK----- 170
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK     
Sbjct: 391 EVNPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 449

Query: 171 EPEKPK-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           +PEKPK E  P P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 450 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 498

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/109 (48%), Positives = 67/109 (61%), Gaps = 15/109 (13%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK----- 170
           E+   P  PKP+   +PEKPK  V P +PEKPK + KP+P+KPK     +PEKPK     
Sbjct: 369 EVKPQPEKPKPEVKPQPEKPKPEVNP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 427

Query: 171 EPEKPK-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           +PEKPK E  P P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 428 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 476

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/109 (48%), Positives = 68/109 (62%), Gaps = 15/109 (13%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPKEPEKP 185
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK   KP
Sbjct: 402 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 460

Query: 186 K-EKPPPPPEPKPEPPK-----EPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           + EKP P  +P+PE PK     +PEKPK E  P P +P+P  +P P  P
Sbjct: 461 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 509

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 51/100 (51%), Positives = 65/100 (65%), Gaps = 11/100 (11%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPKEPEKP 185
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK   KP
Sbjct: 413 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 471

Query: 186 K-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQP-MPQP 296
           + EKP P  +P+PE PK   KP+ EKP P  +PQP  P+P
Sbjct: 472 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKP 511

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/95 (51%), Positives = 61/95 (64%), Gaps = 5/95 (5%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKP 197
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK PE   +PEKPK E  
Sbjct: 424 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPK-PEVKPQPEKPKPEVK 481

Query: 198 PPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPP 299
           P P +PKPE   +PEKPK E  P P +P+P    P
Sbjct: 482 PQPEKPKPEVKPQPEKPKPEVKPQPEKPKPDNSKP 516

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 47/94 (50%), Positives = 59/94 (62%), Gaps = 4/94 (4%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKP 197
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK PE   +PEKPK E  
Sbjct: 435 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPK-PEVKPQPEKPKPEVK 492

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           P P +PKPE   +PEKPK   P   +PQ   + P
Sbjct: 493 PQPEKPKPEVKPQPEKPK---PDNSKPQADDKKP 523

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 36/81 (44%), Positives = 46/81 (56%), Gaps = 3/81 (3%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP 200
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK PE   +PEKPK    
Sbjct: 457 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPK-PEVKPQPEKPKPDNS 514

Query: 201 PPPEPKPEPPKEPEKPKEKPP 263
            P     +P       K+K P
Sbjct: 515 KPQADDKKPSTTNNLSKDKQP 535

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 42/115 (36%), Positives = 56/115 (48%), Gaps = 24/115 (20%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-EPE---KPKEQ-------------------EKPKPKKP 149
           + P  P  K+P  PK  ++P  +PE   +PK Q                   EKPKP+  
Sbjct: 279 DTPKEPGNKKPSAPKTGMQPSPQPEVKPQPKNQNQRLNRNQKNQNQRLNRNLEKPKPEVK 338

Query: 150 KEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
            +PEKPK   KP+     P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 339 PQPEKPKPEVKPQ-----PEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 388

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 34/88 (38%), Positives = 45/88 (51%), Gaps = 10/88 (11%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-EPEKPKEPEKPK--- 188
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK +  KP+  +K     
Sbjct: 468 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPDNSKPQADDKKPSTT 526

Query: 189 ---EKPPPPPEPKPEPPKEPEKPKEKPP 263
               K   P        K   KPK+  P
Sbjct: 527 NNLSKDKQPSNQASTNEKATNKPKKSLP 554

[64][TOP]
>UniRef100_Q9KK09 Surface protein PcpC n=1 Tax=Streptococcus pneumoniae
           RepID=Q9KK09_STRPN
          Length = 580

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/104 (50%), Positives = 65/104 (62%), Gaps = 12/104 (11%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK-----EPEKP 185
           LE P P    +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK     +PEKP
Sbjct: 326 LEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 384

Query: 186 K-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           K E  P P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 385 KPEVNPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 428

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 54/109 (49%), Positives = 68/109 (62%), Gaps = 15/109 (13%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK----- 170
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK     
Sbjct: 343 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVNPQPEKPKPEVKP 401

Query: 171 EPEKPKEKPPPPPE-PKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           +PEKPK +  P PE PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 402 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 450

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 54/109 (49%), Positives = 68/109 (62%), Gaps = 15/109 (13%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK----- 170
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK     
Sbjct: 387 EVNPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 445

Query: 171 EPEKPK-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           +PEKPK E  P P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 446 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 494

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/109 (48%), Positives = 67/109 (61%), Gaps = 15/109 (13%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK----- 170
           E+   P  PKP+   +PEKPK  V P +PEKPK + KP+P+KPK     +PEKPK     
Sbjct: 365 EVKPQPEKPKPEVKPQPEKPKPEVNP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 423

Query: 171 EPEKPK-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           +PEKPK E  P P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 424 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 472

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/109 (48%), Positives = 68/109 (62%), Gaps = 15/109 (13%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPKEPEKP 185
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK   KP
Sbjct: 398 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 456

Query: 186 K-EKPPPPPEPKPEPPK-----EPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           + EKP P  +P+PE PK     +PEKPK E  P P +P+P  +P P  P
Sbjct: 457 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 505

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 51/100 (51%), Positives = 65/100 (65%), Gaps = 11/100 (11%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPKEPEKP 185
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK   KP
Sbjct: 409 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 467

Query: 186 K-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQP-MPQP 296
           + EKP P  +P+PE PK   KP+ EKP P  +PQP  P+P
Sbjct: 468 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKP 507

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/95 (51%), Positives = 61/95 (64%), Gaps = 5/95 (5%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKP 197
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK PE   +PEKPK E  
Sbjct: 420 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPK-PEVKPQPEKPKPEVK 477

Query: 198 PPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPP 299
           P P +PKPE   +PEKPK E  P P +P+P    P
Sbjct: 478 PQPEKPKPEVKPQPEKPKPEVKPQPEKPKPDNSKP 512

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 47/94 (50%), Positives = 59/94 (62%), Gaps = 4/94 (4%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKP 197
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK PE   +PEKPK E  
Sbjct: 431 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPK-PEVKPQPEKPKPEVK 488

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           P P +PKPE   +PEKPK   P   +PQ   + P
Sbjct: 489 PQPEKPKPEVKPQPEKPK---PDNSKPQADDKKP 519

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 36/81 (44%), Positives = 46/81 (56%), Gaps = 3/81 (3%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP 200
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK PE   +PEKPK    
Sbjct: 453 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPK-PEVKPQPEKPKPDNS 510

Query: 201 PPPEPKPEPPKEPEKPKEKPP 263
            P     +P       K+K P
Sbjct: 511 KPQADDKKPSTTNNLSKDKQP 531

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 42/115 (36%), Positives = 56/115 (48%), Gaps = 24/115 (20%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-EPE---KPKEQ-------------------EKPKPKKP 149
           + P  P  K+P  PK  ++P  +PE   +PK Q                   EKPKP+  
Sbjct: 275 DTPKEPGNKKPSAPKTGMQPSPQPEVKPQPKNQNQRLNRNQKNQNQRLNRNLEKPKPEVK 334

Query: 150 KEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
            +PEKPK   KP+     P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 335 PQPEKPKPEVKPQ-----PEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 384

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 34/88 (38%), Positives = 45/88 (51%), Gaps = 10/88 (11%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-EPEKPKEPEKPK--- 188
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK +  KP+  +K     
Sbjct: 464 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPDNSKPQADDKKPSTT 522

Query: 189 ---EKPPPPPEPKPEPPKEPEKPKEKPP 263
               K   P        K   KPK+  P
Sbjct: 523 NNLSKDKQPSNQASTNEKATNKPKKSLP 550

[65][TOP]
>UniRef100_Q9KK45 Surface protein PspC n=1 Tax=Streptococcus pneumoniae
           RepID=Q9KK45_STRPN
          Length = 587

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 54/109 (49%), Positives = 68/109 (62%), Gaps = 15/109 (13%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK----- 170
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK     
Sbjct: 394 EVNPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 452

Query: 171 EPEKPK-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           +PEKPK E  P P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 453 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 501

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 52/104 (50%), Positives = 64/104 (61%), Gaps = 12/104 (11%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK-----EPEKP 185
           LE P P    +PEKPK  V P +PEKPK + KP+P+KPK     +PEKPK     +PEKP
Sbjct: 377 LEKPKPEVKPQPEKPKPEVNP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 435

Query: 186 K-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           K E  P P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 436 KPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 479

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/109 (48%), Positives = 68/109 (62%), Gaps = 15/109 (13%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPKEPEKP 185
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK   KP
Sbjct: 405 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 463

Query: 186 K-EKPPPPPEPKPEPPK-----EPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           + EKP P  +P+PE PK     +PEKPK E  P P +P+P  +P P  P
Sbjct: 464 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 512

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 52/104 (50%), Positives = 64/104 (61%), Gaps = 12/104 (11%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK-----EPEKP 185
           LE P P    +PEKPK  VKP +PEKPK + KP+P+KPK     + EKPK     +PEKP
Sbjct: 333 LEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQLEKPKPEVKPQPEKP 391

Query: 186 K-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           K E  P P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 392 KPEVNPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 435

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/109 (48%), Positives = 67/109 (61%), Gaps = 15/109 (13%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK----- 170
           E+   P  PKP+   +PEKPK  VKP + EKPK + KP+P+KPK     +PEKPK     
Sbjct: 350 EVKPQPEKPKPEVKPQPEKPKPEVKP-QLEKPKPEVKPQPEKPKPEVNPQPEKPKPEVKP 408

Query: 171 EPEKPKEKPPPPPE-PKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           +PEKPK +  P PE PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 409 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 457

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 51/100 (51%), Positives = 65/100 (65%), Gaps = 11/100 (11%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPKEPEKP 185
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK   KP
Sbjct: 416 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 474

Query: 186 K-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQP-MPQP 296
           + EKP P  +P+PE PK   KP+ EKP P  +PQP  P+P
Sbjct: 475 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKP 514

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/95 (51%), Positives = 61/95 (64%), Gaps = 5/95 (5%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKP 197
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK PE   +PEKPK E  
Sbjct: 427 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPK-PEVKPQPEKPKPEVK 484

Query: 198 PPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPP 299
           P P +PKPE   +PEKPK E  P P +P+P    P
Sbjct: 485 PQPEKPKPEVKPQPEKPKPEVKPQPEKPKPDNSKP 519

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/96 (52%), Positives = 62/96 (64%), Gaps = 5/96 (5%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP 200
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK   KP +PEKPK +  
Sbjct: 383 EVKPQPEKPKPEVNPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVK 440

Query: 201 PPPE-PKPEPPKEPEKPKEKPPPPPQPQ-PMPQPPP 302
           P PE PKPE   +PEKPK  P   PQP+ P P+  P
Sbjct: 441 PQPEKPKPEVKPQPEKPK--PEVKPQPEKPKPEVKP 474

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 47/94 (50%), Positives = 59/94 (62%), Gaps = 4/94 (4%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKP 197
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK PE   +PEKPK E  
Sbjct: 438 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPK-PEVKPQPEKPKPEVK 495

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           P P +PKPE   +PEKPK   P   +PQ   + P
Sbjct: 496 PQPEKPKPEVKPQPEKPK---PDNSKPQADDKKP 526

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 36/81 (44%), Positives = 46/81 (56%), Gaps = 3/81 (3%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP 200
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK PE   +PEKPK    
Sbjct: 460 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPK-PEVKPQPEKPKPDNS 517

Query: 201 PPPEPKPEPPKEPEKPKEKPP 263
            P     +P       K+K P
Sbjct: 518 KPQADDKKPSTTNNLSKDKQP 538

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 43/120 (35%), Positives = 57/120 (47%), Gaps = 30/120 (25%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-EPE---KPKEQ-------------------EKPKPKKP 149
           + P  P  K+P  PK  ++P  +PE   +PK Q                   EKPKP+  
Sbjct: 282 DTPKEPGNKKPSAPKTGMQPSPQPEVKPQPKNQNQRLNRNQKNQNQRLNRNLEKPKPEVK 341

Query: 150 KEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPK-------EKPPPPPQPQPMPQPPPHI 308
            +PEKPK   KP+     P +PKPE   +PEKPK       EKP P  +PQP  +P P +
Sbjct: 342 PQPEKPKPEVKPQ-----PEKPKPEVKPQPEKPKPEVKPQLEKPKPEVKPQP-EKPKPEV 395

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 34/88 (38%), Positives = 45/88 (51%), Gaps = 10/88 (11%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-EPEKPKEPEKPK--- 188
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK +  KP+  +K     
Sbjct: 471 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPDNSKPQADDKKPSTT 529

Query: 189 ---EKPPPPPEPKPEPPKEPEKPKEKPP 263
               K   P        K   KPK+  P
Sbjct: 530 NNLSKDKQPSNQASTNEKATNKPKKSLP 557

[66][TOP]
>UniRef100_A7RC55 Putative uncharacterized protein C602L n=1 Tax=Paramecium bursaria
           Chlorella virus AR158 RepID=A7RC55_PBCVA
          Length = 362

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 51/99 (51%), Positives = 54/99 (54%), Gaps = 2/99 (2%)
 Frame = +3

Query: 24  SIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKP-KKPKEPEKPKEPEKPKEKPP 200
           S E  EP P PKPK   KPK   KPK   KPK   KPKP  KPK   KP     PK  P 
Sbjct: 119 SDEYTEPAPKPKPKPAPKPKPAPKPKPAPKPKPAPKPKPAPKPKPAPKP----APKPAPE 174

Query: 201 PPPEPKPEP-PKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
           P PEP PEP PK   +P  KP P P P+P P+P P  PA
Sbjct: 175 PAPEPAPEPVPKPAPEPAPKPAPEPVPEPAPEPAPVRPA 213

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 33/80 (41%), Positives = 38/80 (47%), Gaps = 7/80 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-------KPKEKP 197
           +P P PKPK   KPK   KPK   KPK   KP PK   EP     PE       +P  KP
Sbjct: 136 KPKPAPKPKPAPKPKPAPKPKPAPKPKPAPKPAPKPAPEPAPEPAPEPVPKPAPEPAPKP 195

Query: 198 PPPPEPKPEPPKEPEKPKEK 257
            P P P+P P   P +P  +
Sbjct: 196 APEPVPEPAPEPAPVRPARR 215

[67][TOP]
>UniRef100_Q8LLU1 Proline-rich protein (Fragment) n=1 Tax=Saccharum officinarum
           RepID=Q8LLU1_SACOF
          Length = 164

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 48/95 (50%), Positives = 58/95 (61%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEK---PKEQEKPKPKKPKEPEKPKEPEK---PKEKP 197
           EP P P+PK EP+   EP+   EP+    PK + KPKP+   +PE   EPE    PK +P
Sbjct: 60  EPQPKPEPKPEPQPQPEPLPKPEPQPKPTPKPEPKPKPEPVPKPEPKPEPEPKPHPKPEP 119

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P PEPKPEP  EP KPK KP P P+P P P+P P
Sbjct: 120 KPEPEPKPEPKPEP-KPKPKPEPKPEPLPKPEPKP 153

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 42/89 (47%), Positives = 55/89 (61%), Gaps = 2/89 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEPK 218
           P P P+PK   KP+   +P+   KP+ Q KP PK +PK   +P    +PK +P P P PK
Sbjct: 57  PQPEPQPKPEPKPEPQPQPEPLPKPEPQPKPTPKPEPKPKPEPVPKPEPKPEPEPKPHPK 116

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EPE KP+ KP P P+P+P P+P P
Sbjct: 117 PEPKPEPEPKPEPKPEPKPKPKPEPKPEP 145

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 42/89 (47%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P PK   +PK   KP+   KP+   KP+PK   EP+   +PE PK +P P PEPK
Sbjct: 72  QPQPEPLPKPEPQPKPTPKPEPKPKPEPVPKPEPKPEPEPKPHPKPE-PKPEPEPKPEPK 130

Query: 219 PEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP PK   +PK +P P P+P+P P+P P
Sbjct: 131 PEPKPKPKPEPKPEPLPKPEPKPEPKPEP 159

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 41/86 (47%), Positives = 55/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPK 218
           P P P+PK   KP+   KP+   KP+ + +P+PK   +PE   EPE KP+ KP P P+PK
Sbjct: 79  PKPEPQPKPTPKPEPKPKPEPVPKPEPKPEPEPKPHPKPEPKPEPEPKPEPKPEPKPKPK 138

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQP 296
           PEP  EP  PK +P P P+P+P P+P
Sbjct: 139 PEPKPEP-LPKPEPKPEPKPEPKPEP 163

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 42/84 (50%), Positives = 52/84 (61%), Gaps = 1/84 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P PK   KPK    PK   KP+ + KP PK   +PE   +PE KP+ KP P PEP
Sbjct: 82  EPQPKPTPKPEPKPKPEPVPKPEPKPEPEPKPHPKPEPKPEPEPKPEPKPEPKPKPKPEP 141

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPM 287
           KPEP  +PE PK +P P P+P+P+
Sbjct: 142 KPEPLPKPE-PKPEPKPEPKPEPL 164

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 38/78 (48%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = +3

Query: 72  EKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPE-KP 248
           E P+   +PK   KP+ Q +P+P    EP+ PK   KP+ KP P P PKPEP  EPE KP
Sbjct: 55  ELPQPEPQPKPEPKPEPQPQPEPLPKPEPQ-PKPTPKPEPKPKPEPVPKPEPKPEPEPKP 113

Query: 249 KEKPPPPPQPQPMPQPPP 302
             KP P P+P+P P+P P
Sbjct: 114 HPKPEPKPEPEPKPEPKP 131

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 31/66 (46%), Positives = 41/66 (62%)
 Frame = +3

Query: 108 EKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPM 287
           E P+ + +PKP+   EP+   EP  PK +P P P PKPEP     KPK +P P P+P+P 
Sbjct: 55  ELPQPEPQPKPEPKPEPQPQPEP-LPKPEPQPKPTPKPEP-----KPKPEPVPKPEPKPE 108

Query: 288 PQPPPH 305
           P+P PH
Sbjct: 109 PEPKPH 114

[68][TOP]
>UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J4Y2_HUMAN
          Length = 253

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 40/91 (43%), Positives = 43/91 (47%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P  +PPPPP   P
Sbjct: 17  PPPPPPPSPPPPPPSPPPPPPPSPPS----PLPPSPPPPPPPSPPPPPPSQPPPPPSSPP 72

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
            PP  P  P   PP PP P P P PPP +P+
Sbjct: 73  PPPPPPSPPPPPPPSPPPPLPSPPPPPPLPS 103

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 40/90 (44%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPP  P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 2   PPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPP---PPPPPSPPP 58

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP +P  P   PPPPP P   P PPP  P
Sbjct: 59  PPPSQPPPPPSSPPPPPPPPSPPPPPPPSP 88

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 40/92 (43%), Positives = 43/92 (46%), Gaps = 1/92 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P PPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP  +P
Sbjct: 5   PSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQP 64

Query: 222 EPPKEPEKPKEKPPPP-PQPQPMPQPPPHIPA 314
            PP  P  P   PPPP P P P P PPP +P+
Sbjct: 65  PPP--PSSPPPPPPPPSPPPPPPPSPPPPLPS 94

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 42/93 (45%), Positives = 45/93 (48%), Gaps = 1/93 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P   + P  P   PPPPP P P
Sbjct: 26  PPPPPSPPPPPPPSPP-SPLPPSPP----PPPPPSPPPPPPSQPPPPPSSPPPPPPPPSP 80

Query: 222 EPPKEPEKPKEKP-PPPPQPQPMPQPPPHIPAS 317
            PP  P  P   P PPPP P P P PPP +P+S
Sbjct: 81  PPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSS 113

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 41/90 (45%), Positives = 42/90 (46%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P+ P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 159 PPPPPSPPPPLPPPSPLPPPPPSPPH----PLPPSPPPPPPPSPPPPPPPSPPPPPLPSP 214

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             P  P  P   PPPPP P P P PPP  P
Sbjct: 215 PAPSPPSPPL-PPPPPPPPSPPPPPPPSPP 243

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 40/93 (43%), Positives = 40/93 (43%), Gaps = 3/93 (3%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P     P  P  P  P     P P  P  P  P  P  P   PPP P P P
Sbjct: 115 PPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSP 174

Query: 222 EPPKEPEKP---KEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P      PPPPP P P P PPP  P
Sbjct: 175 LPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPP 207

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 41/94 (43%), Positives = 43/94 (45%), Gaps = 4/94 (4%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPP +P P
Sbjct: 8   PPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPP-PSPPPPPPSQPPP 66

Query: 222 ---EPPKEPEKPKEKPPPPPQ-PQPMPQPPPHIP 311
               PP  P  P   PPPPP  P P+P PPP  P
Sbjct: 67  PPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPP 100

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 39/91 (42%), Positives = 40/91 (43%), Gaps = 1/91 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P PPP P  P  P  P  P  P  P     P P  P  P     P      PPPPP P P
Sbjct: 93  PSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPP 152

Query: 222 EPPKEPEKPKEKPPPP-PQPQPMPQPPPHIP 311
            PP  P  P   PPPP P P P+P PPP  P
Sbjct: 153 PPPPSPPPPPPSPPPPLPPPSPLPPPPPSPP 183

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 42/101 (41%), Positives = 42/101 (41%), Gaps = 9/101 (8%)
 Frame = +3

Query: 42  PPPPPKPKEP--EKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP-- 209
           PPPPP P  P    P  P  P  P  P  Q  P P  P  P  P  P  P    PPPP  
Sbjct: 34  PPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLP 93

Query: 210 -----EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
                 P P PP  P  P   PPPPP P P P  PP  P S
Sbjct: 94  SPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPS 134

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 40/91 (43%), Positives = 40/91 (43%), Gaps = 4/91 (4%)
 Frame = +3

Query: 42  PPPPPKPKE--PEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP-- 209
           PPPPP P    P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP  
Sbjct: 82  PPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLL 141

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P P PP  P  P   PPPPP   P P PPP
Sbjct: 142 SPPPPPPSPPPPPPPSPPPPPPSPPPPLPPP 172

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 42/95 (44%), Positives = 42/95 (44%), Gaps = 3/95 (3%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPP  P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 65  PPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPL-PSPPPPPPLPSSPPPPPPSP-P 122

Query: 222 EPPKEPEKPKEKPPPPP---QPQPMPQPPPHIPAS 317
            PP  P  P   PPPPP    P P P PPP  P S
Sbjct: 123 PPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPS 157

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 39/90 (43%), Positives = 39/90 (43%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P     P  P     P P  P  P  P  P  P   PPPPP   P
Sbjct: 74  PPPPPSPPPPPPPSPPPPLPSPPPPP----PLPSPPPPPPLPSSPPPPPPSPPPPPLSPP 129

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P    PPPP P P P PPP  P
Sbjct: 130 PPPPSPPPPPLLSPPPPPPSPPPPPPPSPP 159

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 41/95 (43%), Positives = 42/95 (44%), Gaps = 4/95 (4%)
 Frame = +3

Query: 42  PPPP--PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP-EKPKEKPPPPPE 212
           PPPP  P P  P  P  P+    P  P     P P  P  P  P  P   P   PPPPP 
Sbjct: 122 PPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPS 181

Query: 213 -PKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
            P P PP  P  P   PPPPP P P P P P  PA
Sbjct: 182 PPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPA 216

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 39/92 (42%), Positives = 40/92 (43%), Gaps = 1/92 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPP-PPEPK 218
           PPPPP P  P     P  P  P  P     P P  P  P  P  P  P   PPP PP P 
Sbjct: 129 PPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPP--PPSPPPPLPPPSPLPPPPPSPPHPL 186

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
           P  P  P  P   PPPPP P P P P P  P+
Sbjct: 187 PPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPS 218

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 38/91 (41%), Positives = 40/91 (43%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P+ P  P  P     P P  P  P  P  P  P   PP PP P P
Sbjct: 170 PPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPP--PPSPPPPPLPSPPAPSPPSPPLPPP 227

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
            PP     P   PPPPP   P P PPP  P+
Sbjct: 228 PPP-----PPSPPPPPPPSPPPPSPPPPPPS 253

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 42/95 (44%), Positives = 42/95 (44%), Gaps = 3/95 (3%)
 Frame = +3

Query: 42  PPPPPKPKEPEKP--KEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           PPPPP P  P  P    P  P  P  P     P P     P  P  P  P   PPPPP P
Sbjct: 105 PPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPP-P 163

Query: 216 KPEPPKEPEKPKEKPPP-PPQPQPMPQPPPHIPAS 317
            P PP  P  P   PPP PP P P P PPP  P S
Sbjct: 164 SPPPPLPPPSPLPPPPPSPPHPLP-PSPPPPPPPS 197

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 38/94 (40%), Positives = 39/94 (41%), Gaps = 2/94 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEP--EKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           PPPPP P  P  P  P  P  P    P     P P  P  P  P     P    PPPP P
Sbjct: 96  PPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPP 155

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
              PP  P  P   PPP P P P P PP  +P S
Sbjct: 156 PSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPS 189

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 28/61 (45%), Positives = 29/61 (47%)
 Frame = +3

Query: 132 PKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P P  P  P  P  P  P    PPPP P P PP  P  P   PP PP P P P PPP  P
Sbjct: 3   PPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPP-PSPPPPPP 61

Query: 312 A 314
           +
Sbjct: 62  S 62

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 28/58 (48%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
 Frame = +3

Query: 147 PKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPP-PPQPQPMPQPPPHIPAS 317
           P  P  P  P  P   PPPPP   P PP  P  P   PPP PP P P P PPP  P S
Sbjct: 1   PPPPPSPPPPPPPPSSPPPPP--PPSPPPPPPSPPPPPPPSPPSPLP-PSPPPPPPPS 55

[69][TOP]
>UniRef100_A4REN0 Predicted protein n=1 Tax=Magnaporthe grisea RepID=A4REN0_MAGGR
          Length = 193

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 50/90 (55%), Positives = 61/90 (67%), Gaps = 6/90 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KEKPPPPP 209
           +P  P KP +PEKP +P KP +PEKP + EKP KP+KP +PEKP +PEKP   EKP  P 
Sbjct: 96  KPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPE 155

Query: 210 EP-KPEPPKEPEKP--KEKPPPPPQPQPMP 290
           +P KPE P +PEKP   EKP  P +P P P
Sbjct: 156 KPGKPEKPGKPEKPGKPEKPGKPEKPVPDP 185

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 49/92 (53%), Positives = 61/92 (66%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KEKPPPPP 209
           +P  P KP +PEKP +P KP +PEKP + EKP KP+KP +PEKP +PEKP   EKP  P 
Sbjct: 54  KPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPE 113

Query: 210 EP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           +P KPE P +PEKP   EKP  P +P    +P
Sbjct: 114 KPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKP 145

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 49/92 (53%), Positives = 61/92 (66%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KEKPPPPP 209
           +P  P KP +PEKP +P KP +PEKP + EKP KP+KP +PEKP +PEKP   EKP  P 
Sbjct: 60  KPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPE 119

Query: 210 EP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           +P KPE P +PEKP   EKP  P +P    +P
Sbjct: 120 KPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKP 151

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 49/92 (53%), Positives = 61/92 (66%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KEKPPPPP 209
           +P  P KP +PEKP +P KP +PEKP + EKP KP+KP +PEKP +PEKP   EKP  P 
Sbjct: 66  KPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPE 125

Query: 210 EP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           +P KPE P +PEKP   EKP  P +P    +P
Sbjct: 126 KPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKP 157

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 49/92 (53%), Positives = 61/92 (66%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KEKPPPPP 209
           +P  P KP +PEKP +P KP +PEKP + EKP KP+KP +PEKP +PEKP   EKP  P 
Sbjct: 72  KPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPE 131

Query: 210 EP-KPEPPKEPEKP--KEKPPPPPQPQPMPQP 296
           +P KPE P +PEKP   EKP  P +P    +P
Sbjct: 132 KPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKP 163

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 46/103 (44%), Positives = 65/103 (63%), Gaps = 12/103 (11%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP----KPKKPKEPEKPKEPEKP--KEKPP 200
           +P  P KP++P KP++P KP++P KP++  KP    KP+KP +PEKP +PEKP   EKP 
Sbjct: 81  KPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPG 140

Query: 201 PPPEP-KPEPPKEPEKPKE-----KPPPPPQPQPMPQPPPHIP 311
            P +P KPE P +PEKP +     KP  P +P+   +P   +P
Sbjct: 141 KPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPVP 183

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 43/83 (51%), Positives = 55/83 (66%), Gaps = 6/83 (7%)
 Frame = +3

Query: 66  EPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KEKPPPPPEP-KPEPPK 233
           + +KP +P KP +PEKP + EKP KP+KP +PEKP +PEKP   EKP  P +P KPE P 
Sbjct: 51  DDKKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPG 110

Query: 234 EPEKP--KEKPPPPPQPQPMPQP 296
           +PEKP   EKP  P +P    +P
Sbjct: 111 KPEKPGKPEKPGKPEKPGKPEKP 133

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 42/83 (50%), Positives = 52/83 (62%), Gaps = 6/83 (7%)
 Frame = +3

Query: 66  EPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKP--KEKPPPPPEP-KPEPPK 233
           E E   +  KP +PEKP + EKP KP+KP +PEKP +PEKP   EKP  P +P KPE P 
Sbjct: 45  EDEDKDDDKKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPG 104

Query: 234 EPEKP--KEKPPPPPQPQPMPQP 296
           +PEKP   EKP  P +P    +P
Sbjct: 105 KPEKPGKPEKPGKPEKPGKPEKP 127

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 33/74 (44%), Positives = 47/74 (63%), Gaps = 5/74 (6%)
 Frame = +3

Query: 90  VKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKP--KEKPPPPPEP-KPEPPKEPEKP--KE 254
           V+ ++ +K  +++  KP+KP +PEKP +PEKP   EKP  P +P KPE P +PEKP   E
Sbjct: 42  VRNEDEDKDDDKKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPE 101

Query: 255 KPPPPPQPQPMPQP 296
           KP  P +P    +P
Sbjct: 102 KPGKPEKPGKPEKP 115

[70][TOP]
>UniRef100_C2RF44 Cell surface protein n=1 Tax=Bacillus cereus m1550 RepID=C2RF44_BACCE
          Length = 1522

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 51/102 (50%), Positives = 74/102 (72%), Gaps = 5/102 (4%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            +K  +  EP  P  KP++P++PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++
Sbjct: 1373 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEEPKEPKEPEVKPEDPKE 1432

Query: 183  PKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
            PKE  P  PE KPE PKEP++P+ KP  P +P+  P+  P +
Sbjct: 1433 PKE--PKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEV 1471

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 51/107 (47%), Positives = 71/107 (66%), Gaps = 19/107 (17%)
 Frame = +3

Query: 36   LEPPPPPKPK-EPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEKPKE--- 191
            ++P  P +P+ +PE PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++PKE   
Sbjct: 1353 VKPEDPKEPEVKPEDPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEV 1412

Query: 192  -----KPPPPPEPKPEPPKEPEKPK------EKPPPPPQPQPMPQPP 299
                 K P  PE KPE PKEP++PK      E P  P +P+  P+ P
Sbjct: 1413 KPEEPKEPKEPEVKPEDPKEPKEPKEPEVKPEDPKEPKEPEVKPEDP 1459

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 48/95 (50%), Positives = 65/95 (68%), Gaps = 13/95 (13%)
 Frame = +3

Query: 51   PPKPKEPE-KPKEPVKPK-EPEKPKEQE-KPK-PKKPKEPE-KPKEPEKPKE-------- 191
            P  PKEPE KP++P +P+ +PE PKE E KP+ PK+PKEPE KP++P++PKE        
Sbjct: 1345 PEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDP 1404

Query: 192  KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQP 296
            K P  PE KPE PKEP++P+ KP  P +P+   +P
Sbjct: 1405 KEPKEPEVKPEEPKEPKEPEVKPEDPKEPKEPKEP 1439

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 8/95 (8%)
 Frame = +3

Query: 51   PPKPKEPE-KPKEPVKPK-EPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEPK- 218
            P  PKEPE KP++P +P+ +PE PKE E  KP+ PKEPE KP++P++P+ KP  P EPK 
Sbjct: 1325 PEDPKEPEVKPEDPKEPEVKPEDPKEPEV-KPEDPKEPEVKPEDPKEPEVKPEDPKEPKE 1383

Query: 219  ----PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
                PE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 1384 PEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEEP 1417

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/98 (48%), Positives = 64/98 (65%), Gaps = 11/98 (11%)
 Frame = +3

Query: 51   PPKPKEPE-KPKEPVKPK-EPEKPKEQEKPKPKKPKEPE-KPKEPEKPKE--------KP 197
            P  PKEPE KP++P +P+ +PE PKE E  KP+ PKEPE KP++P++PKE        K 
Sbjct: 1335 PEDPKEPEVKPEDPKEPEVKPEDPKEPEV-KPEDPKEPEVKPEDPKEPKEPEVKPEDPKE 1393

Query: 198  PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 1394 PKEPEVKPEDPKEPKEPEVKPEEPKEPKE-PEVKPEDP 1430

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 45/89 (50%), Positives = 63/89 (70%), Gaps = 5/89 (5%)
 Frame = +3

Query: 60   PKEPE-KPKEPVKPK-EPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP--KPE 224
            P+EPE KP++P +P+ +PE PKE E  KP+ PKEPE KP++P++P+ KP  P EP  KPE
Sbjct: 1318 PEEPEVKPEDPKEPEVKPEDPKEPEV-KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE 1376

Query: 225  PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 1377 DPKEPKEPEVKPEDPKEPKE-PEVKPEDP 1404

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 45/92 (48%), Positives = 57/92 (61%), Gaps = 4/92 (4%)
 Frame = +3

Query: 36   LEPPPPPKPKEPEKPKEPVKPK-EPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPP 209
            LEP     PK  E  K P +P+ +PE PKE E  KP+ PKEPE KP++P++P+ KP  P 
Sbjct: 1301 LEPTVTILPKTKEDFKIPEEPEVKPEDPKEPEV-KPEDPKEPEVKPEDPKEPEVKPEDPK 1359

Query: 210  EP--KPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
            EP  KPE PKEPE   E P  P +P+  P+ P
Sbjct: 1360 EPEVKPEDPKEPEVKPEDPKEPKEPEVKPEDP 1391

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 7/84 (8%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE-KPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPP 209
            ++P  P +PKEPE KP++P +PKEP++P E +   PK+PKEPE KP++P++PKE     P
Sbjct: 1412 VKPEEPKEPKEPEVKPEDPKEPKEPKEP-EVKPEDPKEPKEPEVKPEDPKEPKE-----P 1465

Query: 210  EPKPEPP-----KEPEKPKEKPPP 266
            E KPE       KEP+   E+  P
Sbjct: 1466 EVKPEVRLEKLIKEPQVKTERELP 1489

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 5/89 (5%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEPVKPK-EPEKPKEQEKPKPKKPKEPEKPKEPEKPKE 191
            +K  E  EP  P  KP++P++PKEP +P+ +PE PKE ++P+ K    PE PKEP++P+ 
Sbjct: 1412 VKPEEPKEPKEPEVKPEDPKEPKEPKEPEVKPEDPKEPKEPEVK----PEDPKEPKEPEV 1467

Query: 192  KPPPPPE---PKPEPPKEPEKPKEKPPPP 269
            KP    E    +P+   E E PK     P
Sbjct: 1468 KPEVRLEKLIKEPQVKTERELPKTGAASP 1496

[71][TOP]
>UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK6_CHLRE
          Length = 738

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 40/91 (43%), Positives = 41/91 (45%), Gaps = 2/91 (2%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P  P  P  P  P     P    P  P  P  P  P   PPPPP P+P 
Sbjct: 330 PPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPP 389

Query: 225 PPK--EPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PP    P  P   PPPPP P P P PPP  P
Sbjct: 390 PPSPPPPSPPPPSPPPPPPPSPPPPPPPRPP 420

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 41/91 (45%), Positives = 43/91 (47%), Gaps = 1/91 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEPK 218
           PPPPP P  P  P     P  P +P     P P  P  P   P  P  P   PPPPP P+
Sbjct: 260 PPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPR 319

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P PP  P  P   PPPPP P P P PPP  P
Sbjct: 320 PPPPSPPP-PSPPPPPPPSPPPPPSPPPPPP 349

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 38/90 (42%), Positives = 38/90 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P     P  P     P P  P     P  P  P   PP PP P P
Sbjct: 196 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 255

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 256 PPPSPPPPPPPSPPPPPPPSPPPPPPPRPP 285

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 39/89 (43%), Positives = 40/89 (44%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P  P     P  P     P P  P  P  P  P  P  +PPPP  P P 
Sbjct: 302 PPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPS 361

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PP  P  P   PPPPP P P P PPP  P
Sbjct: 362 PPP-PSPPPPSPPPPPPPSPPPPPPPRPP 389

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 39/90 (43%), Positives = 41/90 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P+ P  P  P  P  P  P     P    P  P  P  P  P   PPPP  P P
Sbjct: 276 PPPPPPPRPPPPP--PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPP 333

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP+P P   PPP  P
Sbjct: 334 PPPSPPPPPSPPPPPPPRPPPPSPPPPSPP 363

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 39/91 (42%), Positives = 41/91 (45%), Gaps = 1/91 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEPK 218
           PPPPP+P  P  P  P     P  P     P P  P  P  +P  P  P   PPPPP P 
Sbjct: 278 PPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPS 337

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P PP  P  P    PPPP P P   PPP  P
Sbjct: 338 PPPPPSPPPPPPPRPPPPSPPPPSPPPPSPP 368

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 39/89 (43%), Positives = 40/89 (44%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P  P  P  P  P  +  P    P  P  P  P  P   PPPPP P P 
Sbjct: 325 PPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPP-PSPPPPPPPSPPPP 383

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PP  P  P   PP PP P P P PPP  P
Sbjct: 384 PPPRPPPPSPPPPSPPPPSPPPPPPPSPP 412

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 42/101 (41%), Positives = 43/101 (42%), Gaps = 8/101 (7%)
 Frame = +3

Query: 42  PPPPPKPKEP--------EKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKP 197
           PPPPP P+ P          P  P  P  P  P     P P     P  P  P  P   P
Sbjct: 344 PPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSP 403

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPASC 320
           PPPP P P PP  P  P   PPPP  P P P PPP  PA C
Sbjct: 404 PPPPPPSPPPPPPPRPPPPSPPPPSPPPPSP-PPPSPPARC 443

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 39/90 (43%), Positives = 40/90 (44%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P     P  P     P P  P  P  P  P  P   PPPP  P P
Sbjct: 206 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP--PPSPPPPSPPPPSPPPPSPPPP 263

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P+P P PPP  P
Sbjct: 264 PPPSPPPPPPPSPPPPPPPRPPPPPPPSPP 293

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 38/88 (43%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEPK 218
           PPPPP P  P  P+ P     P  P     P P  P  P   P  P  P+  PP PP P 
Sbjct: 338 PPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPS 397

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P PP  P  P   PPPPP P+P P  PP
Sbjct: 398 PPPPSPPPPPPPSPPPPPPPRPPPPSPP 425

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 39/93 (41%), Positives = 41/93 (44%), Gaps = 3/93 (3%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEK---PKEPEKPKEKPPPPPE 212
           PPPPP P  P  P+ P  P     P     P P  P  P     P  P +P    PPPP 
Sbjct: 270 PPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPS 329

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P P PP  P  P   PPPPP   P P PPP  P
Sbjct: 330 PPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSP 362

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 38/88 (43%), Positives = 40/88 (45%), Gaps = 2/88 (2%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP--PEPK 218
           PPPP P  P  P+ P     P  P     P P  P  P  P  P  P   PPPP  P P 
Sbjct: 307 PPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPS 366

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P PP  P  P   PPPPP P+P P  PP
Sbjct: 367 PPPPSPPPPPPPSPPPPPPPRPPPPSPP 394

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 39/96 (40%), Positives = 40/96 (41%), Gaps = 9/96 (9%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE---------KPKEPEKPKEK 194
           PPPPP P+ P     P  P  P  P     P P  P  P           P  P  P   
Sbjct: 312 PPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPS 371

Query: 195 PPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PPPPP P P PP  P  P   PPPP  P P P PPP
Sbjct: 372 PPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPP 407

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 38/89 (42%), Positives = 39/89 (43%), Gaps = 2/89 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP--PEP 215
           PPP P P  P  P  P  P     P     P P  P  P  P  P  P   PPPP  P P
Sbjct: 246 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPP 305

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P PP  P  P  +PPPP  P P P PPP
Sbjct: 306 SPPPPSPPPPPPPRPPPPSPPPPSPPPPP 334

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 39/93 (41%), Positives = 39/93 (41%), Gaps = 3/93 (3%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKP---KKPKEPEKPKEPEKPKEKPPPPPE 212
           PPPPP P  P     P  P  P  P     P P     P  P  P  P  P   PPPPP 
Sbjct: 284 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPS 343

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P P PP  P  P   PP PP P P P  PP  P
Sbjct: 344 PPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPP 376

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 37/90 (41%), Positives = 38/90 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPP  P     P  P  P  P        P P  P  P  P  P  P   PPPPP P+P
Sbjct: 225 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRP 284

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPP  P P P PP   P
Sbjct: 285 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 314

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 37/90 (41%), Positives = 38/90 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P     P  P     P P  P  P  P+ P  P   PPPP  P P
Sbjct: 241 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPP 300

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP     P   PPPPP   P P PPP  P
Sbjct: 301 SPPPPSPPPPSPPPPPPPRPPPPSPPPPSP 330

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 40/96 (41%), Positives = 41/96 (42%), Gaps = 6/96 (6%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK-EPEKPKEPEKPKEKPPPPPEPK 218
           PPPPP P  P  P     P  P  P     P P+ P   P  P  P  P   PPPPP P 
Sbjct: 286 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPP 345

Query: 219 PEPPKEPEKPKEKPPPPPQ-----PQPMPQPPPHIP 311
           P PP  P  P   PP PP      P P P PPP  P
Sbjct: 346 PPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 381

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 37/90 (41%), Positives = 37/90 (41%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP PP P  P     P  P  P  P     P    P  P  P  P  P   PPPPP P P
Sbjct: 227 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPP 286

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PP PP P P P  PP  P
Sbjct: 287 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 316

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 39/89 (43%), Positives = 40/89 (44%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P     P  P  P     P P  P  P  P  P  P  +PPPPP P P 
Sbjct: 235 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP-PSPPPPPPPRPPPPPPPSP- 292

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PP  P  P   PP PP P P P PPP  P
Sbjct: 293 PPPSPPPPSPPPPSPPPPSPPPPPPPRPP 321

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 41/102 (40%), Positives = 43/102 (42%), Gaps = 1/102 (0%)
 Frame = +3

Query: 9   CGAIKSIEILEPPPP-PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKP 185
           C  +    +  PPPP P P  P  P  P     P  P     P P  P  P  P  P  P
Sbjct: 179 CCPLSQANVPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP--PPSPPPPSPP 236

Query: 186 KEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
              PPPP  P P PP  P  P   PPPPP P P P PPP  P
Sbjct: 237 PPSPPPPSPPPPSPPP-PSPPPPSPPPPPPPSPPPPPPPSPP 277

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 38/93 (40%), Positives = 39/93 (41%), Gaps = 3/93 (3%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P     P  P     P P  P     P  P  P   PPPPP P P
Sbjct: 211 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 270

Query: 222 EPPKE---PEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP     P  P+  PPPPP P P   PPP  P
Sbjct: 271 PPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPP 303

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 38/90 (42%), Positives = 38/90 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P     P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 221 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP--PPSPPPPPPPSPPPPPPPSPPP 278

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P    PPPP P P   PPP  P
Sbjct: 279 PPPPRPPPPPPPSPPPPSPPPPSPPPPSPP 308

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 39/90 (43%), Positives = 40/90 (44%), Gaps = 1/90 (1%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P     P  P +P     P P  P  P  P  P  P   PPPPP P P 
Sbjct: 297 PPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPP-PSPPPPPSPPPPPPPRPPPP 355

Query: 225 PPKEPEKPKEKPPPP-PQPQPMPQPPPHIP 311
            P  P  P   PPPP P P P P PPP  P
Sbjct: 356 SPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 385

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 39/91 (42%), Positives = 40/91 (43%), Gaps = 2/91 (2%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPKP 221
           PPPP P  P  P  P  P     P    +P P  P  P  P  P   P    PPPP P P
Sbjct: 255 PPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 314

Query: 222 EPPKEPEKPKEKPP-PPPQPQPMPQPPPHIP 311
            PP  P  P   PP PPP P P P PPP  P
Sbjct: 315 PPPPRPPPPSPPPPSPPPPPPPSPPPPPSPP 345

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 38/92 (41%), Positives = 38/92 (41%), Gaps = 2/92 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE--P 215
           PPPPP P  P  P  P  P     P     P P  P  P  P     P   PPPPP   P
Sbjct: 262 PPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPP 321

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P PP     P   P PPP P P P PPP  P
Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPP 353

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 37/92 (40%), Positives = 38/92 (41%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P  P     P     P P  P  P  P     P   PPPPP   P
Sbjct: 280 PPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPP 339

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            PP  P  P  +PPPP  P P P PP   P S
Sbjct: 340 PPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPS 371

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 36/90 (40%), Positives = 37/90 (41%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P     P  P     P P  P  P  P  P      PPPP  P P
Sbjct: 236 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPP 295

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP     P   PPP P P P P+PPP  P
Sbjct: 296 SPPPPSPPPPSPPPPSPPPPPPPRPPPPSP 325

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 36/89 (40%), Positives = 37/89 (41%), Gaps = 2/89 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE--P 215
           PPPP  P     P  P  P  P        P P  P  P  P     P   PPPPP   P
Sbjct: 210 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 269

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P PP  P  P  +PPPPP P P P  PP
Sbjct: 270 PPPPPSPPPPPPPRPPPPPPPSPPPPSPP 298

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 38/93 (40%), Positives = 39/93 (41%), Gaps = 2/93 (2%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE--PK 218
           PPPP P  P  P     P  P  P     P P  P  P     P  P   PPPPP   P 
Sbjct: 220 PPPPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 278

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
           P PP+ P  P   PPPP  P P P PP   P S
Sbjct: 279 PPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPS 311

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 36/91 (39%), Positives = 36/91 (39%), Gaps = 1/91 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP-PPPEPK 218
           PP PP P  P     P  P  P  P     P    P  P  P  P  P   PP PPP P 
Sbjct: 222 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 281

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P PP  P      P PPP   P P PPP  P
Sbjct: 282 PRPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 312

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 30/77 (38%), Positives = 31/77 (40%)
 Frame = +3

Query: 87  PVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPP 266
           P+       P     P P  P  P  P  P  P   PPPP  P P PP  P  P   PPP
Sbjct: 181 PLSQANVPSPPPPSPPPPSPP--PPSPPPPSPPPPSPPPPSPPPPSPP-PPSPPPPSPPP 237

Query: 267 PPQPQPMPQPPPHIPAS 317
           P  P P P PP   P S
Sbjct: 238 PSPPPPSPPPPSPPPPS 254

[72][TOP]
>UniRef100_Q816D8 Cell surface protein n=1 Tax=Bacillus cereus ATCC 14579
            RepID=Q816D8_BACCR
          Length = 3373

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/111 (47%), Positives = 75/111 (67%), Gaps = 13/111 (11%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            +K  +  EP  P  KP++P++PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++
Sbjct: 3162 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3221

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PKE        K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3222 PKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3271

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/111 (47%), Positives = 75/111 (67%), Gaps = 13/111 (11%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            +K  +  EP  P  KP++P++PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++
Sbjct: 3175 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3234

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PKE        K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3235 PKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3284

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/111 (47%), Positives = 75/111 (67%), Gaps = 13/111 (11%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            +K  +  EP  P  KP++P++PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++
Sbjct: 3188 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3247

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PKE        K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3248 PKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3297

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 50/100 (50%), Positives = 70/100 (70%), Gaps = 12/100 (12%)
 Frame = +3

Query: 48   PPPKPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEKPKE-------- 191
            P  KP++P++PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++PKE        
Sbjct: 3160 PEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDP 3219

Query: 192  KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3220 KEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3258

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/111 (45%), Positives = 72/111 (64%), Gaps = 19/111 (17%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE-KPKEPVKPKEPE-KPKEQEKPK--------PKKPKEPE-KPKEPEK 182
            ++P  P +PKEPE KP++P +PKEPE KP++ ++PK        PK+PKEPE KP++P++
Sbjct: 3201 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3260

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PKE        K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3261 PKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3310

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 52/110 (47%), Positives = 75/110 (68%), Gaps = 13/110 (11%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            +K  +  EP  P  KP++P++PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++
Sbjct: 3214 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3273

Query: 183  PKE--------KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
            PKE        K P  PE KPE PKEP++P+ KP  P +P+  P+  P +
Sbjct: 3274 PKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEV 3322

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 48/105 (45%), Positives = 66/105 (62%), Gaps = 19/105 (18%)
 Frame = +3

Query: 54   PKPKEPEK-PKEPVKPKEPE-KPKEQEKPK--------PKKPKEPE-KPKEPEKPKE--- 191
            PK KE  K P++P +PKEPE KP++ ++PK        PK+PKEPE KP++P++PKE   
Sbjct: 3142 PKTKEDFKIPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEV 3201

Query: 192  -----KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
                 K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3202 KPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3245

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/101 (45%), Positives = 60/101 (59%), Gaps = 9/101 (8%)
 Frame = +3

Query: 36   LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKE------- 191
            LEP     PK  E  K P  PKEP++P E +   PK+PKEPE KP++P++PKE       
Sbjct: 3134 LEPTVTILPKTKEDFKIPEDPKEPKEP-EVKPEDPKEPKEPEVKPEDPKEPKEPEVKPED 3192

Query: 192  -KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             K P  PE KPE PKEP++P+ KP  P +P+  P+  P  P
Sbjct: 3193 PKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKE-PEVKPEDP 3232

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 44/93 (47%), Positives = 62/93 (66%), Gaps = 10/93 (10%)
 Frame = +3

Query: 18   IKSIEILEPPPPP-KPKEPEKPKEP-VKPKEPEKPKEQE-KPK-PKKPKEPE-KPKEPEK 182
            +K  +  EP  P  KP++P++PKEP VKP++P++PKE E KP+ PK+PKEPE KP++P++
Sbjct: 3253 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKE 3312

Query: 183  PKEKPPPPPEPKPEPP-----KEPEKPKEKPPP 266
            PKE     PE KPE       KEP+   E+  P
Sbjct: 3313 PKE-----PEVKPEVRLEKLIKEPQVKTERELP 3340

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 37/85 (43%), Positives = 52/85 (61%), Gaps = 5/85 (5%)
 Frame = +3

Query: 72   EKPKEPVKPKEPEKPKEQEKPK----PKKPKEPE-KPKEPEKPKEKPPPPPEPKPEPPKE 236
            +K   P++P     PK +E  K    PK+PKEPE KP++P++PKE     PE KPE PKE
Sbjct: 3128 DKINPPLEPTVTILPKTKEDFKIPEDPKEPKEPEVKPEDPKEPKE-----PEVKPEDPKE 3182

Query: 237  PEKPKEKPPPPPQPQPMPQPPPHIP 311
            P++P+ KP  P +P+  P+  P  P
Sbjct: 3183 PKEPEVKPEDPKEPKE-PEVKPEDP 3206

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 34/82 (41%), Positives = 50/82 (60%), Gaps = 4/82 (4%)
 Frame = +3

Query: 36   LEPPPPPKPKEPE-KPKEPVKPKEPE-KPKEQEKPKPK--KPKEPEKPKEPEKPKEKPPP 203
            ++P  P +PKEPE KP++P +PKEPE KP++ ++PK    KP++P++PKEPE   E    
Sbjct: 3266 VKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEDPKEPKEPEVKPEVRLE 3325

Query: 204  PPEPKPEPPKEPEKPKEKPPPP 269
                +P+   E E PK     P
Sbjct: 3326 KLIKEPQVKTERELPKTGAASP 3347

[73][TOP]
>UniRef100_C0MDP2 Putative collagen and fibronectin-binding collagen-like cell
           surface-anchored protein FneE n=1 Tax=Steptococcus equi
           subsp. zooepidemicus H70 RepID=C0MDP2_STRS7
          Length = 731

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 43/89 (48%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   KP+   +P+   +PK +  PKP+   EPE   EPE PK +P P P PK
Sbjct: 571 EPKPEPQPEPMPKPEPKPEPEPKPEPKPEPMPKPEPKPEPEPKPEPE-PKPEPQPEPMPK 629

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EPE KP+ KP P P+P+P P+P P
Sbjct: 630 PEPKPEPEPKPEPKPEPMPKPEPKPEPEP 658

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 43/91 (47%), Positives = 55/91 (60%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P PK   KP+   KP+   KP+ Q +P PK   +PE   +PE PK +P P PEPK
Sbjct: 595 EPKPEPMPKPEPKPEPEPKPEPEPKPEPQPEPMPKPEPKPEPEPKPE-PKPEPMPKPEPK 653

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PEP  +PE P+ KP P P+P+P P+  P  P
Sbjct: 654 PEPEPKPE-PEPKPEPEPKPEPQPEAKPQKP 683

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   +P+   KP+   +P+ + +PKP+   +PE   EPE PK +P P PEP+
Sbjct: 565 EPKPEPEPKPEPQPEPMPKPEPKPEPEPKPEPKPEPMPKPEPKPEPE-PKPEPEPKPEPQ 623

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE KP+ +P P P+P+PMP+P P
Sbjct: 624 PEPMPKPEPKPEPEPKPEPKPEPMPKPEP 652

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 42/94 (44%), Positives = 59/94 (62%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-----KPKEKPPP 203
           EP P P+PK   +PK   KP+   KP+ + +P+PK   EP+   +PE     +PK +P P
Sbjct: 579 EPMPKPEPKPEPEPKPEPKPEPMPKPEPKPEPEPKPEPEPKPEPQPEPMPKPEPKPEPEP 638

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            PEPKPEP  +PE KP+ +P P P+P+P P+P P
Sbjct: 639 KPEPKPEPMPKPEPKPEPEPKPEPEPKPEPEPKP 672

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 41/90 (45%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+PK   +PK   +P+   KP+ + +P+PK   +PE   +PE KP+ +P P PEP
Sbjct: 559 QPMPKPEPKPEPEPKPEPQPEPMPKPEPKPEPEPKPEPKPEPMPKPEPKPEPEPKPEPEP 618

Query: 216 KPEPPKEP-EKPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP  KP+ KP P P+P+P P+P P
Sbjct: 619 KPEPQPEPMPKPEPKPEPEPKPEPKPEPMP 648

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 41/88 (46%), Positives = 55/88 (62%), Gaps = 2/88 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+PK    PK   KP+   KP+ + KP+P+ +P    +PK   +PK +P P P P
Sbjct: 589 EPEPKPEPKPEPMPKPEPKPEPEPKPEPEPKPEPQPEPMPKPEPKPEPEPKPEPKPEPMP 648

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           KPEP  EPE KP+ +P P P+P+P PQP
Sbjct: 649 KPEPKPEPEPKPEPEPKPEPEPKPEPQP 676

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 41/87 (47%), Positives = 51/87 (58%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P P     PK   KP+   KP+ Q +P PK   +PE   +PE PK +P P PEPKP
Sbjct: 550 PTPTPDPMPQPMPKPEPKPEPEPKPEPQPEPMPKPEPKPEPEPKPE-PKPEPMPKPEPKP 608

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP  +PE P+ KP P P+P P P+P P
Sbjct: 609 EPEPKPE-PEPKPEPQPEPMPKPEPKP 634

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEP 215
           +P P P PK   KP+   KP+   +P  + +PKP+   +PE KP+   KP+ KP P P+P
Sbjct: 555 DPMPQPMPKPEPKPEPEPKPEPQPEPMPKPEPKPEPEPKPEPKPEPMPKPEPKPEPEPKP 614

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EP+ +P  KP P P+P+P P+P P
Sbjct: 615 EPEPKPEPQPEPMPKPEPKPEPEPKPEPKP 644

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 39/89 (43%), Positives = 54/89 (60%), Gaps = 2/89 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK-PKEKPPPPPEPK 218
           P P P+P    +PK   +PK   +P+   KP+PK   EP+   +PE  PK +P P PEPK
Sbjct: 554 PDPMPQPMPKPEPKPEPEPKPEPQPEPMPKPEPKPEPEPKPEPKPEPMPKPEPKPEPEPK 613

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE +P+  P P P+P+P P+P P
Sbjct: 614 PEPEPKPEPQPEPMPKPEPKPEPEPKPEP 642

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 7/90 (7%)
 Frame = +3

Query: 54  PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPK 233
           P+ + P    +P+ P+   KP+ + +P+PK   +PE   +PE PK +P P PEPKPEP  
Sbjct: 545 PRGENPTPTPDPM-PQPMPKPEPKPEPEPKPEPQPEPMPKPE-PKPEPEPKPEPKPEPMP 602

Query: 234 EPE-------KPKEKPPPPPQPQPMPQPPP 302
           +PE       KP+ +P P PQP+PMP+P P
Sbjct: 603 KPEPKPEPEPKPEPEPKPEPQPEPMPKPEP 632

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 37/87 (42%), Positives = 47/87 (54%), Gaps = 4/87 (4%)
 Frame = +3

Query: 54  PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK---PKEKPPPPPEPKPE 224
           P+ +  E+      P     P  Q  PKP+   EPE   EP+    PK +P P PEPKPE
Sbjct: 536 PQGERGEQGPRGENPTPTPDPMPQPMPKPEPKPEPEPKPEPQPEPMPKPEPKPEPEPKPE 595

Query: 225 PPKEP-EKPKEKPPPPPQPQPMPQPPP 302
           P  EP  KP+ KP P P+P+P P+P P
Sbjct: 596 PKPEPMPKPEPKPEPEPKPEPEPKPEP 622

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 35/90 (38%), Positives = 52/90 (57%), Gaps = 3/90 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE---KPKEPEKPKEKPPPPP 209
           EP P P+PK   +PK   +P+   KP+ + +P+PK   +PE   KP+   +P+ KP P P
Sbjct: 605 EPKPEPEPKPEPEPKPEPQPEPMPKPEPKPEPEPKPEPKPEPMPKPEPKPEPEPKPEPEP 664

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           +P+PEP  EP+ P+ KP  P +P      P
Sbjct: 665 KPEPEPKPEPQ-PEAKPQKPTKPSNTTNQP 693

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 31/78 (39%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query: 72  EKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPE-KP 248
           E+ ++  + +  E+    E P P     P+   +PE PK +P P PEP+PEP  +PE KP
Sbjct: 530 ERGEQGPQGERGEQGPRGENPTPTPDPMPQPMPKPE-PKPEPEPKPEPQPEPMPKPEPKP 588

Query: 249 KEKPPPPPQPQPMPQPPP 302
           + +P P P+P+PMP+P P
Sbjct: 589 EPEPKPEPKPEPMPKPEP 606

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query: 105 PEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQ 281
           P+  + ++ P+ ++ ++  + + P  P   P P P PKPEP  EPE KP+ +P P P+P+
Sbjct: 527 PQGERGEQGPQGERGEQGPRGENPT-PTPDPMPQPMPKPEPKPEPEPKPEPQPEPMPKPE 585

Query: 282 PMPQPPP 302
           P P+P P
Sbjct: 586 PKPEPEP 592

[74][TOP]
>UniRef100_B2E2V2 Putative uncharacterized protein (Fragment) n=1 Tax=Streptococcus
           pneumoniae CDC3059-06 RepID=B2E2V2_STRPN
          Length = 308

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/115 (47%), Positives = 68/115 (59%), Gaps = 23/115 (20%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK-----EPEKP 185
           LE P P    +PEKPK  VKP +PEKPK + KP+P+KPK     +PEKPK     +PEKP
Sbjct: 98  LEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 156

Query: 186 K-------EKPPPPPEPKPEPPK-----EPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           K       EKP P  +P+PE PK     +PEKPK E  P P +P+P  +P P  P
Sbjct: 157 KPEVKPQLEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 211

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/109 (48%), Positives = 67/109 (61%), Gaps = 15/109 (13%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPK----- 170
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK     + EKPK     
Sbjct: 115 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPEVKPQLEKPKPEVKP 173

Query: 171 EPEKPK-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           +PEKPK E  P P +PKPE   +PEKPK E  P P +P+P  +P P  P
Sbjct: 174 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 222

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 52/109 (47%), Positives = 67/109 (61%), Gaps = 15/109 (13%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPKEPEKP 185
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+ +KPK     +PEKPK   KP
Sbjct: 126 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQLEKPKPEVKPQPEKPKPEVKP 184

Query: 186 K-EKPPPPPEPKPEPPK-----EPEKPK-EKPPPPPQPQPMPQPPPHIP 311
           + EKP P  +P+PE PK     +PEKPK E  P P +P+P  +P P  P
Sbjct: 185 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKP 233

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 9/100 (9%)
 Frame = +3

Query: 36  LEPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKPPPPP 209
           ++P P P+ K + EKPK  VKP +PEKPK + KP+P+KPK PE   +PEKPK E  P P 
Sbjct: 86  MQPSPQPEVKPQLEKPKPEVKP-QPEKPKPEVKPQPEKPK-PEVKPQPEKPKPEVKPQPE 143

Query: 210 EPKPEPPKEPEKPK-------EKPPPPPQPQPMPQPPPHI 308
           +PKPE   +PEKPK       EKP P  +PQP  +P P +
Sbjct: 144 KPKPEVKPQPEKPKPEVKPQLEKPKPEVKPQP-EKPKPEV 182

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 11/100 (11%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-----EPEKPKEPEKP 185
           E+   P  PKP+   +PEKPK  VKP + EKPK + KP+P+KPK     +PEKPK   KP
Sbjct: 137 EVKPQPEKPKPEVKPQPEKPKPEVKP-QLEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKP 195

Query: 186 K-EKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQP-MPQP 296
           + EKP P  +P+PE PK   KP+ EKP P  +PQP  P+P
Sbjct: 196 QPEKPKPEVKPQPEKPKPEVKPQPEKPKPEVKPQPEKPKP 235

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/95 (50%), Positives = 60/95 (63%), Gaps = 5/95 (5%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKP 197
           E+   P  PKP+   + EKPK  VKP +PEKPK + KP+P+KPK PE   +PEKPK E  
Sbjct: 148 EVKPQPEKPKPEVKPQLEKPKPEVKP-QPEKPKPEVKPQPEKPK-PEVKPQPEKPKPEVK 205

Query: 198 PPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPP 299
           P P +PKPE   +PEKPK E  P P +P+P    P
Sbjct: 206 PQPEKPKPEVKPQPEKPKPEVKPQPEKPKPDNSKP 240

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 46/89 (51%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKPPPPPE 212
           LE P P    +PEKPK  VKP +PEKPK + KP+P+KPK PE   +PEKPK E  P P +
Sbjct: 164 LEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPK-PEVKPQPEKPKPEVKPQPEK 221

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           PKPE   +PEKPK   P   +PQ   + P
Sbjct: 222 PKPEVKPQPEKPK---PDNSKPQADDKKP 247

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 3/93 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-EPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKPPPPPE 212
           + P  P  K+P  PK  ++P  +PE   + EKPKP+   +PEKPK   KP+ EKP P  +
Sbjct: 69  DTPKEPGNKKPSAPKPGMQPSPQPEVKPQLEKPKPEVKPQPEKPKPEVKPQPEKPKPEVK 128

Query: 213 PKPEPPKEPEKPK-EKPPPPPQPQPMPQPPPHI 308
           P+PE PK   KP+ EKP P  +PQP  +P P +
Sbjct: 129 PQPEKPKPEVKPQPEKPKPEVKPQP-EKPKPEV 160

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 41/81 (50%), Positives = 53/81 (65%), Gaps = 4/81 (4%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKP 197
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK PE   +PEKPK E  
Sbjct: 170 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPK-PEVKPQPEKPKPEVK 227

Query: 198 PPPPEPKPEPPKEPEKPKEKP 260
           P P +PKP+  K P+   +KP
Sbjct: 228 PQPEKPKPDNSK-PQADDKKP 247

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 36/81 (44%), Positives = 46/81 (56%), Gaps = 3/81 (3%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP 200
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK PE   +PEKPK    
Sbjct: 181 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPK-PEVKPQPEKPKPDNS 238

Query: 201 PPPEPKPEPPKEPEKPKEKPP 263
            P     +P       K+K P
Sbjct: 239 KPQADDKKPSTTNNLSKDKQP 259

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 37/83 (44%), Positives = 47/83 (56%), Gaps = 3/83 (3%)
 Frame = +3

Query: 72  EKPKEP--VKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEK 245
           + PKEP   KP  P KP  Q  P+P+   + EKPK    P+ K P P +PKPE   +PEK
Sbjct: 69  DTPKEPGNKKPSAP-KPGMQPSPQPEVKPQLEKPK----PEVK-PQPEKPKPEVKPQPEK 122

Query: 246 PK-EKPPPPPQPQPMPQPPPHIP 311
           PK E  P P +P+P  +P P  P
Sbjct: 123 PKPEVKPQPEKPKPEVKPQPEKP 145

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 34/88 (38%), Positives = 45/88 (51%), Gaps = 10/88 (11%)
 Frame = +3

Query: 30  EILEPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPK-EPEKPKEPEKPK--- 188
           E+   P  PKP+   +PEKPK  VKP +PEKPK + KP+P+KPK +  KP+  +K     
Sbjct: 192 EVKPQPEKPKPEVKPQPEKPKPEVKP-QPEKPKPEVKPQPEKPKPDNSKPQADDKKPSTT 250

Query: 189 ---EKPPPPPEPKPEPPKEPEKPKEKPP 263
               K   P        K   KPK+  P
Sbjct: 251 NNLSKDKQPSNQASTNEKATNKPKKSLP 278

[75][TOP]
>UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7QFW8_IXOSC
          Length = 185

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 42/93 (45%), Positives = 42/93 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P        P P  P  P  P  P  P   PPPPP P P
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPP--------PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPASC 320
            PP  P  P   PPPPP P P P PPP  P  C
Sbjct: 53  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLC 85

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 41/93 (44%), Positives = 41/93 (44%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P        P P  P  P  P  P  P   PPPPP P P
Sbjct: 2   PPPPPPPPPPPPPPPPPPPPPP--------PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPASC 320
            PP  P  P   PPPPP P P P PPP     C
Sbjct: 54  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLCC 86

[76][TOP]
>UniRef100_B2AVH8 Predicted CDS Pa_7_2900 n=1 Tax=Podospora anserina
           RepID=B2AVH8_PODAN
          Length = 925

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 49/93 (52%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +3

Query: 15  AIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKE 191
           A KS E+ +P  PPKPKE  +PKE  KP E  KPKE   P +P KPKE  KPKE  KPKE
Sbjct: 263 AAKSAEVPKPAEPPKPKEMPRPKEAPKPAEAPKPKEVPIPAEPPKPKETPKPKEIPKPKE 322

Query: 192 KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMP 290
            P P  +P P PP  P  P E+ P  P  QP P
Sbjct: 323 VPKPKVQPPPPPPTPP--PAEERPKTPVSQPSP 353

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 52/110 (47%), Positives = 58/110 (52%), Gaps = 23/110 (20%)
 Frame = +3

Query: 42  PPPPPKPK-EPEKPK------------EPVKPKEPEK----PKEQEKPKPK---KPKEPE 161
           P P P+PK EP++PK            E  K +E  K    PK  E PKPK   +PKE  
Sbjct: 229 PEPTPEPKAEPKEPKPKKRSKKERRAEEAAKAEEAAKSAEVPKPAEPPKPKEMPRPKEAP 288

Query: 162 KPKEPEKPKEKPPP--PPEPKPEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           KP E  KPKE P P  PP+PK  P PKE  KPKE P P  QP P P  PP
Sbjct: 289 KPAEAPKPKEVPIPAEPPKPKETPKPKEIPKPKEVPKPKVQPPPPPPTPP 338

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 49/109 (44%), Positives = 54/109 (49%), Gaps = 18/109 (16%)
 Frame = +3

Query: 39  EPPPPPK--PKEPEKPKEPVKPKEPEK-------------PKEQEKPKPK---KPKEPEK 164
           EP P PK  PKEP+  K   K +  E+             PK  E PKPK   +PKE  K
Sbjct: 230 EPTPEPKAEPKEPKPKKRSKKERRAEEAAKAEEAAKSAEVPKPAEPPKPKEMPRPKEAPK 289

Query: 165 PKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P E  KPKE P P   PKP   KE  KPKE P P   P+P  QPPP  P
Sbjct: 290 PAEAPKPKEVPIPAEPPKP---KETPKPKEIPKPKEVPKPKVQPPPPPP 335

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 41/101 (40%), Positives = 50/101 (49%), Gaps = 2/101 (1%)
 Frame = +3

Query: 6   GCGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKP 185
           G G  KS E   PPP P P   + P  P  P   E   E      +   E E+P+ P +P
Sbjct: 137 GYGGAKS-EWYTPPPNPGPTPNQAPPPPPPPPTAEDEHEPRGGSYRSSWE-EEPRPPPQP 194

Query: 186 KEKP-PPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           + K  PP PEPKPEP  EP+ +P+ KP P   P P P P P
Sbjct: 195 QPKANPPAPEPKPEPKPEPKARPEPKPEPRRTPTPEPTPEP 235

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 39/125 (31%), Positives = 53/125 (42%), Gaps = 40/125 (32%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEP----------VKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKE 191
           PPPPP P   E   EP           +P+ P +P+ +  P   +PK   KP+   +P+ 
Sbjct: 160 PPPPPPPPTAEDEHEPRGGSYRSSWEEEPRPPPQPQPKANPPAPEPKPEPKPEPKARPEP 219

Query: 192 KP----PPPPEPKPEPPKEPEKPK--------------------------EKPPPPPQPQ 281
           KP     P PEP PEP  EP++PK                           KP  PP+P+
Sbjct: 220 KPEPRRTPTPEPTPEPKAEPKEPKPKKRSKKERRAEEAAKAEEAAKSAEVPKPAEPPKPK 279

Query: 282 PMPQP 296
            MP+P
Sbjct: 280 EMPRP 284

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 35/107 (32%), Positives = 47/107 (43%), Gaps = 20/107 (18%)
 Frame = +3

Query: 42  PPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           PPP P+PK  P  P+   +PK   K + + KP+P++   PE   EP+   ++P P    K
Sbjct: 190 PPPQPQPKANPPAPEPKPEPKPEPKARPEPKPEPRRTPTPEPTPEPKAEPKEPKPKKRSK 249

Query: 219 PE-------------------PPKEPEKPKEKPPPPPQPQPMPQPPP 302
            E                    P EP KPKE P P   P+P   P P
Sbjct: 250 KERRAEEAAKAEEAAKSAEVPKPAEPPKPKEMPRPKEAPKPAEAPKP 296

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 38/90 (42%), Positives = 48/90 (53%), Gaps = 5/90 (5%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P P+   +PKEP KPK+  K KE+   +  K +E  K  E  KP E P P   P+P
Sbjct: 227 PTPEPTPEPKAEPKEP-KPKKRSK-KERRAEEAAKAEEAAKSAEVPKPAEPPKPKEMPRP 284

Query: 222 -EPPKEPEKPKEK----PPPPPQPQPMPQP 296
            E PK  E PK K    P  PP+P+  P+P
Sbjct: 285 KEAPKPAEAPKPKEVPIPAEPPKPKETPKP 314

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 30/86 (34%), Positives = 45/86 (52%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           + PPPP P  P   ++  +P+        E+ +P+ P +P+    P  P+ KP P PEPK
Sbjct: 158 QAPPPPPP--PPTAEDEHEPRGGSYRSSWEE-EPRPPPQPQPKANPPAPEPKPEPKPEPK 214

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQP 296
             P  +PE P+  P P P P+P  +P
Sbjct: 215 ARPEPKPE-PRRTPTPEPTPEPKAEP 239

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/120 (30%), Positives = 49/120 (40%), Gaps = 33/120 (27%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPK----------EPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPK 188
           PPPPP  ++  +P+          EP  P +P+       P+PK   +PE    PE KP+
Sbjct: 163 PPPPPTAEDEHEPRGGSYRSSWEEEPRPPPQPQPKANPPAPEPKPEPKPEPKARPEPKPE 222

Query: 189 EKPPPPPEPKPEPPKEPEKPKEKPP----------------------PPPQPQPMPQPPP 302
            +  P PEP PEP  EP++PK K                        P P   P P+  P
Sbjct: 223 PRRTPTPEPTPEPKAEPKEPKPKKRSKKERRAEEAAKAEEAAKSAEVPKPAEPPKPKEMP 282

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 37/101 (36%), Positives = 46/101 (45%), Gaps = 6/101 (5%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK 182
           K   A K  E+  P  PPKPKE  KPKE  KPKE  KPK Q  P P  P  P   + P+ 
Sbjct: 289 KPAEAPKPKEVPIPAEPPKPKETPKPKEIPKPKEVPKPKVQ--PPPPPPTPPPAEERPKT 346

Query: 183 PKEKPPPP------PEPKPEPPKEPEKPKEKPPPPPQPQPM 287
           P  +P P        + + E  K  E+ K K     + + M
Sbjct: 347 PVSQPSPTKGTSAWEKAREETRKRIEEQKAKEAEQKRKEEM 387

[77][TOP]
>UniRef100_UPI000186476A hypothetical protein BRAFLDRAFT_84276 n=1 Tax=Branchiostoma floridae
            RepID=UPI000186476A
          Length = 1721

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/110 (40%), Positives = 60/110 (54%), Gaps = 14/110 (12%)
 Frame = +3

Query: 24   SIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKP-P 200
            S+++ EP PPP    PE P+EP    + E+ +E+E+PKP  P  P  P+EP  P  +P P
Sbjct: 1285 SVQMKEPEPPPPSPTPEPPEEPELAWDEEEKQEEEQPKPPSPP-PTPPREPTPPPREPTP 1343

Query: 201  PPPEPKP-------------EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP EP P              PP+EP  P  +P PPP+P+  P PPP  P
Sbjct: 1344 PPREPTPPPREPTPPPREPTPPPREPTPPPREPTPPPEPEKEPTPPPSPP 1393

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 39/89 (43%), Positives = 48/89 (53%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
            PP P P  P +P  P  P+EP  P  +  P P++P  P  P+EP  P  +P PPP  +P 
Sbjct: 1323 PPSPPPTPPREPTPP--PREPTPPPREPTPPPREPTPP--PREPTPPPREPTPPPR-EPT 1377

Query: 225  PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP EPEK    PP PP  +  P PPP  P
Sbjct: 1378 PPPEPEKEPTPPPSPPPVEKAPTPPPPSP 1406

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/90 (44%), Positives = 50/90 (55%), Gaps = 3/90 (3%)
 Frame = +3

Query: 45   PPPPKPKEPEKP-KEPVKP-KEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
            PPP  P+EP  P +EP  P +EP  P  +  P P++P  P  P+EP  P  +P PPPEP+
Sbjct: 1326 PPPTPPREPTPPPREPTPPPREPTPPPREPTPPPREPTPP--PREPTPPPREPTPPPEPE 1383

Query: 219  PEPPKEPEKPK-EKPPPPPQPQPMPQPPPH 305
             EP   P  P  EK P PP P P P+   H
Sbjct: 1384 KEPTPPPSPPPVEKAPTPPPPSPTPEVEEH 1413

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 48/123 (39%), Positives = 61/123 (49%), Gaps = 21/123 (17%)
 Frame = +3

Query: 6    GCGAIKSIEILEPPPPPKPKEPEKPKEP----------------VKPKEPEKPKEQEKPK 137
            G G   ++E+  PP PP  +E E P E                 V+ KEPE P     P+
Sbjct: 1242 GSGEPSTVEMSPPPSPPPEQEEEIPVEEEEEEEDGDWQEQIEVSVQMKEPEPPPPSPTPE 1301

Query: 138  PKKPKEPEKP-KEPEKPKEKPPPPPEPKPEPPKEPEKPKEKP-PPPPQPQPMPQ---PPP 302
            P  P+EPE    E EK +E+ P PP P P PP+EP  P  +P PPP +P P P+   PPP
Sbjct: 1302 P--PEEPELAWDEEEKQEEEQPKPPSPPPTPPREPTPPPREPTPPPREPTPPPREPTPPP 1359

Query: 303  HIP 311
              P
Sbjct: 1360 REP 1362

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 46/110 (41%), Positives = 55/110 (50%), Gaps = 17/110 (15%)
 Frame = +3

Query: 39   EPPPPPK-----PKEP-EKPKEPV-KPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKP 197
            EP PPP+     P+EP   P+EP   P+EP  P  +  P P+  KEP  P  P  P EK 
Sbjct: 1340 EPTPPPREPTPPPREPTPPPREPTPPPREPTPPPREPTPPPEPEKEPTPPPSP-PPVEKA 1398

Query: 198  PPPPEPKPEPPKEPEKPKEKPPP-----PPQPQPMPQ-----PPPHIPAS 317
            P PP P P P  E E P E  PP     PP P P P+     PPP + A+
Sbjct: 1399 PTPPPPSPTPEVE-EHPVEVAPPLVEEEPPAPTPSPEPVVEDPPPELIAN 1447

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 41/127 (32%), Positives = 49/127 (38%), Gaps = 37/127 (29%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPK----------EPEKPKEQEKPKPKKPKEPEKPKEPEKP-- 185
            P  PP P+    P   V+            EP   +    P P   +E E P E E+   
Sbjct: 1215 PRTPPPPQRIRTPVRIVRTPSNVSAKAGSGEPSTVEMSPPPSPPPEQEEEIPVEEEEEEE 1274

Query: 186  --------------KEKPPPPPEPKPEPPKEP-------EKPKEKPPPPPQPQPM----P 290
                          KE  PPPP P PEPP+EP       EK +E+ P PP P P     P
Sbjct: 1275 DGDWQEQIEVSVQMKEPEPPPPSPTPEPPEEPELAWDEEEKQEEEQPKPPSPPPTPPREP 1334

Query: 291  QPPPHIP 311
             PPP  P
Sbjct: 1335 TPPPREP 1341

[78][TOP]
>UniRef100_A2AMW3 Gamma-aminobutyric acid (GABA-A) receptor, subunit epsilon n=1
           Tax=Mus musculus RepID=A2AMW3_MOUSE
          Length = 916

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 46/91 (50%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           EP P P+P EPE   EP    EPE +P+ Q +P+P+   EPE   EPE +P+ +P P PE
Sbjct: 251 EPQPQPEP-EPEPQPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPEPEPQPEPQPEPQPE 309

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE +P+ KP P PQP+P P+P P
Sbjct: 310 PQPEPKPEPEPQPEPKPEPEPQPEPEPEPEP 340

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P PKP+ EP+   EP    +PE +P+ Q +PKP+   +PE   EPE P+ +P P PE
Sbjct: 281 EPQPEPKPEPEPQPEPEPQPEPQPEPQPEPQPEPKPEPEPQPEPKPEPE-PQPEPEPEPE 339

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE KP+ +P P P+P+P P+P P
Sbjct: 340 PEPEPQPEPEPKPEPQPEPEPEPEPEPEPEP 370

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 39/90 (43%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +P+   +P+   KP+ + +P+PK   EP+   EPE +P+ +P P PEP
Sbjct: 291 EPQPEPEPQPEPQPEPQPEPQPEPKPEPEPQPEPKPEPEPQPEPEPEPEPEPEPQPEPEP 350

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 351 KPEPQPEPEPEPEPEPEPEPEPEPEPEPEP 380

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 39/89 (43%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +P+   +PK   +P+ + KP+P+   EPE   EPE +P+ +P P PEP
Sbjct: 295 EPEPQPEPQPEPQPEPQPEPKPEPEPQPEPKPEPEPQPEPEPEPEPEPEPQPEPEPKPEP 354

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE P+ +P P P+P+P P+P P
Sbjct: 355 QPEPEPEPE-PEPEPEPEPEPEPEPEPEP 382

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 46/93 (49%), Positives = 55/93 (59%), Gaps = 4/93 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+PK EPE   EP    EPE P+ Q +P+PK   +PE   EPE P+ +P P PEP
Sbjct: 317 EPEPQPEPKPEPEPQPEPEPEPEPE-PEPQPEPEPKPEPQPEPEPEPE-PEPEPEPEPEP 374

Query: 216 KPEPPKEPEKPKE---KPPPPPQPQPMPQPPPH 305
           +PEP  EPE   E   +P P P P P P P PH
Sbjct: 375 EPEPEPEPESESELDLEPEPEPHPHPHPHPHPH 407

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/94 (45%), Positives = 61/94 (64%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
           EP P P+P+ EPE   EP    +PE KP+ + +P+P+   EP+   +PE   +PK +P P
Sbjct: 261 EPQPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPEPEPQPEPQPEPQPEPQPEPKPEPEP 320

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            PEPKPEP  +PE +P+ +P P PQP+P P+P P
Sbjct: 321 QPEPKPEPEPQPEPEPEPEPEPEPQPEPEPKPEP 354

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 39/91 (42%), Positives = 58/91 (63%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P P+P+   +PK   +P+   +P+ + +P+P+   +PE   EPE   +PK +P P P
Sbjct: 273 EPQPEPQPEPQPEPKPEPEPQPEPEPQPEPQPEPQPEPQPEPKPEPEPQPEPKPEPEPQP 332

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE P+ +P P P+PQP P+P P
Sbjct: 333 EPEPEPEPEPE-PQPEPEPKPEPQPEPEPEP 362

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/89 (48%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+P EP+   EP    +PE P+ Q +P+P+   EPE   EPE +P+ +P P PEP
Sbjct: 229 QPRPRPQP-EPQPQPEPQPEPQPE-PQPQPEPEPEPQPEPEPQPEPEPQPEPQPEPQPEP 286

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE P+ +P P P+PQP PQP P
Sbjct: 287 KPEPEPQPE-PEPQPEPQPEPQPEPQPEP 314

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 41/94 (43%), Positives = 61/94 (64%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EP+   +P    EPE +P+ + +P+P+   EP+   +PE KP+ +P P P
Sbjct: 237 EPQPQPEPQPEPQPEPQPQPEPEPEPQPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPEP 296

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EP+   +P+ KP P PQP+P P+P P
Sbjct: 297 EPQPEPQPEPQPEPQPEPKPEPEPQPEPKPEPEP 330

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 40/91 (43%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ +P+   EP    EPE +P+ + +P+P+   +PE   EPE P+ +P P PE
Sbjct: 243 EPQPEPQPEPQPQPEPEPEPQPEPEPQPEPEPQPEPQPEPQPEPKPEPE-PQPEPEPQPE 301

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EP+ +PK +P P P+P+P P+P P
Sbjct: 302 PQPEPQPEPQPEPKPEPEPQPEPKPEPEPQP 332

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 40/101 (39%), Positives = 56/101 (55%), Gaps = 12/101 (11%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+P+   KP+   +P+   +P+ Q +P+P+   EPE   EPE KP+ +P P PEP
Sbjct: 303 QPEPQPEPQPEPKPEPEPQPEPKPEPEPQPEPEPEPEPEPEPQPEPEPKPEPQPEPEPEP 362

Query: 216 KPEPPKEPEKPKEKPPPP-----------PQPQPMPQPPPH 305
           +PEP  EPE   E  P P           P+P+P P P PH
Sbjct: 363 EPEPEPEPEPEPEPEPEPEPESESELDLEPEPEPHPHPHPH 403

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 37/85 (43%), Positives = 55/85 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +PK   +P+   KP+ + +P+P+   EPE   +PE P+ KP P PEP+
Sbjct: 301 EPQPEPQPEPQPEPKPEPEPQPEPKPEPEPQPEPEPEPEPEPEPQPE-PEPKPEPQPEPE 359

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQ 293
           PEP  EPE P+ +P P P+P+P P+
Sbjct: 360 PEPEPEPE-PEPEPEPEPEPEPEPE 383

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 36/89 (40%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+P+   +P+   +P+ P + +   +P+P+   EP+   EP+ +P+ +P P PEP
Sbjct: 199 QPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEPQPEPQPQPEP 258

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE P+ +P P P+PQP PQP P
Sbjct: 259 EPEPQPEPE-PQPEPEPQPEPQPEPQPEP 286

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 35/89 (39%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +P+ P + +   +P+ + +P+P+   EP+   +PE P+ +P P PEP+
Sbjct: 205 EPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEPQPE-PQPQPEPEPEPQ 263

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE +P+ +P P PQP+P P+P P
Sbjct: 264 PEPEPQPEPEPQPEPQPEPQPEPKPEPEP 292

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 34/89 (38%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+P+ P + +   +P+   +P+ Q +P+P+   +PE   +PE P+ +P P PEP+
Sbjct: 211 QPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEPQPEPQPQPE-PEPEPQPEPEPQ 269

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE +P+ +P P P+P+P P+P P
Sbjct: 270 PEPEPQPEPQPEPQPEPKPEPEPQPEPEP 298

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 42/97 (43%), Positives = 57/97 (58%), Gaps = 7/97 (7%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK-----PKEKPP 200
           EP P P+P+ EPE   EP    EPE P+ + +P+P+   E E   EPE      P   P 
Sbjct: 347 EPEPKPEPQPEPEPEPEPEPEPEPE-PEPEPEPEPEPESESELDLEPEPEPHPHPHPHPH 405

Query: 201 PPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
           P PEP+PEP  EPE +P+ +P P P+P+P P+P P +
Sbjct: 406 PHPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEM 442

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 41/97 (42%), Positives = 57/97 (58%), Gaps = 9/97 (9%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-------KPKEK 194
           EP P P+P+ EPE   EP    EPE P+ + +P+P+   EPE   EPE       +P+ +
Sbjct: 337 EPEPEPEPQPEPEPKPEPQPEPEPE-PEPEPEPEPEPEPEPEPEPEPESESELDLEPEPE 395

Query: 195 PPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P P P P P P  EPE +P+ +P P P+P+P P+P P
Sbjct: 396 PHPHPHPHPHPHPEPEPEPEPEPEPEPEPEPEPEPEP 432

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 33/88 (37%), Positives = 56/88 (63%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPK 218
           P P P+P+    P+   +P+   +P+ + +P+P+ P + +  ++P  +P+ +P P PEP+
Sbjct: 186 PLPEPQPEPQPDPQPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQ 245

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+ P+ +P P PQP+P PQP P
Sbjct: 246 PEPQPEPQ-PQPEPEPEPQPEPEPQPEP 272

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 36/90 (40%), Positives = 52/90 (57%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P  +PE   EP    +PE   E + P   +     +P+   +P+ +P P PEP
Sbjct: 189 EPQPEPQPDPQPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEP 248

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  +PE +P+ +P P PQP+P PQP P
Sbjct: 249 QPEPQPQPEPEPEPQPEPEPQPEPEPQPEP 278

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 41/91 (45%), Positives = 53/91 (58%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P EPE   EP    EPE P+ Q +P+P+ P    +P     P   P P PEP+
Sbjct: 135 EPEPEPEP-EPEPEPEPEPEPEPE-PEPQPEPQPQ-PLAGRQPLPQPLPWPLPLPLPEPQ 191

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PEP  +P+ P+ +P P P+PQP PQP P  P
Sbjct: 192 PEPQPDPQ-PEPQPEPQPEPQPEPQPEPQTP 221

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 43/97 (44%), Positives = 54/97 (55%), Gaps = 9/97 (9%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE- 212
           EP P P+P EPE   EP    EPE KP+ Q +P+P+   EPE   EPE P+ +P P PE 
Sbjct: 327 EPEPQPEP-EPEPEPEPEPQPEPEPKPEPQPEPEPEPEPEPEPEPEPE-PEPEPEPEPES 384

Query: 213 -------PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
                  P+PEP   P  P   P P P+P+P P+P P
Sbjct: 385 ESELDLEPEPEPHPHPH-PHPHPHPEPEPEPEPEPEP 420

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/100 (38%), Positives = 53/100 (53%), Gaps = 12/100 (12%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P P+P+   +P+   +P    +P  Q  P P     PE   EP+   +P+ +P P P
Sbjct: 149 EPEPEPEPEPEPQPEPQPQPLAGRQPLPQPLPWPLPLPLPEPQPEPQPDPQPEPQPEPQP 208

Query: 210 EPKPEPPKEPE---------KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EP+         +P+ +P P PQPQP PQP P
Sbjct: 209 EPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEP 248

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 38/89 (42%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEP-EKPKEPEKPKEKPPPPPEP 215
           +P P P+P+   +P+   +P EPE P+ Q +P+P   ++P  +P     P+ +P P PEP
Sbjct: 83  QPQPMPQPQPMPEPQPQPEP-EPE-PQPQPQPQPLAGRQPLPQPLPWPMPQPQPEPEPEP 140

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE P+ +P P P+PQP PQP P
Sbjct: 141 EPEPEPEPE-PEPEPEPEPEPQPEPQPQP 168

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 31/87 (35%), Positives = 55/87 (63%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P+P+   +P    +P+   +P+ Q +P+P+ P+ P + +   +P+ +P P P+P+P
Sbjct: 184 PLPLPEPQPEPQPDPQPEPQPEPQPEPQPEPQPE-PQTPGQVQAGRQPRPRPQPEPQPQP 242

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP  EP+ P+ +P P P+P+P P+P P
Sbjct: 243 EPQPEPQ-PEPQPQPEPEPEPQPEPEP 268

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 39/92 (42%), Positives = 50/92 (54%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +P+   +P    +P  Q  P P    +PE   EPE     P P PEP+
Sbjct: 95  EPQPQPEPEPEPQPQPQPQPLAGRQPLPQPLPWPMPQPQPEPEPEPE-----PEPEPEPE 149

Query: 219 PEPPKEPEKPKEKPPPPPQP----QPMPQPPP 302
           PEP  EPE P+ +P P PQP    QP+PQP P
Sbjct: 150 PEPEPEPE-PEPQPEPQPQPLAGRQPLPQPLP 180

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 36/91 (39%), Positives = 56/91 (61%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKE-PEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKE-KPPPPP 209
           +P P P P   PE   EP    +PE +P+ Q +P+P+   EP+ P + +  ++ +P P P
Sbjct: 177 QPLPWPLPLPLPEPQPEPQPDPQPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQP 236

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+P+P  +PE P+ +P P P+P+P PQP P
Sbjct: 237 EPQPQPEPQPE-PQPEPQPQPEPEPEPQPEP 266

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 39/102 (38%), Positives = 52/102 (50%), Gaps = 8/102 (7%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   E     EPE +P     P P    EPE   EPE +P+ +P P P
Sbjct: 369 EPEPEPEPEPEPEPESESELDLEPEPEPHPHPHPHPHPHPEPEPEPEPEPEPEPEPEPEP 428

Query: 210 EPKPEPPKEPE-----KPKEKPPPPPQPQPMPQPPPHIPASC 320
           EP+PEP  EPE     +P+ +  P P  + +P   P +   C
Sbjct: 429 EPEPEPEPEPEPEMKSEPQSQLEPQPSGKKLPAKEPELTVDC 470

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 33/88 (37%), Positives = 51/88 (57%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEPK 218
           P P P P     P+   +P+   +P+ Q +P+P+   EP+ +P+ P + +    P P P+
Sbjct: 176 PQPLPWPLPLPLPEPQPEPQPDPQPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQ 235

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE P+ +P P PQPQP P+P P
Sbjct: 236 PEPQPQPE-PQPEPQPEPQPQPEPEPEP 262

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 20/108 (18%)
 Frame = +3

Query: 39  EPPPPPKP-KEPEKPKE------PVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKP 197
           +P P P+P   PE P        P    + E P   +     +P+   +P+   +P+ +P
Sbjct: 41  QPQPVPQPLTPPESPAGDTVVFGPQPQPQAESPGHDDVVFSSQPQPMPQPQPMPEPQPQP 100

Query: 198 PPPPEPKPEPPKEP-------------EKPKEKPPPPPQPQPMPQPPP 302
            P PEP+P+P  +P               P+ +P P P+P+P P+P P
Sbjct: 101 EPEPEPQPQPQPQPLAGRQPLPQPLPWPMPQPQPEPEPEPEPEPEPEP 148

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 36/105 (34%), Positives = 52/105 (49%), Gaps = 16/105 (15%)
 Frame = +3

Query: 36  LEPPPPPKPK-----EPEKPKEPVKPKEPEKPK-------EQEKPKPKKPKEPEKPKEPE 179
           LE  PP + K     +P+   +P+ P  PE P         Q +P+ + P   +     +
Sbjct: 26  LENKPPAQDKVVFGPQPQPVPQPLTP--PESPAGDTVVFGPQPQPQAESPGHDDVVFSSQ 83

Query: 180 KPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQP----QPMPQPPP 302
            P+  P P P P+P+P  EPE P+ +P P PQP    QP+PQP P
Sbjct: 84  -PQPMPQPQPMPEPQPQPEPE-PEPQPQPQPQPLAGRQPLPQPLP 126

[79][TOP]
>UniRef100_P73032 Slr1753 protein n=1 Tax=Synechocystis sp. PCC 6803 RepID=P73032_SYNY3
          Length = 1749

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 44/95 (46%), Positives = 63/95 (66%), Gaps = 4/95 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1134 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1193

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHIP 311
            EP+PEP  EPE +P+ +P P P+P+P P+P P +P
Sbjct: 1194 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPELP 1228

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1018 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1077

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1078 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1109

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1020 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1079

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1080 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1111

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1022 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1081

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1082 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1113

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1024 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1083

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1084 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1115

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1026 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1085

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1086 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1117

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1028 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1087

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1088 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1119

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1030 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1089

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1090 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1121

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1032 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1091

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1092 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1123

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1034 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1093

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1094 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1125

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1036 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1095

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1096 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1127

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1038 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1097

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1098 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1129

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1040 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1099

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1100 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1131

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1042 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1101

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1102 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1133

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1044 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1103

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1104 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1135

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1046 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1105

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1106 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1137

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1048 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1107

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1108 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1139

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1050 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1109

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1110 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1141

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1052 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1111

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1112 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1143

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1054 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1113

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1114 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1145

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1056 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1115

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1116 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1147

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1058 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1117

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1118 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1149

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1060 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1119

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1120 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1151

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1062 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1121

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1122 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1153

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1064 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1123

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1124 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1155

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1066 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1125

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1126 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1157

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1068 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1127

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1128 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1159

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1070 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1129

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1130 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1161

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1072 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1131

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1132 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1163

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1074 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1133

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1134 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1165

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1076 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1135

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1136 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1167

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1078 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1137

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1138 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1169

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1080 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1139

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1140 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1171

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1082 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1141

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1142 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1173

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1084 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1143

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1144 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1175

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1086 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1145

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1146 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1177

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1088 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1147

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1148 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1179

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1090 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1149

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1150 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1181

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1092 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1151

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1152 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1183

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1094 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1153

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1154 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1185

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1096 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1155

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1156 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1187

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1098 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1157

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1158 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1189

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1100 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1159

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1160 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1191

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1102 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1161

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1162 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1193

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1104 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1163

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1164 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1195

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1106 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1165

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1166 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1197

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1108 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1167

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1168 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1199

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1110 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1169

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1170 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1201

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1112 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1171

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1172 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1203

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1114 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1173

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1174 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1205

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1116 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1175

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1176 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1207

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1118 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1177

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1178 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1209

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1120 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1179

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1180 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1211

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1122 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1181

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1182 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1213

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1124 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1183

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1184 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1215

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1126 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1185

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1186 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1217

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1128 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1187

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 1188 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1219

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 45/98 (45%), Positives = 63/98 (64%), Gaps = 7/98 (7%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1136 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1195

Query: 210  EPKPEPPKEPE-KPKEKPPPPPQPQPMPQ---PPPHIP 311
            EP+PEP  EPE +P+ +P P P+P+P P+   P P IP
Sbjct: 1196 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPELPTPSIP 1233

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 42/94 (44%), Positives = 55/94 (58%), Gaps = 3/94 (3%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
            EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 1148 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 1207

Query: 210  EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            EP+PEP  EPE   E  P  P P  +P  PP  P
Sbjct: 1208 EPEPEPEPEPEPEPEPEPELPTPS-IPVEPPTSP 1240

[80][TOP]
>UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK5_CHLRE
          Length = 853

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 39/90 (43%), Positives = 39/90 (43%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P  P  P  P     P P     P  P  P  P   PP PP P P
Sbjct: 424 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 483

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 484 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 513

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 40/91 (43%), Positives = 40/91 (43%), Gaps = 1/91 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPK-EPEKPKEKPPPPPEPK 218
           PPPPP P  P  P     P  P  P     P P  P  P  P   P  P   PPPPP P 
Sbjct: 257 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 316

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P  P  P  P   PPPPP P P P PPP  P
Sbjct: 317 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 347

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 40/91 (43%), Positives = 40/91 (43%), Gaps = 1/91 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPK-EPEKPKEKPPPPPEPK 218
           PPPPP P  P  P     P  P  P     P P  P  P  P   P  P   PP PP P 
Sbjct: 309 PPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPS 368

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P PP  P  P   PPPPP P P P PPP  P
Sbjct: 369 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 399

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 40/90 (44%), Positives = 40/90 (44%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P     P  P  P     P P  P  P  P  P  P   PPPP  P P
Sbjct: 374 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP--PPSPPPPSPPPPSPPPPSPPPP 431

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 432 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 461

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 39/92 (42%), Positives = 39/92 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP    P  P  P  P  P  P     P    P  P  P  P  P   PPPPP P P
Sbjct: 331 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 390

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            PP  P  P   PPPP  P P P PP   P S
Sbjct: 391 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 422

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 39/92 (42%), Positives = 39/92 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP    P  P  P  P  P  P     P    P  P  P  P  P   PPPPP P P
Sbjct: 445 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 504

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            PP  P  P   PPPP  P P P PP   P S
Sbjct: 505 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 536

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 38/90 (42%), Positives = 38/90 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP PP P  P     P  P  P  P     P P     P  P  P  P   PP PP P P
Sbjct: 209 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 268

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 269 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 298

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 38/90 (42%), Positives = 38/90 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P     P  P  P     P P  P     P  P  P   PPPPP P P
Sbjct: 281 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 340

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P    PPPP P P   PPP  P
Sbjct: 341 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 370

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 38/90 (42%), Positives = 38/90 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPP  P     P  P  P  P  P     P P  P     P  P  P   PP PP P P
Sbjct: 364 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 423

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 424 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 453

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 40/97 (41%), Positives = 40/97 (41%), Gaps = 7/97 (7%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P     P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 409 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 468

Query: 222 EPPKEP-------EKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P         P   PPPPP P P P PPP  P
Sbjct: 469 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 505

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 39/89 (43%), Positives = 39/89 (43%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P  P  P     P     P P  P  P  P  P  P   PP PP P P 
Sbjct: 268 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP-PSPPPPSPPPPSPP 326

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PP  P  P   PPPPP P P P PPP  P
Sbjct: 327 PPSPPPPPPPSPPPPPPPSPPPPPPPSPP 355

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 39/90 (43%), Positives = 39/90 (43%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P    P  P  P  P  P   PPPPP P P
Sbjct: 289 PPPPPPPSPP--PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 346

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPP  P P P PP   P
Sbjct: 347 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 376

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 39/90 (43%), Positives = 39/90 (43%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P     P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 291 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP--PPSPPPPPPPSPPPPPPPSPPP 348

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PP PP P P P  PP  P
Sbjct: 349 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 378

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 39/90 (43%), Positives = 39/90 (43%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP    P  P  P  P  P        P P  P  P  P  P  P   PPPPP P P
Sbjct: 238 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 297

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP   P P PPP  P
Sbjct: 298 PPPSPP--PPSPPPPPPPSPPPPSPPPPSP 325

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 37/87 (42%), Positives = 37/87 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP    P  P  P  P  P  P     P    P  P  P  P  P   PPPP  P P
Sbjct: 274 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 333

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PP  P  P   PPPPP P P P  PP
Sbjct: 334 PPPSPPPPPPPSPPPPPPPSPPPPSPP 360

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 39/90 (43%), Positives = 39/90 (43%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P  P     P     P P  P  P  P  P  P   PPPP  P P
Sbjct: 303 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 362

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPPPP P P P PPP  P
Sbjct: 363 SPPP-PSPPPPSPPPPPPPSPPPPPPPSPP 391

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 39/91 (42%), Positives = 39/91 (42%), Gaps = 1/91 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPK-EPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           PPPPP P  P  P   P  P  P  P     P    P  P  P  P  P   PPPPP P 
Sbjct: 384 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 443

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P PP  P  P   PP PP P P   PPP  P
Sbjct: 444 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 474

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 37/87 (42%), Positives = 37/87 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P  P  P  P     P P     P  P  P  P   PPPP  P P
Sbjct: 432 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 491

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PP  P  P   PPPPP P P P  PP
Sbjct: 492 PPPSPPPPPPPSPPPPPPPSPPPPSPP 518

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 39/91 (42%), Positives = 39/91 (42%), Gaps = 1/91 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPK-EPEKPKEKPPPPPEPK 218
           PPPPP P  P  P  P  P     P     P P  P  P  P   P  P   PPPPP P 
Sbjct: 438 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 497

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P PP  P  P    PPPP P P   PPP  P
Sbjct: 498 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 528

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 40/90 (44%), Positives = 40/90 (44%), Gaps = 1/90 (1%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P  P     P  P     P P  P  P  P  P  P   PPPPP P P 
Sbjct: 232 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP-PSPPPPPPPSPPPPPPPSPP 290

Query: 225 PPKEPEKPKEKPPPP-PQPQPMPQPPPHIP 311
           PP  P  P   PPPP P P P P PPP  P
Sbjct: 291 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 320

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 38/88 (43%), Positives = 38/88 (43%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPE-KPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           PPPPP P  P   P  P  P  P        P P  P  P  P  P  P   PPPPP P 
Sbjct: 392 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 451

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P PP  P  P   PP PP P P P  PP
Sbjct: 452 PPPPPPPSPPPPPPPSPPPPSPPPPSPP 479

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 39/94 (41%), Positives = 39/94 (41%), Gaps = 4/94 (4%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP    P  P  P  P  P        P P  P  P  P  P  P   PPPPP P P
Sbjct: 453 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 512

Query: 222 EPPK----EPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP      P  P   PP PP P P P PPP  P
Sbjct: 513 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 546

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 38/88 (43%), Positives = 38/88 (43%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK-EPEKPKEPEKPKEKPPPPPEPK 218
           PPPPP P  P  P     P  P  P     P P  P   P  P  P  P   PPPPP P 
Sbjct: 436 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 495

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P PP  P  P   PP PP P P P  PP
Sbjct: 496 PPPPPPPSPPPPPPPSPPPPSPPPPSPP 523

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 40/91 (43%), Positives = 40/91 (43%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P  P     P  P     P P  P  P  P  P  P   PPPPP P P 
Sbjct: 227 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP--PPSPPPPSPPPPPPPSPPPP 284

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
           PP  P  P    PPPP P P P PPP  P S
Sbjct: 285 PPPSPPPPPPPSPPPPSPPP-PSPPPPPPPS 314

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 37/90 (41%), Positives = 37/90 (41%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP    P  P  P  P  P        P P  P  P  P  P  P   PPPPP P P
Sbjct: 339 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 398

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P      P PPP   P P PPP  P
Sbjct: 399 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 428

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 37/90 (41%), Positives = 37/90 (41%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P     P  P  P     P P  P  P     P  P   PPP P P  
Sbjct: 348 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 407

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PP PP P P P PPP  P
Sbjct: 408 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 437

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 37/90 (41%), Positives = 37/90 (41%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP PP P  P     P  P  P  P     P P  P  P     P  P    PPPP P P
Sbjct: 356 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 415

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             P  P  P   PPPPP P P P PPP  P
Sbjct: 416 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 445

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 37/92 (40%), Positives = 37/92 (40%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P     P  P  P     P P  P  P  P     P   PPP P P   
Sbjct: 468 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 527

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIPASC 320
           PP  P  P   PPPPP P P   PPP  P  C
Sbjct: 528 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPC 559

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 37/90 (41%), Positives = 37/90 (41%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPP  P     P  P  P  P  P     P    P  P  P  P  P   PPPPP P P
Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSP 281

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PP PP P P P  PP  P
Sbjct: 282 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPP 311

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 37/90 (41%), Positives = 37/90 (41%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPP  P  P     P  P  P  P     P P  P     P  P  P   PPPPP P P
Sbjct: 325 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 384

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P    PPPP P P   PPP  P
Sbjct: 385 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 414

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 38/89 (42%), Positives = 38/89 (42%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P     P  P  P     P P  P  P  P  P  P   PPPPP P P 
Sbjct: 403 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP-PSPPPPPPPSPPPPPPPSPP 461

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PP  P  P   PPPP  P P P PP   P
Sbjct: 462 PPPPPSPPPPSPPPPSPPPPSPPPPSPPP 490

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 37/90 (41%), Positives = 37/90 (41%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP    P  P  P  P     P     P P  P  P  P  P  P   PPPP  P P
Sbjct: 461 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 520

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP     P   PPP P P P P PPP  P
Sbjct: 521 SPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 550

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 40/93 (43%), Positives = 40/93 (43%), Gaps = 1/93 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P     P  P     P P  P  P  P  P  P   PP PP P P
Sbjct: 198 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP--PPSPPPPPPPSPPPPSPPPPSP 255

Query: 222 EPPKEPEKPKEKPPPP-PQPQPMPQPPPHIPAS 317
            PP  P  P   PPPP P P P P PPP  P S
Sbjct: 256 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 288

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 38/92 (41%), Positives = 38/92 (41%), Gaps = 2/92 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP PP P  P     P  P  P  P     P    P  P  P  P  P   PPPP  P P
Sbjct: 199 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258

Query: 222 EPPK--EPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP    P  P   PPPPP P P P PPP  P
Sbjct: 259 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 290

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 36/87 (41%), Positives = 36/87 (41%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPP  P     P  P  P  P  P     P    P  P  P  P  P   PPPP  P P
Sbjct: 217 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 276

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PP  P  P   PPPPP P P P  PP
Sbjct: 277 PPPSPPPPPPPSPPPPPPPSPPPPSPP 303

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 38/91 (41%), Positives = 39/91 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P  P  P  P     P    P  P  P  P  P   PPPP  P P
Sbjct: 269 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
            PP  P  P   PPPPP P P P P P  P+
Sbjct: 329 SPPPPPP-PSPPPPPPPSPPPPPPPSPPPPS 358

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 37/86 (43%), Positives = 37/86 (43%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P  P  P  P  P     P P     P  P  P  P   PPPP  P P 
Sbjct: 320 PPPPSPPPPSPPPPP-PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 378

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PP  P  P   PPPPP P P P  PP
Sbjct: 379 PPSPPPPPPPSPPPPPPPSPPPPSPP 404

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 36/87 (41%), Positives = 36/87 (41%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P     P  P  P  P     P P     P  P  P  P    PPPP P P
Sbjct: 346 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 405

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
             P  P  P   PPPP  P P P PPP
Sbjct: 406 PSPPPPSPPPPSPPPPSPPPPSPPPPP 432

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 38/89 (42%), Positives = 38/89 (42%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P  P  P     P     P P  P  P     P  P   PPP P P P 
Sbjct: 382 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP-PP 440

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PP  P  P   PPPPP P P P PPP  P
Sbjct: 441 PPSPPPPPPPSPPPPPPPSPPPPPPPSPP 469

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 38/90 (42%), Positives = 38/90 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P     P  P  P     P P  P  P     P  P    PPPP P P
Sbjct: 273 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 332

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PPP P P P P PPP  P
Sbjct: 333 PPPPSPPPP---PPPSPPPPPPPSPPPPSP 359

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 40/96 (41%), Positives = 40/96 (41%), Gaps = 4/96 (4%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEPK 218
           PPPPP P  P  P  P  P     P     P P  P  P   P  P  P   PPPPP P 
Sbjct: 332 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 391

Query: 219 PEPPKEPEKPKE---KPPPPPQPQPMPQPPPHIPAS 317
           P PP  P  P      PPPP  P P P PP   P S
Sbjct: 392 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 427

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 40/102 (39%), Positives = 41/102 (40%), Gaps = 1/102 (0%)
 Frame = +3

Query: 9   CGAIKSIEILEPPPP-PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKP 185
           C  I +  I  PPPP P P  P  P  P     P  P     P P  P     P  P  P
Sbjct: 181 CCPISTPGIPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 240

Query: 186 KEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
               PPPP P P  P  P  P   PP PP P P P PPP  P
Sbjct: 241 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 282

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 36/90 (40%), Positives = 37/90 (41%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P     P  P  P     P P  P     P  P  P    PPPP P P 
Sbjct: 212 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 271

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
            P  P  P   PPPPP P P P P P  P+
Sbjct: 272 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 301

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 38/94 (40%), Positives = 38/94 (40%), Gaps = 4/94 (4%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P  P     P     P P  P  P  P  P  P   PPPP  P P
Sbjct: 246 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 305

Query: 222 E----PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
                PP  P  P   PP PP P P P PPP  P
Sbjct: 306 SPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 339

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 37/92 (40%), Positives = 37/92 (40%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P  P  P  P     P    P  P  P  P      PPPP  P P
Sbjct: 326 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 385

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            PP  P  P   PPPP  P P P PP   P S
Sbjct: 386 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 417

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 39/91 (42%), Positives = 39/91 (42%), Gaps = 1/91 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP-PPPEPK 218
           PPPPP P  P     P  P  P  P     P    P  P  P  P  P   PP PPP P 
Sbjct: 390 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 449

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P PP  P  P   PPPPP   P P PPP  P
Sbjct: 450 PSPP--PPPPPSPPPPPPPSPPPPSPPPPSP 478

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 39/94 (41%), Positives = 39/94 (41%), Gaps = 4/94 (4%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEPK 218
           PPPPP P  P  P  P  P     P     P P  P  P   P  P  P   PPPPP P 
Sbjct: 446 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 505

Query: 219 PEPPKEPEKPKE---KPPPPPQPQPMPQPPPHIP 311
           P PP  P  P      PPPP  P P P PP   P
Sbjct: 506 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 539

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 36/90 (40%), Positives = 36/90 (40%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P     P  P     P P  P  P  P     P   PPP P P P
Sbjct: 218 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPP 277

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P   P  P   PPPPP   P P PPP  P
Sbjct: 278 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 307

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 37/89 (41%), Positives = 37/89 (41%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P     P  P  P     P P  P     P  P  P    PPPP P P 
Sbjct: 217 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 276

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PP  P  P   PPP P P P P PPP  P
Sbjct: 277 PPPSPPPP---PPPSPPPPPPPSPPPPSP 302

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 38/94 (40%), Positives = 38/94 (40%), Gaps = 2/94 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE--P 215
           PPP P P  P  P  P     P  P     P P  P  P     P  P   PPPPP   P
Sbjct: 394 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 453

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            P PP  P  P   PPPP  P P P PP   P S
Sbjct: 454 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 487

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 37/90 (41%), Positives = 37/90 (41%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P  P     P     P P  P  P  P     P   P PPP P P
Sbjct: 228 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 287

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P   PP PP P P P PPP  P
Sbjct: 288 SPP-PPPPPSPPPPSPPPPSPPPPPPPSPP 316

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 38/92 (41%), Positives = 38/92 (41%), Gaps = 3/92 (3%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP- 221
           PPPP P  P  P  P  P  P  P     P P  P     P  P  P   PPP P P P 
Sbjct: 237 PPPPPPPSPPPPSPP--PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294

Query: 222 --EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
              PP  P  P   PPPPP P P   PPP  P
Sbjct: 295 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 326

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 37/94 (39%), Positives = 37/94 (39%), Gaps = 4/94 (4%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P     P  P     P P  P  P  P  P      PPPP  P P
Sbjct: 404 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 463

Query: 222 EPPK----EPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP      P  P   PP PP P P P PPP  P
Sbjct: 464 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 497

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 35/90 (38%), Positives = 35/90 (38%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPP P P  P  P  P     P  P     P P  P  P  P     P   P PPP P P
Sbjct: 399 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 458

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P      P PPP   P P PPP  P
Sbjct: 459 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 488

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 35/90 (38%), Positives = 35/90 (38%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP PP P  P     P  P  P  P     P P     P  P  P  P    PPPP P  
Sbjct: 400 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 459

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PP  P  P    PPPP P P   PPP  P
Sbjct: 460 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 489

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 32/81 (39%), Positives = 32/81 (39%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPP  P     P  P  P  P  P     P P  P     P  P  P   PP PP P P
Sbjct: 478 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 537

Query: 222 EPPKEPEKPKEKPPPPPQPQP 284
            PP  P  P   PPPP  P P
Sbjct: 538 PPPPPPSPPPPSPPPPSPPPP 558

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 33/78 (42%), Positives = 33/78 (42%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P     P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 488 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP--PPSPPPPSPPPPSPPPPPPPSP 545

Query: 222 EPPKEPEKPKEKPPPPPQ 275
            PP  P      PPPP Q
Sbjct: 546 PPPSPPPP---SPPPPCQ 560

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 39/113 (34%), Positives = 45/113 (39%), Gaps = 13/113 (11%)
 Frame = +3

Query: 3   KGCGAIKSIEILEPPPPPKPK--------EPEKPKEPVK----PKEPEKPKEQEKPKPKK 146
           KGC  ++ + I   PPP  PK        + +    P+     P  P        P P  
Sbjct: 150 KGCTTLEELCI---PPPGLPKGVCSAALFDSQNDCCPISTPGIPSPPPPSPPPPSPPPPS 206

Query: 147 PKEPEKPKEPEKPKEKPPP-PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P  P  P     P   PPP PP P P PP  P  P   PPPP  P P P PPP
Sbjct: 207 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPP 259

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 24/51 (47%), Positives = 24/51 (47%)
 Frame = +3

Query: 165 PKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
           P  P  P   PPPP  P P PP  P  P   PPPP  P P P PP   P S
Sbjct: 187 PGIPSPPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPPSPPPPSPPPPS 236

[81][TOP]
>UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA
          Length = 599

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/92 (44%), Positives = 41/92 (44%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PP P P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P 
Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPP-PSPPPPPPPPPPPPPPPPPPPPPPPS 276

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIPASC 320
           PP  P  P   PPPPP P P P PPP  P  C
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPVYPDQC 308

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 38/88 (43%), Positives = 38/88 (43%)
 Frame = +3

Query: 48  PPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEP 227
           P P P  P  P  P  P  P        P P  P  P  P  P  P   PPPPP P P P
Sbjct: 211 PLPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPP 270

Query: 228 PKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P  P  P   PPPPP P P P PPP  P
Sbjct: 271 PPPPPSPPPPPPPPPPPPPPPPPPPPPP 298

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 34/81 (41%), Positives = 34/81 (41%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPP----PPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293

Query: 222 EPPKEPEKPKEKPPPPPQPQP 284
            PP         PPPPP   P
Sbjct: 294 PPP---------PPPPPPVYP 305

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 31/77 (40%), Positives = 31/77 (40%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP PP P  P  P  P  P  P  P     P P  P  P     P  P   PPPPP P P
Sbjct: 235 PPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294

Query: 222 EPPKEPEKPKEKPPPPP 272
            PP         PPPPP
Sbjct: 295 PPP---------PPPPP 302

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 28/68 (41%), Positives = 30/68 (44%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P     P  P  P  P     P P  P  P  P  P  P   PPPPP P P
Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299

Query: 222 EPPKEPEK 245
            PP  P++
Sbjct: 300 PPPVYPDQ 307

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 28/79 (35%), Positives = 30/79 (37%), Gaps = 5/79 (6%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK-----PKEPEKPKEPEKPKEKPPPP 206
           PPPPP P  P  P  P  P  P  P     P P       P  P  P  P  P   PPPP
Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300

Query: 207 PEPKPEPPKEPEKPKEKPP 263
           P   P+        K +PP
Sbjct: 301 PPVYPDQCSVCIVAKLQPP 319

[82][TOP]
>UniRef100_Q96VJ1 Protease-1 (PRT1) protein, putative n=1 Tax=Pneumocystis carinii
            RepID=Q96VJ1_PNECA
          Length = 897

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/103 (39%), Positives = 60/103 (58%), Gaps = 10/103 (9%)
 Frame = +3

Query: 39   EPPPPPKPKEPEKPK---------EPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPK 188
            EPPPPP P  P +P+         E   P+ P+ P+ + +P+P+   EPE   EPE +P+
Sbjct: 711  EPPPPPPPPPPPRPEPQPQPETQPETQPPQPPQPPQSETQPEPEPEPEPEPEPEPEPEPE 770

Query: 189  EKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
             +P P P+P+PEP  +PE    +P P P+P+  P+P P  PAS
Sbjct: 771  PEPEPEPQPEPEPETQPEPQPPQPEPEPEPETQPEPQPEPPAS 813

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 41/98 (41%), Positives = 60/98 (61%), Gaps = 8/98 (8%)
 Frame = +3

Query: 42   PPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
            PPPPP+P+   +PE   E   P+ P+ P+ + +P+P+   EPE   EPE   +P+ +P P
Sbjct: 718  PPPPPRPEPQPQPETQPETQPPQPPQPPQSETQPEPEPEPEPEPEPEPEPEPEPEPEPEP 777

Query: 204  PPEPKPEPPKEPEKPKEKPPPPP--QPQPMPQPPPHIP 311
             PEP+PE   EP+ P+ +P P P  QP+P P+PP   P
Sbjct: 778  QPEPEPETQPEPQPPQPEPEPEPETQPEPQPEPPASPP 815

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 37/87 (42%), Positives = 51/87 (58%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           +PP PP+P + E   EP    EPE +P+ + +P+P+   EP+   EPE   E  PP PEP
Sbjct: 737 QPPQPPQPPQSETQPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPETQPEPQPPQPEP 796

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PEP  +PE   E P  PP+ QP  +P
Sbjct: 797 EPEPETQPEPQPEPPASPPKLQPEQKP 823

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 38/123 (30%), Positives = 57/123 (46%), Gaps = 32/123 (26%)
 Frame = +3

Query: 39   EPPPPPKP-------------------------------KEPEKPKEPVKPKEPE-KPKE 122
            +PP  P+P                                EP  P  P  P  PE +P+ 
Sbjct: 671  QPPLDPQPPSKPDSNPPSDPSSQQDPDTSLSSNPTSTSSSEPPPPPPPPPPPRPEPQPQP 730

Query: 123  QEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            + +P+ + P+ P+ P+   +P+ +P P PEP+PEP  EPE P+ +P P P+P+P  QP P
Sbjct: 731  ETQPETQPPQPPQPPQSETQPEPEPEPEPEPEPEPEPEPE-PEPEPEPQPEPEPETQPEP 789

Query: 303  HIP 311
              P
Sbjct: 790  QPP 792

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 30/97 (30%), Positives = 49/97 (50%), Gaps = 8/97 (8%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPE--------KPKEQEKPKPKKPKEPEKPKEPEKPKE 191
           L+P PP KP +   P +P   ++P+             E P P  P  P +P+   +P+ 
Sbjct: 674 LDPQPPSKP-DSNPPSDPSSQQDPDTSLSSNPTSTSSSEPPPPPPPPPPPRPEPQPQPET 732

Query: 192 KPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           +P   P   P+PP+   +P+ +P P P+P+P P+P P
Sbjct: 733 QPETQPPQPPQPPQSETQPEPEPEPEPEPEPEPEPEP 769

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 29/104 (27%), Positives = 40/104 (38%), Gaps = 12/104 (11%)
 Frame = +3

Query: 42  PPPPP------------KPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKP 185
           PPP P            +P      + P+ P+ P KP       P   ++P+        
Sbjct: 646 PPPDPDATPSPDLDANLQPDSNADSQPPLDPQPPSKPDSNPPSDPSSQQDPDTSLSSNPT 705

Query: 186 KEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
                 PP P P PP  P +P+ +P P  QP+  P  PP  P S
Sbjct: 706 STSSSEPPPPPPPPP--PPRPEPQPQPETQPETQPPQPPQPPQS 747

[83][TOP]
>UniRef100_Q9JLE8 GABA-A receptor epsilon-like subunit n=1 Tax=Mus musculus
           RepID=Q9JLE8_MOUSE
          Length = 910

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 45/92 (48%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   EPE   EPE +P+ +P P P
Sbjct: 253 EPQPQPEPQPEPEPQPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPEPEPQPEPQPEPQP 312

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE KP+ +P P P+P+P P+P P
Sbjct: 313 EPKPEPEPQPEPKPEPEPQPEPEPEPEPEPQP 344

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    +PE KP+ + +P+PK   EP+   EPE P+ +P P PE
Sbjct: 289 EPKPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPEPKPEPEPQPEPEPE-PEPEPQPEPE 347

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PKPEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 348 PKPEPQPEPEPEPEPEPEPEPEPEPEPEPEP 378

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EP+ +P+ + KP+P+   EPE   EP+ +P+ +P P P
Sbjct: 259 EPQPEPEPQPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPEPEPQPEPQPEPQPEPKPEP 318

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+PQP P+P P
Sbjct: 319 EPQPEPKPEPEPQPEPEPEPEPEPQPEPEPKP 350

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 39/89 (43%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +P+   +PK   +P+ + KP+P+   EPE   EPE P+ +P P PEP+
Sbjct: 295 EPQPEPEPQPEPQPEPQPEPKPEPEPQPEPKPEPEPQPEPEPEPEPE-PQPEPEPKPEPQ 353

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 354 PEPEPEPEPEPEPEPEPEPEPEPEPEPEP 382

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ +PE   EP    EPE +P+ Q +P+P+   EPE   EP KP+ +P P PE
Sbjct: 277 EPQPEPQPEPQPEPKPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPEP-KPEPEPQPEPE 335

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  +PE +PK +P P P+P+P P+P P
Sbjct: 336 PEPEPEPQPEPEPKPEPQPEPEPEPEPEPEP 366

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/90 (47%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP EPE   EP    EP+ P+ Q +PKP+   +PE   EPE +P+ +P P PEP
Sbjct: 285 EPQPEPKP-EPEPQPEPEPQPEPQ-PEPQPEPKPEPEPQPEPKPEPEPQPEPEPEPEPEP 342

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  +PE +P+ +P P P+P+P P+P P
Sbjct: 343 QPEPEPKPEPQPEPEPEPEPEPEPEPEPEP 372

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 38/88 (43%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +P+   +P+   +P+ Q +P+P+   +PE   EP KP+ +P P PEP+
Sbjct: 245 EPQPEPQPEPQPQPEPQPEPEPQPEPEPQPEPEPQPEPQPEPQPEP-KPEPEPQPEPEPQ 303

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+ P+ KP P PQP+P P+P P
Sbjct: 304 PEPQPEPQ-PEPKPEPEPQPEPKPEPEP 330

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/97 (44%), Positives = 60/97 (61%), Gaps = 9/97 (9%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           EP P P+P+ EPE   EP    +PE PK + +P+P+   +PE   EP+ +PK +P P PE
Sbjct: 265 EPQPEPEPQPEPEPQPEPQPEPQPE-PKPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPE 323

Query: 213 PKPEPPKEPE-------KPKEKPPPPPQPQPMPQPPP 302
           PKPEP  +PE       +P+ +P P P+PQP P+P P
Sbjct: 324 PKPEPEPQPEPEPEPEPEPQPEPEPKPEPQPEPEPEP 360

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 37/90 (41%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+P+   +P+   KP+   +P+ + +P+P+   +PE   EPE +P+ KP P P+P
Sbjct: 273 QPEPEPQPEPQPEPQPEPKPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPEPKPEPEPQP 332

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P PQP+P P+P P
Sbjct: 333 EPEPEPEPEPQPEPEPKPEPQPEPEPEPEP 362

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 37/90 (41%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+P+   +P+   +P+   +P+ + +P+P+   EPE   EPE +P+ +P P PEP
Sbjct: 231 QPRPRPQPEPQPQPEPQPEPQPEPQPQPEPQPEPEPQPEPEPQPEPEPQPEPQPEPQPEP 290

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE +P+ +P P PQP+P P+P P
Sbjct: 291 KPEPEPQPEPEPQPEPQPEPQPEPKPEPEP 320

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 41/99 (41%), Positives = 60/99 (60%), Gaps = 10/99 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +PK   +P+   KP+ + +P+P+   EPE   EPE KP+ +P P PEP
Sbjct: 301 EPQPEPQPEPQPEPKPEPEPQPEPKPEPEPQPEPEPEPEPEPQPEPEPKPEPQPEPEPEP 360

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQ--------PMPQPPPH 305
           +PEP  EPE +P+ +P P P+P+        P P+P PH
Sbjct: 361 EPEPEPEPEPEPEPEPEPEPEPESESELDLEPEPEPHPH 399

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 45/96 (46%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+PK EPE   EP    EPE P+ + +PKP+   EPE   EPE P+ +P P PEP
Sbjct: 317 EPEPQPEPKPEPEPQPEPEPEPEPE-PQPEPEPKPEPQPEPEPEPEPE-PEPEPEPEPEP 374

Query: 216 KPEPPKEPE-------KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE       +P+ +P P P P P P+P P
Sbjct: 375 EPEPEPEPESESELDLEPEPEPHPHPHPHPHPEPEP 410

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 36/90 (40%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +P+   +P+   +P+ Q +P+P+   EP+   +PE +P+ KP P P+P
Sbjct: 239 EPQPQPEPQPEPQPEPQPQPEPQPEPEPQPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQP 298

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EP+ +P+ +P P P+PQP P+P P
Sbjct: 299 EPEPQPEPQPEPQPEPKPEPEPQPEPKPEP 328

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 40/90 (44%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P +PE   EP    EPE +P+ + +P+P+   +PE   EPE P+ +P P PEP
Sbjct: 249 EPQPEPQP-QPEPQPEPEPQPEPEPQPEPEPQPEPQPEPQPEPKPEPE-PQPEPEPQPEP 306

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EP+ +P+ +P P P+P+P P+P P
Sbjct: 307 QPEPQPEPKPEPEPQPEPKPEPEPQPEPEP 336

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEP------EKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKP 197
           +P P P+P+ P       +P+   +P+   +P+ Q +P+P+   +PE   EPE +P+ +P
Sbjct: 213 QPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEPQPEPQPQPEPQPEPEPQPEPEP 272

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P PEP+PEP  EP+ P+ KP P PQP+P PQP P
Sbjct: 273 QPEPEPQPEPQPEPQ-PEPKPEPEPQPEPEPQPEP 306

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 35/90 (38%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +P+ P + +   +P+ + +P+P+   EP+   +PE +P+ +P P PEP
Sbjct: 207 EPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEPQPEPQPQPEPQPEPEP 266

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  +PE +P+ +P P PQP+P P+P P
Sbjct: 267 QPEPEPQPEPEPQPEPQPEPQPEPKPEPEP 296

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 35/90 (38%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+P+   +P+   +P+ P + +   +P+P+   EP+   EP+ +P+ +P P PEP
Sbjct: 201 QPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEPQPEPQPQPEP 260

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  +PE +P+ +P P P+PQP PQP P
Sbjct: 261 QPEPEPQPEPEPQPEPEPQPEPQPEPQPEP 290

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 42/102 (41%), Positives = 59/102 (57%), Gaps = 12/102 (11%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---------KP 185
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE         +P
Sbjct: 335 EPEPEPEPQPEPEPKPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPESESELDLEPEP 394

Query: 186 KEKPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
           +  P P P P PEP  EPE +P+ +P P P+P+P P+P P +
Sbjct: 395 EPHPHPHPHPHPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEM 436

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 37/90 (41%), Positives = 60/90 (66%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P EP+ P +    ++P +P+ Q +P+P+   +PE   EP+ +P+ +P P P+P
Sbjct: 211 EPQPEPQP-EPQTPGQVQAGRQP-RPRPQPEPQPQPEPQPEPQPEPQPQPEPQPEPEPQP 268

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 269 EPEPQPEPEPQPEPQPEPQPEPKPEPEPQP 298

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 35/92 (38%), Positives = 56/92 (60%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP 209
           EP P P+P+   EP+   +P    EP+ P + +  +  +P+   +P+   +P+ +P P P
Sbjct: 195 EPQPDPQPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEPQPEP 254

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+PEP  EPE +P+ +P P P+PQP PQP P
Sbjct: 255 QPQPEPQPEPEPQPEPEPQPEPEPQPEPQPEP 286

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 33/89 (37%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPK 218
           P P P+P+    P+   +P+   +P+ + +P+P+ P + +  ++P  +P+ +P P PEP+
Sbjct: 188 PLPEPQPEPQPDPQPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQ 247

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+ +P+ +P P PQP+P PQP P
Sbjct: 248 PEPQPEPQPQPEPQPEPEPQPEPEPQPEP 276

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 41/92 (44%), Positives = 54/92 (58%), Gaps = 1/92 (1%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+ EPE   EP    EPE P+ Q +P+P+ P    +P     P   P P PEP
Sbjct: 135 EPEPEPEPEPEPEPEPEPEPEPEPE-PEPQPEPQPQ-PLAGRQPLPQPLPWPLPLPLPEP 192

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           +PEP  +P+ P+ +P P P+PQP PQP P  P
Sbjct: 193 QPEPQPDPQ-PEPQPEPQPEPQPEPQPEPQTP 223

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 35/90 (38%), Positives = 52/90 (57%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P  +PE   EP    +PE   E + P   +     +P+   +P+ +P P PEP
Sbjct: 191 EPQPEPQPDPQPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEP 250

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  +PE +P+ +P P P+PQP P+P P
Sbjct: 251 QPEPQPQPEPQPEPEPQPEPEPQPEPEPQP 280

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 33/87 (37%), Positives = 55/87 (63%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P+P+   +P    +P+   +P+ Q +P+P+ P+ P + +   +P+ +P P P+P+P
Sbjct: 186 PLPLPEPQPEPQPDPQPEPQPEPQPEPQPEPQPE-PQTPGQVQAGRQPRPRPQPEPQPQP 244

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP  EP+ P+ +P P PQP+P PQP P
Sbjct: 245 EPQPEPQ-PEPQPQPEPQPEPEPQPEP 270

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/90 (42%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEP-EKPKEPEKPKEKPPPPPEP 215
           +P P P+P+   +P+   +P EPE P+ Q +P+P   ++P  +P     P+ +P P PEP
Sbjct: 83  QPQPMPQPQPMPEPQPQPEP-EPE-PQPQPQPQPLAGRQPLPQPLPWPMPQPQPEPEPEP 140

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+PQP PQP P
Sbjct: 141 EPEPEPEPEPEPEPEPEPEPEPQPEPQPQP 170

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/100 (38%), Positives = 53/100 (53%), Gaps = 12/100 (12%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P P+P+   +P+   +P    +P  Q  P P     PE   EP+   +P+ +P P P
Sbjct: 151 EPEPEPEPEPEPQPEPQPQPLAGRQPLPQPLPWPLPLPLPEPQPEPQPDPQPEPQPEPQP 210

Query: 210 EPKPEPPKEPE---------KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EP+         +P+ +P P PQPQP PQP P
Sbjct: 211 EPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEP 250

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +P+   +P    +P  Q  P P    +PE   EPE    +P P PEP+
Sbjct: 95  EPQPQPEPEPEPQPQPQPQPLAGRQPLPQPLPWPMPQPQPEPEPEPEP---EPEPEPEPE 151

Query: 219 PEPPKEPEKPKEKPPPPPQP----QPMPQPPP 302
           PEP  EPE P+ +P P PQP    QP+PQP P
Sbjct: 152 PEPEPEPE-PEPQPEPQPQPLAGRQPLPQPLP 182

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 40/96 (41%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEK-----PKEKP 197
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   E E   EPE      P   P
Sbjct: 345 EPEPKPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPESESELDLEPEPEPHPHPHPHP 404

Query: 198 PPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            P PEP+PEP  EPE +P+ +P P P+P+P  +  P
Sbjct: 405 HPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEMKSEP 440

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 36/91 (39%), Positives = 56/91 (61%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKE-PEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKE-KPPPPP 209
           +P P P P   PE   EP    +PE +P+ Q +P+P+   EP+ P + +  ++ +P P P
Sbjct: 179 QPLPWPLPLPLPEPQPEPQPDPQPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQP 238

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+P+P  +PE P+ +P P P+PQP P+P P
Sbjct: 239 EPQPQPEPQPE-PQPEPQPQPEPQPEPEPQP 268

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           +P P P+P+ EPE   EP    EPE P+ + +P+P+   +P   ++P  P+  P P P P
Sbjct: 131 QPQPEPEPEPEPEPEPEPEPEPEPE-PEPEPEPQPEPQPQPLAGRQP-LPQPLPWPLPLP 188

Query: 216 KPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
            PEP  EP+  P+ +P P PQP+P P+P P
Sbjct: 189 LPEPQPEPQPDPQPEPQPEPQPEPQPEPQP 218

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 38/105 (36%), Positives = 50/105 (47%), Gaps = 17/105 (16%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +P    +P     P    +P+P+   EPE   EPE P+ +P P PEP+
Sbjct: 101 EPEPEPQPQPQPQPLAGRQPLPQPLPWPMPQPQPEPEPEPEPEPEPE-PEPEPEPEPEPE 159

Query: 219 PEPPKEPEK-----------------PKEKPPPPPQPQPMPQPPP 302
           PEP  EP+                  P   P P P+PQP PQP P
Sbjct: 160 PEPQPEPQPQPLAGRQPLPQPLPWPLPLPLPEPQPEPQPDPQPEP 204

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 34/88 (38%), Positives = 51/88 (57%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEPK 218
           P P P P     P+   +P+   +P+ Q +P+P+   EP+ +P+ P + +    P P P+
Sbjct: 178 PQPLPWPLPLPLPEPQPEPQPDPQPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQ 237

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE P+ +P P PQPQP PQP P
Sbjct: 238 PEPQPQPE-PQPEPQPEPQPQPEPQPEP 264

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 39/108 (36%), Positives = 53/108 (49%), Gaps = 14/108 (12%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQE-----KPKPKKPKEPEKPKEPE-KPKEKP 197
           EP P P+P+ EPE   EP    EPE   E E     +P+P     P    EPE +P+ +P
Sbjct: 357 EPEPEPEPEPEPEPEPEPEPEPEPEPESESELDLEPEPEPHPHPHPHPHPEPEPEPEPEP 416

Query: 198 PPPPEPKPEPPKEPE-------KPKEKPPPPPQPQPMPQPPPHIPASC 320
            P PEP+PEP  EPE       +P+ +  P P  + +P   P +   C
Sbjct: 417 EPEPEPEPEPEPEPEPEPEMKSEPQSQLEPQPSGKKLPAKEPELTVDC 464

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 20/108 (18%)
 Frame = +3

Query: 39  EPPPPPKP-KEPEKPKE------PVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKP 197
           +P P P+P   PE P        P    + E P   +     +P+   +P+   +P+ +P
Sbjct: 41  QPQPVPQPLTPPESPAGDTVVFGPQPQPQAESPGHDDVVFSSQPQPMPQPQPMPEPQPQP 100

Query: 198 PPPPEPKPEPPKEP-------------EKPKEKPPPPPQPQPMPQPPP 302
            P PEP+P+P  +P               P+ +P P P+P+P P+P P
Sbjct: 101 EPEPEPQPQPQPQPLAGRQPLPQPLPWPMPQPQPEPEPEPEPEPEPEP 148

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 36/105 (34%), Positives = 52/105 (49%), Gaps = 16/105 (15%)
 Frame = +3

Query: 36  LEPPPPPKPK-----EPEKPKEPVKPKEPEKPK-------EQEKPKPKKPKEPEKPKEPE 179
           LE  PP + K     +P+   +P+ P  PE P         Q +P+ + P   +     +
Sbjct: 26  LENKPPAQDKVVFGPQPQPVPQPLTP--PESPAGDTVVFGPQPQPQAESPGHDDVVFSSQ 83

Query: 180 KPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQP----QPMPQPPP 302
            P+  P P P P+P+P  EPE P+ +P P PQP    QP+PQP P
Sbjct: 84  -PQPMPQPQPMPEPQPQPEPE-PEPQPQPQPQPLAGRQPLPQPLP 126

[84][TOP]
>UniRef100_Q9JLE7 GABA-A receptor epsilon-like subunit n=1 Tax=Mus musculus
           RepID=Q9JLE7_MOUSE
          Length = 912

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 45/92 (48%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   EPE   EPE +P+ +P P P
Sbjct: 253 EPQPQPEPQPEPEPQPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPEPEPQPEPQPEPQP 312

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EPKPEP  +PE KP+ +P P P+P+P P+P P
Sbjct: 313 EPKPEPEPQPEPKPEPEPQPEPEPEPEPEPQP 344

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    +PE KP+ + +P+PK   EP+   EPE P+ +P P PE
Sbjct: 289 EPKPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPEPKPEPEPQPEPEPE-PEPEPQPEPE 347

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PKPEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 348 PKPEPQPEPEPEPEPEPEPEPEPEPEPEPEP 378

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EP+ +P+ + KP+P+   EPE   EP+ +P+ +P P P
Sbjct: 259 EPQPEPEPQPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPEPEPQPEPQPEPQPEPKPEP 318

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+PQP P+P P
Sbjct: 319 EPQPEPKPEPEPQPEPEPEPEPEPQPEPEPKP 350

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 39/89 (43%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +P+   +PK   +P+ + KP+P+   EPE   EPE P+ +P P PEP+
Sbjct: 295 EPQPEPEPQPEPQPEPQPEPKPEPEPQPEPKPEPEPQPEPEPEPEPE-PQPEPEPKPEPQ 353

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 354 PEPEPEPEPEPEPEPEPEPEPEPEPEPEP 382

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 46/93 (49%), Positives = 55/93 (59%), Gaps = 4/93 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+PK EPE   EP    EPE P+ + +PKP+   EPE   EPE P+ +P P PEP
Sbjct: 317 EPEPQPEPKPEPEPQPEPEPEPEPE-PQPEPEPKPEPQPEPEPEPEPE-PEPEPEPEPEP 374

Query: 216 KPEPPKEPEKPKE---KPPPPPQPQPMPQPPPH 305
           +PEP  EPE   E   +P P P P P P P PH
Sbjct: 375 EPEPEPEPESESELDLEPEPEPHPHPHPHPHPH 407

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ +PE   EP    EPE +P+ Q +P+P+   EPE   EP KP+ +P P PE
Sbjct: 277 EPQPEPQPEPQPEPKPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPEP-KPEPEPQPEPE 335

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  +PE +PK +P P P+P+P P+P P
Sbjct: 336 PEPEPEPQPEPEPKPEPQPEPEPEPEPEPEP 366

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/90 (47%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P PKP EPE   EP    EP+ P+ Q +PKP+   +PE   EPE +P+ +P P PEP
Sbjct: 285 EPQPEPKP-EPEPQPEPEPQPEPQ-PEPQPEPKPEPEPQPEPKPEPEPQPEPEPEPEPEP 342

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  +PE +P+ +P P P+P+P P+P P
Sbjct: 343 QPEPEPKPEPQPEPEPEPEPEPEPEPEPEP 372

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 38/88 (43%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +P+   +P+   +P+ Q +P+P+   +PE   EP KP+ +P P PEP+
Sbjct: 245 EPQPEPQPEPQPQPEPQPEPEPQPEPEPQPEPEPQPEPQPEPQPEP-KPEPEPQPEPEPQ 303

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+ P+ KP P PQP+P P+P P
Sbjct: 304 PEPQPEPQ-PEPKPEPEPQPEPKPEPEP 330

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/97 (44%), Positives = 60/97 (61%), Gaps = 9/97 (9%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           EP P P+P+ EPE   EP    +PE PK + +P+P+   +PE   EP+ +PK +P P PE
Sbjct: 265 EPQPEPEPQPEPEPQPEPQPEPQPE-PKPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPE 323

Query: 213 PKPEPPKEPE-------KPKEKPPPPPQPQPMPQPPP 302
           PKPEP  +PE       +P+ +P P P+PQP P+P P
Sbjct: 324 PKPEPEPQPEPEPEPEPEPQPEPEPKPEPQPEPEPEP 360

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 37/90 (41%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+P+   +P+   KP+   +P+ + +P+P+   +PE   EPE +P+ KP P P+P
Sbjct: 273 QPEPEPQPEPQPEPQPEPKPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQPEPKPEPEPQP 332

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P PQP+P P+P P
Sbjct: 333 EPEPEPEPEPQPEPEPKPEPQPEPEPEPEP 362

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 37/90 (41%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+P+   +P+   +P+   +P+ + +P+P+   EPE   EPE +P+ +P P PEP
Sbjct: 231 QPRPRPQPEPQPQPEPQPEPQPEPQPQPEPQPEPEPQPEPEPQPEPEPQPEPQPEPQPEP 290

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE +P+ +P P PQP+P P+P P
Sbjct: 291 KPEPEPQPEPEPQPEPQPEPQPEPKPEPEP 320

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 41/99 (41%), Positives = 60/99 (60%), Gaps = 10/99 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +PK   +P+   KP+ + +P+P+   EPE   EPE KP+ +P P PEP
Sbjct: 301 EPQPEPQPEPQPEPKPEPEPQPEPKPEPEPQPEPEPEPEPEPQPEPEPKPEPQPEPEPEP 360

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQ--------PMPQPPPH 305
           +PEP  EPE +P+ +P P P+P+        P P+P PH
Sbjct: 361 EPEPEPEPEPEPEPEPEPEPEPESESELDLEPEPEPHPH 399

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 36/90 (40%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +P+   +P+   +P+ Q +P+P+   EP+   +PE +P+ KP P P+P
Sbjct: 239 EPQPQPEPQPEPQPEPQPQPEPQPEPEPQPEPEPQPEPEPQPEPQPEPQPEPKPEPEPQP 298

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EP+ +P+ +P P P+PQP P+P P
Sbjct: 299 EPEPQPEPQPEPQPEPKPEPEPQPEPKPEP 328

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 40/90 (44%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P +PE   EP    EPE +P+ + +P+P+   +PE   EPE P+ +P P PEP
Sbjct: 249 EPQPEPQP-QPEPQPEPEPQPEPEPQPEPEPQPEPQPEPQPEPKPEPE-PQPEPEPQPEP 306

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EP+ +P+ +P P P+P+P P+P P
Sbjct: 307 QPEPQPEPKPEPEPQPEPKPEPEPQPEPEP 336

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEP------EKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKP 197
           +P P P+P+ P       +P+   +P+   +P+ Q +P+P+   +PE   EPE +P+ +P
Sbjct: 213 QPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEPQPEPQPQPEPQPEPEPQPEPEP 272

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P PEP+PEP  EP+ P+ KP P PQP+P PQP P
Sbjct: 273 QPEPEPQPEPQPEPQ-PEPKPEPEPQPEPEPQPEP 306

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 35/90 (38%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +P+ P + +   +P+ + +P+P+   EP+   +PE +P+ +P P PEP
Sbjct: 207 EPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEPQPEPQPQPEPQPEPEP 266

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  +PE +P+ +P P PQP+P P+P P
Sbjct: 267 QPEPEPQPEPEPQPEPQPEPQPEPKPEPEP 296

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 35/90 (38%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+P+   +P+   +P+ P + +   +P+P+   EP+   EP+ +P+ +P P PEP
Sbjct: 201 QPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEPQPEPQPQPEP 260

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  +PE +P+ +P P P+PQP PQP P
Sbjct: 261 QPEPEPQPEPEPQPEPEPQPEPQPEPQPEP 290

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 37/90 (41%), Positives = 60/90 (66%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P EP+ P +    ++P +P+ Q +P+P+   +PE   EP+ +P+ +P P P+P
Sbjct: 211 EPQPEPQP-EPQTPGQVQAGRQP-RPRPQPEPQPQPEPQPEPQPEPQPQPEPQPEPEPQP 268

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 269 EPEPQPEPEPQPEPQPEPQPEPKPEPEPQP 298

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 35/92 (38%), Positives = 56/92 (60%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP 209
           EP P P+P+   EP+   +P    EP+ P + +  +  +P+   +P+   +P+ +P P P
Sbjct: 195 EPQPDPQPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEPQPEP 254

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+PEP  EPE +P+ +P P P+PQP PQP P
Sbjct: 255 QPQPEPQPEPEPQPEPEPQPEPEPQPEPQPEP 286

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/94 (43%), Positives = 57/94 (60%), Gaps = 4/94 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   E E   EPE +P   P P P
Sbjct: 345 EPEPKPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPESESELDLEPEPEPHPHPHPHP 404

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
            P PEP  EPE +P+ +P P P+P+P P+P P +
Sbjct: 405 HPHPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEM 438

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 33/89 (37%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPK 218
           P P P+P+    P+   +P+   +P+ + +P+P+ P + +  ++P  +P+ +P P PEP+
Sbjct: 188 PLPEPQPEPQPDPQPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQ 247

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+ +P+ +P P PQP+P PQP P
Sbjct: 248 PEPQPEPQPQPEPQPEPEPQPEPEPQPEP 276

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKE---KPPP 203
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE   E   +P P
Sbjct: 335 EPEPEPEPQPEPEPKPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPESESELDLEPEP 394

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            P P P P   P  +P+ +P P P+P+P P+P P
Sbjct: 395 EPHPHPHPHPHPHPEPEPEPEPEPEPEPEPEPEP 428

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 41/92 (44%), Positives = 54/92 (58%), Gaps = 1/92 (1%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+ EPE   EP    EPE P+ Q +P+P+ P    +P     P   P P PEP
Sbjct: 135 EPEPEPEPEPEPEPEPEPEPEPEPE-PEPQPEPQPQ-PLAGRQPLPQPLPWPLPLPLPEP 192

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           +PEP  +P+ P+ +P P P+PQP PQP P  P
Sbjct: 193 QPEPQPDPQ-PEPQPEPQPEPQPEPQPEPQTP 223

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 35/90 (38%), Positives = 52/90 (57%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P  +PE   EP    +PE   E + P   +     +P+   +P+ +P P PEP
Sbjct: 191 EPQPEPQPDPQPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEP 250

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  +PE +P+ +P P P+PQP P+P P
Sbjct: 251 QPEPQPQPEPQPEPEPQPEPEPQPEPEPQP 280

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 43/98 (43%), Positives = 55/98 (56%), Gaps = 10/98 (10%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE KP+ Q +P+P+   EPE   EPE P+ +P P PE
Sbjct: 323 EPKPEPEPQPEPEPEPEPEPQPEPEPKPEPQPEPEPEPEPEPEPEPEPE-PEPEPEPEPE 381

Query: 213 PK--------PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+        PEP   P  P   P P P+P+P P+P P
Sbjct: 382 PESESELDLEPEPEPHPH-PHPHPHPHPEPEPEPEPEP 418

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 33/87 (37%), Positives = 55/87 (63%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P+P+   +P    +P+   +P+ Q +P+P+ P+ P + +   +P+ +P P P+P+P
Sbjct: 186 PLPLPEPQPEPQPDPQPEPQPEPQPEPQPEPQPE-PQTPGQVQAGRQPRPRPQPEPQPQP 244

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP  EP+ P+ +P P PQP+P PQP P
Sbjct: 245 EPQPEPQ-PEPQPQPEPQPEPEPQPEP 270

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/90 (42%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEP-EKPKEPEKPKEKPPPPPEP 215
           +P P P+P+   +P+   +P EPE P+ Q +P+P   ++P  +P     P+ +P P PEP
Sbjct: 83  QPQPMPQPQPMPEPQPQPEP-EPE-PQPQPQPQPLAGRQPLPQPLPWPMPQPQPEPEPEP 140

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+PQP PQP P
Sbjct: 141 EPEPEPEPEPEPEPEPEPEPEPQPEPQPQP 170

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/100 (38%), Positives = 53/100 (53%), Gaps = 12/100 (12%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPP 209
           EP P P+P+   +P+   +P    +P  Q  P P     PE   EP+   +P+ +P P P
Sbjct: 151 EPEPEPEPEPEPQPEPQPQPLAGRQPLPQPLPWPLPLPLPEPQPEPQPDPQPEPQPEPQP 210

Query: 210 EPKPEPPKEPE---------KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EP+         +P+ +P P PQPQP PQP P
Sbjct: 211 EPQPEPQPEPQTPGQVQAGRQPRPRPQPEPQPQPEPQPEP 250

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +P+   +P    +P  Q  P P    +PE   EPE    +P P PEP+
Sbjct: 95  EPQPQPEPEPEPQPQPQPQPLAGRQPLPQPLPWPMPQPQPEPEPEPEP---EPEPEPEPE 151

Query: 219 PEPPKEPEKPKEKPPPPPQP----QPMPQPPP 302
           PEP  EPE P+ +P P PQP    QP+PQP P
Sbjct: 152 PEPEPEPE-PEPQPEPQPQPLAGRQPLPQPLP 182

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 36/91 (39%), Positives = 56/91 (61%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKE-PEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKE-KPPPPP 209
           +P P P P   PE   EP    +PE +P+ Q +P+P+   EP+ P + +  ++ +P P P
Sbjct: 179 QPLPWPLPLPLPEPQPEPQPDPQPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQP 238

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+P+P  +PE P+ +P P P+PQP P+P P
Sbjct: 239 EPQPQPEPQPE-PQPEPQPQPEPQPEPEPQP 268

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           +P P P+P+ EPE   EP    EPE P+ + +P+P+   +P   ++P  P+  P P P P
Sbjct: 131 QPQPEPEPEPEPEPEPEPEPEPEPE-PEPEPEPQPEPQPQPLAGRQP-LPQPLPWPLPLP 188

Query: 216 KPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
            PEP  EP+  P+ +P P PQP+P P+P P
Sbjct: 189 LPEPQPEPQPDPQPEPQPEPQPEPQPEPQP 218

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 38/105 (36%), Positives = 50/105 (47%), Gaps = 17/105 (16%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +P    +P     P    +P+P+   EPE   EPE P+ +P P PEP+
Sbjct: 101 EPEPEPQPQPQPQPLAGRQPLPQPLPWPMPQPQPEPEPEPEPEPEPE-PEPEPEPEPEPE 159

Query: 219 PEPPKEPEK-----------------PKEKPPPPPQPQPMPQPPP 302
           PEP  EP+                  P   P P P+PQP PQP P
Sbjct: 160 PEPQPEPQPQPLAGRQPLPQPLPWPLPLPLPEPQPEPQPDPQPEP 204

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 34/88 (38%), Positives = 51/88 (57%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEPK 218
           P P P P     P+   +P+   +P+ Q +P+P+   EP+ +P+ P + +    P P P+
Sbjct: 178 PQPLPWPLPLPLPEPQPEPQPDPQPEPQPEPQPEPQPEPQPEPQTPGQVQAGRQPRPRPQ 237

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE P+ +P P PQPQP PQP P
Sbjct: 238 PEPQPQPE-PQPEPQPEPQPQPEPQPEP 264

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 39/99 (39%), Positives = 51/99 (51%), Gaps = 5/99 (5%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   E     EPE +P     P P    EPE   EPE P+ +P P PE
Sbjct: 369 EPEPEPEPEPEPEPESESELDLEPEPEPHPHPHPHPHPHPEPEPEPEPE-PEPEPEPEPE 427

Query: 213 PKPEPPKEPE---KPKEKPPPPPQPQPMPQPPPHIPASC 320
           P+PEP  EPE   +P+ +  P P  + +P   P +   C
Sbjct: 428 PEPEPEPEPEMKSEPQSQLEPQPSGKKLPAKEPELTVDC 466

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 20/108 (18%)
 Frame = +3

Query: 39  EPPPPPKP-KEPEKPKE------PVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKP 197
           +P P P+P   PE P        P    + E P   +     +P+   +P+   +P+ +P
Sbjct: 41  QPQPVPQPLTPPESPAGDTVVFGPQPQPQAESPGHDDVVFSSQPQPMPQPQPMPEPQPQP 100

Query: 198 PPPPEPKPEPPKEP-------------EKPKEKPPPPPQPQPMPQPPP 302
            P PEP+P+P  +P               P+ +P P P+P+P P+P P
Sbjct: 101 EPEPEPQPQPQPQPLAGRQPLPQPLPWPMPQPQPEPEPEPEPEPEPEP 148

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 36/105 (34%), Positives = 52/105 (49%), Gaps = 16/105 (15%)
 Frame = +3

Query: 36  LEPPPPPKPK-----EPEKPKEPVKPKEPEKPK-------EQEKPKPKKPKEPEKPKEPE 179
           LE  PP + K     +P+   +P+ P  PE P         Q +P+ + P   +     +
Sbjct: 26  LENKPPAQDKVVFGPQPQPVPQPLTP--PESPAGDTVVFGPQPQPQAESPGHDDVVFSSQ 83

Query: 180 KPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQP----QPMPQPPP 302
            P+  P P P P+P+P  EPE P+ +P P PQP    QP+PQP P
Sbjct: 84  -PQPMPQPQPMPEPQPQPEPE-PEPQPQPQPQPLAGRQPLPQPLP 126

[85][TOP]
>UniRef100_Q6AHT0 Protease-1 (PRT1) protein, putative n=1 Tax=Pneumocystis carinii
            RepID=Q6AHT0_PNECA
          Length = 947

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 41/89 (46%), Positives = 56/89 (62%), Gaps = 2/89 (2%)
 Frame = +3

Query: 36   LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP-PPPE 212
            L PPPPP P  P     P  P  P  P  + +P+P+   EP+ P+ P+ P+ +PP PPP+
Sbjct: 781  LPPPPPPAPTPPPPAPTPAPPPPPPPPPSRPEPQPQPRPEPQ-PQPPKPPQPEPPAPPPK 839

Query: 213  PKPEPPKEPEKPKEKPP-PPPQPQPMPQP 296
            P+PEPP  P KP+ +PP PPP+PQP  +P
Sbjct: 840  PQPEPPAPPPKPQPEPPAPPPKPQPEQKP 868

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 40/100 (40%), Positives = 48/100 (48%), Gaps = 15/100 (15%)
 Frame = +3

Query: 48   PPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP--------------EKP 185
            PP KP  P+ P EP  P+ P  P+   KP P  P +P   ++P              E P
Sbjct: 722  PPSKPG-PQPPSEP-PPQPPLDPRPPSKPYPNPPSDPSSQQDPDTSLSSNLTSTSSSEPP 779

Query: 186  KEKPPPPPEPKPEPPKEPEKPKEKPPPPP-QPQPMPQPPP 302
               PPPPP P P PP     P   PPPPP +P+P PQP P
Sbjct: 780  PLPPPPPPAPTPPPPAPTPAPPPPPPPPPSRPEPQPQPRP 819

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/98 (40%), Positives = 45/98 (45%), Gaps = 7/98 (7%)
 Frame = +3

Query: 39   EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK------KPKEPEKPKEPEKPKEKP- 197
            EPPP P P +P  P +P  P  P  P  Q+ P              E P  P  P   P 
Sbjct: 733  EPPPQP-PLDPRPPSKPY-PNPPSDPSSQQDPDTSLSSNLTSTSSSEPPPLPPPPPPAPT 790

Query: 198  PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PPPP P P PP  P  P  +P P PQP+P PQP P  P
Sbjct: 791  PPPPAPTPAPPPPPPPPPSRPEPQPQPRPEPQPQPPKP 828

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 38/111 (34%), Positives = 50/111 (45%), Gaps = 19/111 (17%)
 Frame = +3

Query: 36   LEPPPPPKPKEPEKPKEPVKPKEPE-------------KPKEQEKPKPKKPKEPEKPKEP 176
            L+P PP KP  P  P +P   ++P+             +P     P P  P  P     P
Sbjct: 740  LDPRPPSKPY-PNPPSDPSSQQDPDTSLSSNLTSTSSSEPPPLPPPPPPAPTPPPPAPTP 798

Query: 177  EKPKEKPPPP------PEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
              P   PPPP      P+P+PEP  +P KP +  PP P P+P P+PP   P
Sbjct: 799  APPPPPPPPPSRPEPQPQPRPEPQPQPPKPPQPEPPAPPPKPQPEPPAPPP 849

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 43/117 (36%), Positives = 50/117 (42%), Gaps = 26/117 (22%)
 Frame = +3

Query: 39   EPPPPPKP--KEPEKPKEPVKPKEPE-----KPKEQEKPKPKKPKEPEKPKEP------- 176
            E PP  +P  + P KP  P  P EP       P+   KP P  P +P   ++P       
Sbjct: 711  ESPPSSEPGYQPPSKPG-PQPPSEPPPQPPLDPRPPSKPYPNPPSDPSSQQDPDTSLSSN 769

Query: 177  -------EKPKEKPPPPPEPKPEPPKEPEKPKEKPPPP-----PQPQPMPQPPPHIP 311
                   E P   PPPPP P P PP     P   PPPP     PQPQP P+P P  P
Sbjct: 770  LTSTSSSEPPPLPPPPPPAPTPPPPAPTPAPPPPPPPPPSRPEPQPQPRPEPQPQPP 826

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 34/99 (34%), Positives = 47/99 (47%), Gaps = 8/99 (8%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQE--KPKPKKPKEPEKPKEPEKPKE---KPPPP 206
           PPP P    P  P   ++P     P+ Q   KP P    EP+   +P  P     + PP 
Sbjct: 656 PPPDPDATPPPDPDANLQPDSNADPQPQPDVKPLPSSDLEPQPSSDPGSPPSSDSESPPS 715

Query: 207 PEPKPEPPKEP--EKPKEKPPPPP-QPQPMPQPPPHIPA 314
            EP  +PP +P  + P E PP PP  P+P  +P P+ P+
Sbjct: 716 SEPGYQPPSKPGPQPPSEPPPQPPLDPRPPSKPYPNPPS 754

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 39/118 (33%), Positives = 48/118 (40%), Gaps = 27/118 (22%)
 Frame = +3

Query: 39   EPPPPPKPKEPEKPKEPVKPKEPEKP--KEQEKPKPKKP--KEPEKPKEPEKPKEKPP-- 200
            +P P  KP  P    EP    +P  P   + E P   +P  + P KP  P+ P E PP  
Sbjct: 681  QPQPDVKPL-PSSDLEPQPSSDPGSPPSSDSESPPSSEPGYQPPSKPG-PQPPSEPPPQP 738

Query: 201  -----PPPEPKPEPPKEPEKPK----------------EKPPPPPQPQPMPQPPPHIP 311
                 PP +P P PP +P   +                E PP PP P P P PPP  P
Sbjct: 739  PLDPRPPSKPYPNPPSDPSSQQDPDTSLSSNLTSTSSSEPPPLPPPPPPAPTPPPPAP 796

[86][TOP]
>UniRef100_Q91236 Zona pellucida protein n=1 Tax=Pseudopleuronectes americanus
           RepID=Q91236_PSEAM
          Length = 509

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 39/97 (40%), Positives = 70/97 (72%), Gaps = 11/97 (11%)
 Frame = +3

Query: 39  EPPPPPK----PKEPEKPKEPVKPKEPEKPKEQEKPK-PKKPKEPEKPKEPEKPK----- 188
           EPP  P+    P++P++P++P +PK P++P++ ++P+ PK P++P++P++P++PK     
Sbjct: 78  EPPQTPQQPTYPQQPQQPQQPQQPKYPQQPQQPQQPQQPKYPQQPQQPQQPQQPKYPQQP 137

Query: 189 EKPPPPPEPK-PEPPKEPEKPKEKPPPPPQPQPMPQP 296
           ++P  P +PK P+ P++P+ P+ K P PPQPQ  PQP
Sbjct: 138 QQPQQPQQPKYPQQPQQPKNPQPKNPQPPQPQKNPQP 174

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 26/74 (35%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           +P  P +P++P+ P++P +P++P++PK  ++P +P++P++P+ P++P++PK   P  P+P
Sbjct: 106 QPQQPQQPQQPKYPQQPQQPQQPQQPKYPQQPQQPQQPQQPKYPQQPQQPKNPQPKNPQP 165

Query: 216 KPEPPKEPEKPKEK 257
            P+P K P+  K++
Sbjct: 166 -PQPQKNPQPTKQQ 178

[87][TOP]
>UniRef100_A1XYV9 Latency-associated nuclear antigen n=1 Tax=Retroperitoneal
            fibromatosis-associated herpesvirus RepID=A1XYV9_HHV8
          Length = 1071

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 44/95 (46%), Positives = 66/95 (69%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39   EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEP-----EKPKEKPP 200
            EP P P+P+E  +P EP   +EPE +P+E+ +P+P++  EPE  KEP     E+P+E+P 
Sbjct: 741  EPEPEPEPEEEPEP-EPQPEEEPEPEPEEEPEPEPEEEPEPEPEKEPEPEPEEEPEEEPE 799

Query: 201  PPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
              PEP+PEP +EPE +P+E+P P P+P+P P+  P
Sbjct: 800  EEPEPEPEPEEEPEPEPEEEPEPEPEPEPEPEEEP 834

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 43/90 (47%), Positives = 63/90 (70%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39   EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP-EKPKEKPPPPPEP 215
            EP P P+P+E  +P EP +  EPE P+E+ +P+P+K  EPE  +EP E+P+E+P P PEP
Sbjct: 751  EPEPEPQPEEEPEP-EPEEEPEPE-PEEEPEPEPEKEPEPEPEEEPEEEPEEEPEPEPEP 808

Query: 216  KPEPPKEP-EKPKEKPPPPPQPQPMPQPPP 302
            + EP  EP E+P+ +P P P+P+  P+P P
Sbjct: 809  EEEPEPEPEEEPEPEPEPEPEPEEEPEPEP 838

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 45/96 (46%), Positives = 67/96 (69%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P  +P+ EPE+  EP   +EPE +P+E+ +P+P++  EPE  +EPE +P+E+P P P
Sbjct: 611 EPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 670

Query: 210 E--PKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           E  P+PEP +EPE   +P+E+P P PQP+  P+P P
Sbjct: 671 EEEPEPEPEEEPEPEPEPEEEPEPEPQPEEEPEPEP 706

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 44/95 (46%), Positives = 64/95 (67%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           E P P   +EPE   EP +  EPE +P+E+ +P+P++  EPE  +EPE +P+E+P P PE
Sbjct: 672 EEPEPEPEEEPEPEPEPEEEPEPEPQPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPE 731

Query: 213 --PKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
             P+PEP +EPE   +P+E+P P PQP+  P+P P
Sbjct: 732 EEPEPEPEEEPEPEPEPEEEPEPEPQPEEEPEPEP 766

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/94 (46%), Positives = 67/94 (71%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P  +P+ EPE+  EP   +EPE +P+E+ +P+P++  EPE  +EPE +P+E+P P P
Sbjct: 603 EPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 662

Query: 210 E--PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           E  P+PEP +EPE +P+E+P P P+P+  P+P P
Sbjct: 663 EEEPEPEPEEEPEPEPEEEPEPEPEPEEEPEPEP 696

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 44/92 (47%), Positives = 66/92 (71%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P  KP+ EPE+  EP   +EPE +P+E+ +P+P++  EPE  +EPE +P+E+P P P
Sbjct: 571 EPEPEEKPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 630

Query: 210 E--PKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           E  P+PEP +EPE +P+E+P P P+ +P P+P
Sbjct: 631 EEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 662

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 41/87 (47%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+E  +P EP +  EPE P+E+ +P+P++  EPE  +EPE +P+E+P P PEP
Sbjct: 691 EPEPEPQPEEEPEP-EPEEEPEPE-PEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEP 748

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           + EP  EP+ P+E+P P P+ +P P+P
Sbjct: 749 EEEPEPEPQ-PEEEPEPEPEEEPEPEP 774

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/92 (46%), Positives = 66/92 (71%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P  +P+ EPE+  EP   +EPE +P+E+ +P+P++  EPE  +EPE +P+E+P P P
Sbjct: 563 EPEPEEEPEPEPEEKPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 622

Query: 210 E--PKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           E  P+PEP +EPE +P+E+P P P+ +P P+P
Sbjct: 623 EEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 654

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/92 (46%), Positives = 66/92 (71%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P  +P+ EPE+  EP   +EPE +P+E+ +P+P++  EPE  +EPE +P+E+P P P
Sbjct: 579 EPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 638

Query: 210 E--PKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           E  P+PEP +EPE +P+E+P P P+ +P P+P
Sbjct: 639 EEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 670

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/92 (46%), Positives = 66/92 (71%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P  +P+ EPE+  EP   +EPE +P+E+ +P+P++  EPE  +EPE +P+E+P P P
Sbjct: 587 EPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 646

Query: 210 E--PKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           E  P+PEP +EPE +P+E+P P P+ +P P+P
Sbjct: 647 EEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 678

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 41/89 (46%), Positives = 63/89 (70%), Gaps = 3/89 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P  +P+ EPE+  EP   +EPE +P+E+ +P+P++  EPE  +EPE +P+E+P P P
Sbjct: 627 EPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 686

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           EP+ EP  EP+ P+E+P P P+ +P P+P
Sbjct: 687 EPEEEPEPEPQ-PEEEPEPEPEEEPEPEP 714

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 42/92 (45%), Positives = 66/92 (71%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P  +P+ EPE+  EP   ++PE +P+E+ +P+P++  EPE  +EPE +P+E+P P P
Sbjct: 555 EPEPEEEPEPEPEEEPEPEPEEKPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 614

Query: 210 E--PKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           E  P+PEP +EPE +P+E+P P P+ +P P+P
Sbjct: 615 EEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 646

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/89 (46%), Positives = 62/89 (69%), Gaps = 3/89 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK-PKEKPPPPPE 212
           EP P  +P+ EPE+  EP   +EPE P+ +E+P+P+  +EPE   EPE+ P+ +P P  E
Sbjct: 643 EPEPEEEPEPEPEEEPEPEPEEEPE-PEPEEEPEPEPEEEPEPEPEPEEEPEPEPQPEEE 701

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           P+PEP +EPE +P+E+P P P+ +P P+P
Sbjct: 702 PEPEPEEEPEPEPEEEPEPEPEEEPEPEP 730

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/93 (47%), Positives = 63/93 (67%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           EP P P+ + EPE  +EP    EPE+  E E P+P++  EPE  +EPE +P+E+P P PE
Sbjct: 665 EPEPEPEEEPEPEPEEEPEPEPEPEEEPEPE-PQPEEEPEPEPEEEPEPEPEEEPEPEPE 723

Query: 213 --PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
             P+PEP +EPE +P+E+P P P+P+  P+P P
Sbjct: 724 EEPEPEPEEEPEPEPEEEPEPEPEPEEEPEPEP 756

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/93 (47%), Positives = 63/93 (67%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
            EP P P+ + EPE  +EP    EPE+  E E P+P++  EPE  +EPE +P+E+P P PE
Sbjct: 725  EPEPEPEEEPEPEPEEEPEPEPEPEEEPEPE-PQPEEEPEPEPEEEPEPEPEEEPEPEPE 783

Query: 213  --PKPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
              P+PEP +EPE+ P+E+P P P+P+  P+P P
Sbjct: 784  KEPEPEPEEEPEEEPEEEPEPEPEPEEEPEPEP 816

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 41/94 (43%), Positives = 63/94 (67%), Gaps = 8/94 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEK----PKPKKPKEPEKPKEPE-KPKEKPPP 203
           EP P P+ +  E+PK   +P+  E+P  +E+    P+P++  EPE  +EPE +P+EKP P
Sbjct: 521 EPKPEPEQEPEEEPKSEPEPEPEEEPDSEEETEPEPEPEEEPEPEPEEEPEPEPEEKPEP 580

Query: 204 PPE--PKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
            PE  P+PEP +EPE +P+E+P P P+ +P P+P
Sbjct: 581 EPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 614

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 40/89 (44%), Positives = 63/89 (70%), Gaps = 3/89 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P  +P+ EPE+  EP   +EPE +P+E+ +P+P++  EPE  +EPE P+ +P   PE
Sbjct: 635 EPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPE-PEPEPEEEPE 693

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           P+P+P +EPE +P+E+P P P+ +P P+P
Sbjct: 694 PEPQPEEEPEPEPEEEPEPEPEEEPEPEP 722

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 42/90 (46%), Positives = 64/90 (71%), Gaps = 4/90 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE- 212
           E  P P+P+E  +P EP +  EPE P+E+ +P+P++  EPE  +EPE +P+E+P P PE 
Sbjct: 551 ETEPEPEPEEEPEP-EPEEEPEPE-PEEKPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEE 608

Query: 213 -PKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
            P+PEP +EPE +P+E+P P P+ +P P+P
Sbjct: 609 EPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 638

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 43/95 (45%), Positives = 64/95 (67%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P  +P+ EPE+  EP   +EPE +P+E+ +P+P++  EPE  +EPE +P+E+P P P
Sbjct: 595 EPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 654

Query: 210 E----PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           E    P+PE   EPE P+E+P P P+ +P P+P P
Sbjct: 655 EEEPEPEPEEEPEPE-PEEEPEPEPEEEPEPEPEP 688

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 45/100 (45%), Positives = 62/100 (62%), Gaps = 9/100 (9%)
 Frame = +3

Query: 30  EILEPPPPPKP-KEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPP 203
           E  EP P P+P +EPE   EP   +EPE KP+ +++P+P++  EPE   EPE+  E P P
Sbjct: 346 EETEPEPEPEPEEEPEPEPEPEPEEEPEPKPEPEQEPEPEEEPEPEPEPEPEEEPE-PEP 404

Query: 204 PPEPKPEPPKEP-EKPKEKPPPPPQPQP------MPQPPP 302
             EPKPEP +EP E+PK +P P P+ +P       P+P P
Sbjct: 405 EEEPKPEPEQEPEEEPKSEPEPEPEEEPDSEEETEPEPEP 444

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 42/92 (45%), Positives = 63/92 (68%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKP-KEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P  +P  E E   EP   +EPE +P+E+ +P+P++  EPE  +EPE +P+E+P P P
Sbjct: 539 EPEPEEEPDSEEETEPEPEPEEEPEPEPEEEPEPEPEEKPEPEPEEEPEPEPEEEPEPEP 598

Query: 210 E--PKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           E  P+PEP +EPE +P+E+P P P+ +P P+P
Sbjct: 599 EEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEP 630

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 43/102 (42%), Positives = 65/102 (63%), Gaps = 14/102 (13%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEK-----PKEKP 197
            EP P  +P+ EPE+  EP   +EPE +P+E+ +P+P+  +EPE   +PE+     P+E+P
Sbjct: 711  EPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEPEEEPEPEPQPEEEPEPEPEEEP 770

Query: 198  PPPPE--PKPEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
             P PE  P+PEP KEPE     +P+E+P   P+P+P P+  P
Sbjct: 771  EPEPEEEPEPEPEKEPEPEPEEEPEEEPEEEPEPEPEPEEEP 812

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 41/95 (43%), Positives = 58/95 (61%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39   EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP--- 206
            E P P   +EPE   EP +  EPE +P+E+ +P+P++  EPE  +EPE   EK P P   
Sbjct: 732  EEPEPEPEEEPEPEPEPEEEPEPEPQPEEEPEPEPEEEPEPEPEEEPEPEPEKEPEPEPE 791

Query: 207  --PEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
              PE +PE   EPE +P+E+P P P+ +P P+P P
Sbjct: 792  EEPEEEPEEEPEPEPEPEEEPEPEPEEEPEPEPEP 826

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 39/93 (41%), Positives = 60/93 (64%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEK----PKPKKPKEPEKPKEPE-KPKEKPPP 203
           EP P P+ +  E+PK   +P+  E+P  +E+    P+P++  EPE  +EPE +P+EKP  
Sbjct: 407 EPKPEPEQEPEEEPKSEPEPEPEEEPDSEEETEPEPEPEEEPEPEPEEEPEPEPEEKPEQ 466

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PE +PEP  E E+P+E+P P P+P+P P+  P
Sbjct: 467 GPEEEPEPEPE-EEPEEEPEPEPEPEPGPEEEP 498

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 40/92 (43%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE---KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP 206
           EP P  +P+ EPE+  EP   +EPE   +P+E+ +P+P+  +EPE P+  E+P+ +P   
Sbjct: 659 EPEPEEEPEPEPEEEPEPEPEEEPEPEPEPEEEPEPEPQPEEEPE-PEPEEEPEPEPEEE 717

Query: 207 PEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP+PE   EPE P+E+P P P+ +P P+P P
Sbjct: 718 PEPEPEEEPEPE-PEEEPEPEPEEEPEPEPEP 748

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 34/90 (37%), Positives = 61/90 (67%), Gaps = 4/90 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK-PKEKPPPPPEP 215
           EP P P+P++  +P+E  +P+   +P+E+ +P+P++  +PE  +EPE+ PK +P P PE 
Sbjct: 371 EPEPKPEPEQEPEPEEEPEPEPEPEPEEEPEPEPEEEPKPEPEQEPEEEPKSEPEPEPEE 430

Query: 216 KPEPPKEPE---KPKEKPPPPPQPQPMPQP 296
           +P+  +E E   +P+E+P P P+ +P P+P
Sbjct: 431 EPDSEEETEPEPEPEEEPEPEPEEEPEPEP 460

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 39/94 (41%), Positives = 62/94 (65%), Gaps = 3/94 (3%)
 Frame = +3

Query: 24  SIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKE--QEKPKPKKPKEPEKPKEPEKPKEKP 197
           S E  EP P P+ +   +P+E  +P+  EKP++  +E+P+P+  +EPE+  EPE P+ +P
Sbjct: 434 SEEETEPEPEPEEEPEPEPEEEPEPEPEEKPEQGPEEEPEPEPEEEPEEEPEPE-PEPEP 492

Query: 198 PPPPEPKPEPPKEPEK-PKEKPPPPPQPQPMPQP 296
            P  EP+P P +EPE  P+E+P P P+ +P P+P
Sbjct: 493 GPEEEPEPGPEEEPEPGPEEEPGPEPEEEPKPEP 526

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 41/92 (44%), Positives = 61/92 (66%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP--KPKKPKEPEKPKEPEKPKE---KPPP 203
           EP P P+P EPE+  EP +P+E  KP+ +++P  +PK   EPE  +EP+  +E   +P P
Sbjct: 387 EPEPEPEP-EPEEEPEP-EPEEEPKPEPEQEPEEEPKSEPEPEPEEEPDSEEETEPEPEP 444

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
             EP+PEP +EPE +P+EKP   P+ +P P+P
Sbjct: 445 EEEPEPEPEEEPEPEPEEKPEQGPEEEPEPEP 476

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 40/98 (40%), Positives = 65/98 (66%), Gaps = 10/98 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPK-----EPEK-PKEQEKPKPKKPKEPEKPKEPE-KPKEKP 197
           EP P P+P+E  +P+   +PK     EPE+ PK + +P+P++  + E+  EPE +P+E+P
Sbjct: 389 EPEPEPEPEEEPEPEPEEEPKPEPEQEPEEEPKSEPEPEPEEEPDSEEETEPEPEPEEEP 448

Query: 198 PPPP--EPKPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
            P P  EP+PEP ++PE+ P+E+P P P+ +P  +P P
Sbjct: 449 EPEPEEEPEPEPEEKPEQGPEEEPEPEPEEEPEEEPEP 486

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 42/100 (42%), Positives = 63/100 (63%), Gaps = 14/100 (14%)
 Frame = +3

Query: 39  EPPPPPKPKE-PEKPKEPVKPKEPEK-PKEQEKPKPKKPKEPEKPKEPEK-PKEKPPPPP 209
           EP P P+P+  PE+  EP   +EPE  P+E+  P+P++  +PE  +EPE+ PK +P P P
Sbjct: 483 EPEPEPEPEPGPEEEPEPGPEEEPEPGPEEEPGPEPEEEPKPEPEQEPEEEPKSEPEPEP 542

Query: 210 E----------PKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           E          P+PEP +EPE +P+E+P P P+ +P P+P
Sbjct: 543 EEEPDSEEETEPEPEPEEEPEPEPEEEPEPEPEEKPEPEP 582

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 35/87 (40%), Positives = 58/87 (66%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+ +   +P+E  KP+  ++P+E+ K +P+ P+  E+P   E+ + +P P  EP+
Sbjct: 505 EPEPGPEEEPGPEPEEEPKPEPEQEPEEEPKSEPE-PEPEEEPDSEEETEPEPEPEEEPE 563

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           PEP +EPE +P+EKP P P+ +P P+P
Sbjct: 564 PEPEEEPEPEPEEKPEPEPEEEPEPEP 590

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 43/102 (42%), Positives = 66/102 (64%), Gaps = 14/102 (13%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEK-----PKEKP 197
           EP P  +P+ EPE+  EP   +EPE +P+E+ +P+P+  +EPE   +PE+     P+E+P
Sbjct: 651 EPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEPEEEPEPEPQPEEEPEPEPEEEP 710

Query: 198 PPPPE--PKPEPPKEPE-KPKEKPPPPPQ----PQPMPQPPP 302
            P PE  P+PEP +EPE +P+E+P P P+    P+P P+  P
Sbjct: 711 EPEPEEEPEPEPEEEPEPEPEEEPEPEPEEEPEPEPEPEEEP 752

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 35/94 (37%), Positives = 60/94 (63%), Gaps = 8/94 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEK-------PKEPEKPKEKP 197
           EP P  +P   E+ +   +P+E  +P+ +E+P+P+  ++PE+       P+  E+P+E+P
Sbjct: 425 EPEPEEEPDSEEETEPEPEPEEEPEPEPEEEPEPEPEEKPEQGPEEEPEPEPEEEPEEEP 484

Query: 198 PPPPEPKPEPPKEPEK-PKEKPPPPPQPQPMPQP 296
            P PEP+P P +EPE  P+E+P P P+ +P P+P
Sbjct: 485 EPEPEPEPGPEEEPEPGPEEEPEPGPEEEPGPEP 518

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 41/94 (43%), Positives = 60/94 (63%), Gaps = 3/94 (3%)
 Frame = +3

Query: 39   EPPPPPKPKEPEKPKEPVKPKEPEKPKEQE-KPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
            E  P P+P+E  +P EP +  EPE  KE E +P+ +  +EPE+  EPE +P+E+P P PE
Sbjct: 759  EEEPEPEPEEEPEP-EPEEEPEPEPEKEPEPEPEEEPEEEPEEEPEPEPEPEEEPEPEPE 817

Query: 213  PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHIP 311
             +PEP  EPE +P+E+P P P+ +   +P P  P
Sbjct: 818  EEPEPEPEPEPEPEEEPEPEPEDEHEEEPEPQEP 851

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 37/90 (41%), Positives = 62/90 (68%), Gaps = 4/90 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE- 212
           E  P P+P+E  KP+   +P+E  +PK + +P+P++  + E+  EPE +P+E+P P PE 
Sbjct: 511 EEEPGPEPEEEPKPEPEQEPEE--EPKSEPEPEPEEEPDSEEETEPEPEPEEEPEPEPEE 568

Query: 213 -PKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
            P+PEP ++PE +P+E+P P P+ +P P+P
Sbjct: 569 EPEPEPEEKPEPEPEEEPEPEPEEEPEPEP 598

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/83 (44%), Positives = 55/83 (66%), Gaps = 2/83 (2%)
 Frame = +3

Query: 39   EPPPPPKPK-EPEKPKEPVKPKEPEK-PKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
            EP P  +P+ EPEK  EP   +EPE+ P+E+ +P+P+  +EPE P+  E+P+ +P P PE
Sbjct: 771  EPEPEEEPEPEPEKEPEPEPEEEPEEEPEEEPEPEPEPEEEPE-PEPEEEPEPEPEPEPE 829

Query: 213  PKPEPPKEPEKPKEKPPPPPQPQ 281
            P+ EP  EPE   E+ P P +P+
Sbjct: 830  PEEEPEPEPEDEHEEEPEPQEPE 852

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 40/104 (38%), Positives = 60/104 (57%), Gaps = 16/104 (15%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP-------EKPKEKP 197
           EP P P+ K  + P+E  +P+  E+P+E+ +P+P+    PE+  EP         P+E+P
Sbjct: 455 EPEPEPEEKPEQGPEEEPEPEPEEEPEEEPEPEPEPEPGPEEEPEPGPEEEPEPGPEEEP 514

Query: 198 PPPP--EPKPEPPKEP-EKPKEKPPPPPQPQP------MPQPPP 302
            P P  EPKPEP +EP E+PK +P P P+ +P       P+P P
Sbjct: 515 GPEPEEEPKPEPEQEPEEEPKSEPEPEPEEEPDSEEETEPEPEP 558

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 39/88 (44%), Positives = 56/88 (63%), Gaps = 2/88 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK-PKEKPPPPPEP 215
           EP    +P EPE+  EP    EPE+  E E P+P+  +EPE   EPE+ P+ +  P PEP
Sbjct: 335 EPESEGEP-EPEEETEPEPEPEPEEEPEPE-PEPEPEEEPEPKPEPEQEPEPEEEPEPEP 392

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           +PEP +EPE +P+E+P P P+ +P  +P
Sbjct: 393 EPEPEEEPEPEPEEEPKPEPEQEPEEEP 420

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 37/99 (37%), Positives = 58/99 (58%), Gaps = 12/99 (12%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPPE 212
           P   P+P+  E+P+E  +P+   +P  +E+P+P   +EPE   E E   +P+E+P P PE
Sbjct: 468 PEEEPEPEPEEEPEEEPEPEPEPEPGPEEEPEPGPEEEPEPGPEEEPGPEPEEEPKPEPE 527

Query: 213 PKPE--PPKEPE-KPKEKP------PPPPQPQPMPQPPP 302
            +PE  P  EPE +P+E+P       P P+P+  P+P P
Sbjct: 528 QEPEEEPKSEPEPEPEEEPDSEEETEPEPEPEEEPEPEP 566

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 38/101 (37%), Positives = 57/101 (56%), Gaps = 15/101 (14%)
 Frame = +3

Query: 39   EPPPPPKP-KEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
            EP P  +P +EPE+  EP    EPE P+E+ +P+P++  EPE   EPE P+E+P P PE 
Sbjct: 787  EPEPEEEPEEEPEEEPEP----EPE-PEEEPEPEPEEEPEPEPEPEPE-PEEEPEPEPED 840

Query: 216  KPEPPKEPEKPKE--------------KPPPPPQPQPMPQP 296
            + E   EP++P++                P PP+P+  P+P
Sbjct: 841  EHEEEPEPQEPEDSDNADANTQEPSEVNEPVPPEPESNPEP 881

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 6/82 (7%)
 Frame = +3

Query: 75  KPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE------PKPEPPKE 236
           K +E    +  ++P+ + +P+P++  EPE   EPE+  E P P PE      PKPEP +E
Sbjct: 323 KLEEGSDVESDDEPESEGEPEPEEETEPEPEPEPEEEPE-PEPEPEPEEEPEPKPEPEQE 381

Query: 237 PEKPKEKPPPPPQPQPMPQPPP 302
           PE P+E+P P P+P+P  +P P
Sbjct: 382 PE-PEEEPEPEPEPEPEEEPEP 402

[88][TOP]
>UniRef100_B6ITI0 Protein TonB, putative n=1 Tax=Rhodospirillum centenum SW
           RepID=B6ITI0_RHOCS
          Length = 330

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 50/99 (50%), Positives = 64/99 (64%), Gaps = 10/99 (10%)
 Frame = +3

Query: 30  EILEPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEK--PKEPEKPKEKPP 200
           + L PPP P+P  +PE PK PVKP EP  PK + KP+P+   EP+K  PK+PE PK +P 
Sbjct: 90  QALPPPPEPEPTPKPEPPKPPVKP-EPAPPKPEPKPEPEPKPEPKKEEPKKPEPPKPEPK 148

Query: 201 ---PPPEPKPEPPK-EPEKPKEKPPPPPQP---QPMPQP 296
              P PEPK E PK +PE  KE+P P P+P   +P P+P
Sbjct: 149 KEQPKPEPKKEEPKPKPEPKKEEPKPKPEPKKEEPKPKP 187

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 46/96 (47%), Positives = 57/96 (59%), Gaps = 7/96 (7%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKE---PVKPKE---PEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP 206
           PP P+P +PE PK+   P  PK    P  P+ +  PKP+ PK P KP EP  PK +P P 
Sbjct: 67  PPKPEPPKPEPPKQEPPPPPPKAQALPPPPEPEPTPKPEPPKPPVKP-EPAPPKPEPKPE 125

Query: 207 PEPKPEPPK-EPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PEPKPEP K EP+KP+   P P + QP P+P    P
Sbjct: 126 PEPKPEPKKEEPKKPEPPKPEPKKEQPKPEPKKEEP 161

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 49/98 (50%), Positives = 57/98 (58%), Gaps = 11/98 (11%)
 Frame = +3

Query: 42  PPPPPK------PKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP--EKPKEKP 197
           PPPPPK      P EPE   +P  PK P KP E   PKP+   EPE   EP  E+PK+  
Sbjct: 83  PPPPPKAQALPPPPEPEPTPKPEPPKPPVKP-EPAPPKPEPKPEPEPKPEPKKEEPKKPE 141

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPPQP---QPMPQPPP 302
           PP PEPK E PK PE  KE+P P P+P   +P P+P P
Sbjct: 142 PPKPEPKKEQPK-PEPKKEEPKPKPEPKKEEPKPKPEP 178

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 47/94 (50%), Positives = 57/94 (60%), Gaps = 8/94 (8%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK---EPEKPKEPEKPKEKPPPPPEP 215
           P PPKP EP KP+ P +   P  PK Q  P P +P+   +PE PK P KP E  PP PEP
Sbjct: 65  PQPPKP-EPPKPEPPKQEPPPPPPKAQALPPPPEPEPTPKPEPPKPPVKP-EPAPPKPEP 122

Query: 216 KPEPPKEPEKPKEKP--PPPPQPQP---MPQPPP 302
           KPEP  +PE  KE+P  P PP+P+P    P+P P
Sbjct: 123 KPEPEPKPEPKKEEPKKPEPPKPEPKKEQPKPEP 156

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 43/96 (44%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+PK   K +EP KP+ P+   ++E+PKP+  KE  KPK PE  KE+P P PEPK
Sbjct: 121 EPKPEPEPKPEPKKEEPKKPEPPKPEPKKEQPKPEPKKEEPKPK-PEPKKEEPKPKPEPK 179

Query: 219 PEPPK-EPEK---------PKEKPPPPPQPQPMPQP 296
            E PK +PE+          KE+P PP + +P  +P
Sbjct: 180 KEEPKPKPERTLSDLLNSLEKEQPAPPAKEKPQERP 215

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 41/83 (49%), Positives = 52/83 (62%), Gaps = 4/83 (4%)
 Frame = +3

Query: 66  EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP---PEPKPEPPKE 236
           + + PK   +PK P+ PK  E PKP+ PK+ E P  P K +  PPPP   P PKPEPPK 
Sbjct: 53  QQDAPKPRAQPK-PQPPKP-EPPKPEPPKQ-EPPPPPPKAQALPPPPEPEPTPKPEPPKP 109

Query: 237 PEKPKEKPP-PPPQPQPMPQPPP 302
           P KP+  PP P P+P+P P+P P
Sbjct: 110 PVKPEPAPPKPEPKPEPEPKPEP 132

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPE-KPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           +PP  P+P  P+ +PK   +PK   K +E +KP+P KP+  ++  +PE  KE+P P PEP
Sbjct: 108 KPPVKPEPAPPKPEPKPEPEPKPEPKKEEPKKPEPPKPEPKKEQPKPEPKKEEPKPKPEP 167

Query: 216 KPEPPK-EPEKPKEKPPPPPQ 275
           K E PK +PE  KE+P P P+
Sbjct: 168 KKEEPKPKPEPKKEEPKPKPE 188

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 32/70 (45%), Positives = 43/70 (61%)
 Frame = +3

Query: 102 EPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQ 281
           + + PK + +PKP+ PK PE PK PE PK++PPPP      PPK      +  PPPP+P+
Sbjct: 53  QQDAPKPRAQPKPQPPK-PEPPK-PEPPKQEPPPP------PPKA-----QALPPPPEPE 99

Query: 282 PMPQPPPHIP 311
           P P+P P  P
Sbjct: 100 PTPKPEPPKP 109

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 39/88 (44%), Positives = 48/88 (54%), Gaps = 13/88 (14%)
 Frame = +3

Query: 45  PPPPKPK----EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK---------P 185
           PP P+PK    +PE  KE  KPK PE  KE+ KPKP+  KE  KPK PE+          
Sbjct: 142 PPKPEPKKEQPKPEPKKEEPKPK-PEPKKEEPKPKPEPKKEEPKPK-PERTLSDLLNSLE 199

Query: 186 KEKPPPPPEPKPEPPKEPEKPKEKPPPP 269
           KE+P PP + KP+     E+P E   PP
Sbjct: 200 KEQPAPPAKEKPQ-----ERPVESGSPP 222

[89][TOP]
>UniRef100_A2SAI3 Endo/excinuclease domain protein n=1 Tax=Burkholderia mallei NCTC
           10229 RepID=A2SAI3_BURM9
          Length = 334

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 40/96 (41%), Positives = 55/96 (57%), Gaps = 3/96 (3%)
 Frame = +3

Query: 21  KSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKP 197
           K++ + + P P KP +P KP +P KP +P KP +  KP KP KP +P KP +P KP +  
Sbjct: 181 KTVRLSKAPKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPS 240

Query: 198 PPPPEPKPEPPKEPEKPKE--KPPPPPQPQPMPQPP 299
            P    KP  P +P KP +  KP  P +P   P+PP
Sbjct: 241 KPSKPSKPSKPSKPSKPSKPSKPSKPSKPSTPPKPP 276

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 37/86 (43%), Positives = 48/86 (55%), Gaps = 1/86 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP-KPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           +P  P KP +P KP +P KP +P KP +  KP KP KP +P KP +P KP +   P    
Sbjct: 196 KPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPS 255

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQ 293
           KP  P +P KP +   PP  P+P  Q
Sbjct: 256 KPSKPSKPSKPSKPSTPPKPPKPSTQ 281

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 26/76 (34%), Positives = 37/76 (48%)
 Frame = +3

Query: 69  PEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKP 248
           P++ K     K  +  +  + PKP KP +P KP +P KP +   P    KP  P +P KP
Sbjct: 168 PKERKATEAAKTSKTVRLSKAPKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKPSKP 227

Query: 249 KEKPPPPPQPQPMPQP 296
             KP  P +P    +P
Sbjct: 228 -SKPSKPSKPSKPSKP 242

[90][TOP]
>UniRef100_UPI0000DA1F2F PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA1F2F
          Length = 301

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 45/91 (49%), Positives = 60/91 (65%), Gaps = 2/91 (2%)
 Frame = +3

Query: 36  LEPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           LEP P PKP+ EPE   EP    EPE P+ + +P+P+   EPE   EPE P+ +P P PE
Sbjct: 41  LEPEPEPKPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPE 98

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 99  PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 129

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 60  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 119

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 120 EPEPEPEPEPESEPESEPEPEPEPEPEPEPEP 151

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/94 (45%), Positives = 61/94 (64%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 64  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 123

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE   +P+ +P P P+P+P P+P P
Sbjct: 124 EPEPEPESEPESEPEPEPEPEPEPEPEPEPEPEP 157

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 140 EPEPEPEPEPEPEPEPEPEPEPEPELEPELEPEPEPELEPEPEPELEPEPEPETEPEPEP 199

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 200 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 231

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 43/92 (46%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+ EPE   EP    EPE P+ + +P+P+   EPE   EPE P+ +P P PEP
Sbjct: 150 EPEPEPEPEPEPEPELEPELEPEPE-PELEPEPEPELEPEPEPETEPE-PEPEPEPEPEP 207

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
           +PEP  EPE +P+ +P P P+P+P P+P P +
Sbjct: 208 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEL 239

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 42/93 (45%), Positives = 60/93 (64%), Gaps = 3/93 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE P+ + +P+P+   EPE   EPE +P+ +P P PE
Sbjct: 156 EPEPEPEPELEPELEPEPEPELEPE-PEPELEPEPEPETEPEPEPEPEPEPEPEPEPEPE 214

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
           P+PEP  EPE +P+ +P P P+P+  P+P P +
Sbjct: 215 PEPEPEPEPEPEPEPEPEPEPEPELEPEPEPEL 247

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 41/93 (44%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P   P
Sbjct: 78  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPESEPESEP 137

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           EP+PEP  EPE P+ +P P P+P+P P+  P +
Sbjct: 138 EPEPEPEPEPE-PEPEPEPEPEPEPEPELEPEL 169

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 41/93 (44%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 86  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPESEPESEPEPEPEPEP 145

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           EP+PEP  EPE P+ +P P  +P+  P+P P +
Sbjct: 146 EPEPEPEPEPE-PEPEPEPELEPELEPEPEPEL 177

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 41/92 (44%), Positives = 59/92 (64%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE   +P+ +P P
Sbjct: 92  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPESEPESEPEPEPEPEPEPEPEP 151

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
            PEP+PEP  EPE +P+ +P P P+ +P P+P
Sbjct: 152 EPEPEPEPEPEPELEPELEPEPEPELEPEPEP 183

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 41/91 (45%), Positives = 58/91 (63%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 82  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPESEPESEPEPEP 141

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE P+ +P P P+P+  P+  P
Sbjct: 142 EPEPEPEPEPE-PEPEPEPEPEPELEPELEP 171

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 42/102 (41%), Positives = 60/102 (58%), Gaps = 14/102 (13%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-----KPKEQEKPKPKKPKEPEKPKEPE------- 179
           EP P P+P+ EPE   EP    EPE     +P+ + +P+P+   EPE   EPE       
Sbjct: 122 EPEPEPEPESEPESEPEPEPEPEPEPEPEPEPEPEPEPEPEPELEPELEPEPEPELEPEP 181

Query: 180 KPKEKPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+ +P P PE +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 182 EPELEPEPEPETEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 223

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 42/92 (45%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           LEP   P+P EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 165 LEPELEPEP-EPELEPEPEPELEPEPEPETEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 223

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+ +P P+P P
Sbjct: 224 EPEPEPEPEPEPEPELEPEPEPELEPEPEPEP 255

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 42/93 (45%), Positives = 59/93 (63%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 116 EPEPEPEPEPEPEPESEPESEPEPEPEPEPEPEPEPEPEPEPEPEPEPELEPELEPEPEP 175

Query: 210 E--PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           E  P+PEP  EPE P+ +  P P+P+P P+P P
Sbjct: 176 ELEPEPEPELEPE-PEPETEPEPEPEPEPEPEP 207

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 43/105 (40%), Positives = 60/105 (57%), Gaps = 17/105 (16%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE P+ +P P PE
Sbjct: 106 EPEPEPEPEPEPEPEPEPEPEPEPESEPESEPEPEPEPEPEPEPEPEPE-PEPEPEPEPE 164

Query: 213 ------PKPEPPKEPE---------KPKEKPPPPPQPQPMPQPPP 302
                 P+PEP  EPE         +P+ +P P P+P+P P+P P
Sbjct: 165 LEPELEPEPEPELEPEPEPELEPEPEPETEPEPEPEPEPEPEPEP 209

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 41/95 (43%), Positives = 59/95 (62%), Gaps = 6/95 (6%)
 Frame = +3

Query: 36  LEPPPPPKPK---EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPP 200
           LEP P P+ +   EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P 
Sbjct: 169 LEPEPEPELEPEPEPELEPEPEPETEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE 228

Query: 201 PPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P PEP+PEP  EPE +P+ +P P P+P+   +P P
Sbjct: 229 PEPEPEPEPELEPEPEPELEPEPEPEPESELEPEP 263

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/97 (43%), Positives = 58/97 (59%), Gaps = 3/97 (3%)
 Frame = +3

Query: 36  LEPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPP 206
           LEP P P+ + EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P 
Sbjct: 185 LEPEPEPETEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPELEPEPE 244

Query: 207 PEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
           PE +PEP  EPE   E P P P+ +P P+  P+ P S
Sbjct: 245 PELEPEPEPEPESELE-PEPEPELEPEPELGPYQPES 280

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 41/98 (41%), Positives = 56/98 (57%), Gaps = 7/98 (7%)
 Frame = +3

Query: 36  LEPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           LEP P P+ + EPE   EP    EPE P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 177 LEPEPEPELEPEPEPETEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 235

Query: 210 EPKPEPPKEPEKPKEKPPPP-----PQPQPMPQPPPHI 308
           EP+ EP  EPE   E  P P     P+P+P  +P P +
Sbjct: 236 EPELEPEPEPELEPEPEPEPESELEPEPEPELEPEPEL 273

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 35/73 (47%), Positives = 48/73 (65%)
 Frame = +3

Query: 84  EPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPP 263
           +P    EPE PK + +P+P+   EPE   EPE P+ +P P PEP+PEP  EPE P+ +P 
Sbjct: 38  DPDLEPEPE-PKPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPE-PEPEPE 94

Query: 264 PPPQPQPMPQPPP 302
           P P+P+P P+P P
Sbjct: 95  PEPEPEPEPEPEP 107

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 28/64 (43%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +3

Query: 117 KEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMP 290
           K+ +  K     +P+   EPE KP+ +P P PEP+PEP  EPE +P+ +P P P+P+P P
Sbjct: 26  KKGQVTKLGPDSDPDLEPEPEPKPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 85

Query: 291 QPPP 302
           +P P
Sbjct: 86  EPEP 89

[91][TOP]
>UniRef100_UPI0000384632 hypothetical protein Magn03010005 n=1 Tax=Magnetospirillum
           magnetotacticum MS-1 RepID=UPI0000384632
          Length = 308

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 43/88 (48%), Positives = 54/88 (61%), Gaps = 6/88 (6%)
 Frame = +3

Query: 54  PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK-EPEKPKEPEKPKEKPPPPPEPKPEP- 227
           P P +  KP+   +  EPE PK  E PKP+ PK EP KP  P +P   PP PP PKPEP 
Sbjct: 53  PPPLQDNKPQPEPQKSEPEPPKP-EPPKPEPPKPEPPKPPPPPEPAPTPPAPPPPKPEPA 111

Query: 228 ----PKEPEKPKEKPPPPPQPQPMPQPP 299
               P+   +PK +PPPPP+P+P P+PP
Sbjct: 112 PIPKPEPKPEPKPEPPPPPKPEPRPEPP 139

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 36/74 (48%), Positives = 42/74 (56%), Gaps = 2/74 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EPP P  PK EP KP+ P  P  PE       P P KP+    PK   KP+ KP PPP P
Sbjct: 71  EPPKPEPPKPEPPKPEPPKPPPPPEPAPTPPAPPPPKPEPAPIPKPEPKPEPKPEPPPPP 130

Query: 216 KPEP-PKEPEKPKE 254
           KPEP P+ P+K K+
Sbjct: 131 KPEPRPEPPKKTKD 144

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 31/72 (43%), Positives = 43/72 (59%), Gaps = 1/72 (1%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPKP 221
           PP P+P +PE PK P  P+    P     PKP+    P+   +PE KP+  PPP PEP+P
Sbjct: 77  PPKPEPPKPEPPKPPPPPEPAPTPPAPPPPKPEPAPIPKPEPKPEPKPEPPPPPKPEPRP 136

Query: 222 EPPKEPEKPKEK 257
           EPPK+ +  K++
Sbjct: 137 EPPKKTKDVKDE 148

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 32/54 (59%), Positives = 36/54 (66%), Gaps = 2/54 (3%)
 Frame = +3

Query: 147 PKEPEKPKEPEKPKEKP-PPPPE-PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P +  KP +PE  K +P PP PE PKPEPPK PE P  KPPPPP+P P P  PP
Sbjct: 55  PLQDNKP-QPEPQKSEPEPPKPEPPKPEPPK-PEPP--KPPPPPEPAPTPPAPP 104

[92][TOP]
>UniRef100_C1MYV9 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545
           RepID=C1MYV9_9CHLO
          Length = 869

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 46/110 (41%), Positives = 52/110 (47%), Gaps = 20/110 (18%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKP--------------------KEQEKPKPKKPKEPEK 164
           PPPP PK+P KPK+P KP  P  P                    +E   P P  PK+P  
Sbjct: 146 PPPPSPKKPPKPKKPPKPSPPPSPASEDADSEENAPASEDADSEEEAPSPPPPSPKKPPS 205

Query: 165 PKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
           PK+P  P    PPP  P P  PK+P KPK KPP P  P P P   P I A
Sbjct: 206 PKKPPTPDTPSPPPDAPSPPSPKKPPKPK-KPPKPSPPPPTPDLGPDIAA 254

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 31/95 (32%), Positives = 38/95 (40%), Gaps = 24/95 (25%)
 Frame = +3

Query: 87  PVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPP--------------------- 203
           P   ++ +  +    P P  PK+P KPK+P KP   PPP                     
Sbjct: 131 PPASEDADSEENAPSPPPPSPKKPPKPKKPPKPS--PPPSPASEDADSEENAPASEDADS 188

Query: 204 ---PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
               P P P  PK+P  PK KPP P  P P P  P
Sbjct: 189 EEEAPSPPPPSPKKPPSPK-KPPTPDTPSPPPDAP 222

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 29/80 (36%), Positives = 36/80 (45%), Gaps = 8/80 (10%)
 Frame = +3

Query: 96  PKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE--------PPKEPEKPK 251
           P   +   E+  P P  P  P+KP +P+KP  KP PPP P  E        P  E    +
Sbjct: 132 PASEDADSEENAPSPPPPS-PKKPPKPKKP-PKPSPPPSPASEDADSEENAPASEDADSE 189

Query: 252 EKPPPPPQPQPMPQPPPHIP 311
           E+ P PP P P   P P  P
Sbjct: 190 EEAPSPPPPSPKKPPSPKKP 209

[93][TOP]
>UniRef100_C1E4Y1 Putative uncharacterized protein n=1 Tax=Micromonas sp. RCC299
           RepID=C1E4Y1_9CHLO
          Length = 1031

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 42/99 (42%), Positives = 56/99 (56%), Gaps = 3/99 (3%)
 Frame = +3

Query: 30  EILEPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEK--PP 200
           E+   PP P+P +PE PK   +P EP+ +P  ++ P P +   P+ P +P   +EK  PP
Sbjct: 399 EVTTQPPKPEPPKPEPPKPEPRPAEPKARPVPKQVPTPARKPAPKPPPKPGPAREKRSPP 458

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
           PPPEP   PP  P  P   PPPPP+P P   P P  PA+
Sbjct: 459 PPPEPSRPPPPPPPPPPPPPPPPPRPPPPNPPKPAPPAT 497

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 42/102 (41%), Positives = 49/102 (48%), Gaps = 23/102 (22%)
 Frame = +3

Query: 75  KPKEPVKPK----EPEKPKEQEKPKPKK--PKEPE-KPKEPE-------------KPKEK 194
           K K+PV P     E E   +  KP+P K  P +PE +P EP+             KP  K
Sbjct: 384 KRKQPVNPVWRVVEDEVTTQPPKPEPPKPEPPKPEPRPAEPKARPVPKQVPTPARKPAPK 443

Query: 195 PPPPPEP---KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PPP P P   K  PP  PE  +  PPPPP P P P PPP  P
Sbjct: 444 PPPKPGPAREKRSPPPPPEPSRPPPPPPPPPPPPPPPPPRPP 485

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 32/86 (37%), Positives = 38/86 (44%), Gaps = 4/86 (4%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P PPPKP    + + P  P EP +P          P  P  P  P  P  +PPPP  PKP
Sbjct: 442 PKPPPKPGPAREKRSPPPPPEPSRP---------PPPPPPPPPPPPPPPPRPPPPNPPKP 492

Query: 222 EPPK----EPEKPKEKPPPPPQPQPM 287
            PP     EP  P   PP  P P+ +
Sbjct: 493 APPATFPVEPPAPTRAPPVEPDPEKL 518

[94][TOP]
>UniRef100_A4R5L4 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea
           RepID=A4R5L4_MAGGR
          Length = 737

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 39/89 (43%), Positives = 49/89 (55%), Gaps = 2/89 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPP--PPEP 215
           PPPP +P  P++P  P +P  P++P    +P P  P EP  P EP  P E PPP  PP P
Sbjct: 379 PPPPDRPPPPDRPPPPDEPPPPDEPPPPSEP-PPPPNEPPPPDEPPPPNESPPPDAPPPP 437

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
              PP +   P + PPPP  P P  +PPP
Sbjct: 438 NEPPPPDAPPPPDAPPPPDAPPPPDEPPP 466

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 38/98 (38%), Positives = 51/98 (52%), Gaps = 8/98 (8%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKP-------KKPKEPEKPKEPEKPKEKPP 200
           PPPP +P  P +P  P  P  P++P    KP P        +P  P++P  P++P     
Sbjct: 337 PPPPVRPPPPGEPPLPDNPPPPDEPPVSGKPPPGDEPPASARPPPPDRPPPPDRPPPPDE 396

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQ-PPPHIP 311
           PPP  +P PP EP  P  +PPPP +P P  + PPP  P
Sbjct: 397 PPPPDEPPPPSEPPPPPNEPPPPDEPPPPNESPPPDAP 434

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 39/95 (41%), Positives = 48/95 (50%), Gaps = 4/95 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +PPP  +P    +P  P +P  P++P   ++P P  P EP  P EP  P  +PPPP EP 
Sbjct: 366 KPPPGDEPPASARPPPPDRPPPPDRPPPPDEPPP--PDEPPPPSEPPPPPNEPPPPDEPP 423

Query: 219 PE----PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P     PP  P  P E PPP   P P   PPP  P
Sbjct: 424 PPNESPPPDAPPPPNEPPPPDAPPPPDAPPPPDAP 458

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 42/101 (41%), Positives = 54/101 (53%), Gaps = 9/101 (8%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKP----KEP---EKPKEQEKPKPKKPKEPEKPKEPEK--PK 188
           + PPPP +P  P+ P  P +P    K P   E P     P P +P  P++P  P++  P 
Sbjct: 341 VRPPPPGEPPLPDNPPPPDEPPVSGKPPPGDEPPASARPPPPDRPPPPDRPPPPDEPPPP 400

Query: 189 EKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           ++PPPP EP P PP EP  P E PPP   P P   PPP+ P
Sbjct: 401 DEPPPPSEP-PPPPNEPPPPDEPPPPNESPPPDAPPPPNEP 440

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 40/91 (43%), Positives = 48/91 (52%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EPP   KP   ++P    +P  P++P   ++P P  P EP  P EP  P E PPPPP  +
Sbjct: 360 EPPVSGKPPPGDEPPASARPPPPDRPPPPDRPPP--PDEPPPPDEPPPPSE-PPPPPN-E 415

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P PP EP  P E PPP   P P   PPP  P
Sbjct: 416 PPPPDEPPPPNESPPPDAPPPPNEPPPPDAP 446

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 37/89 (41%), Positives = 44/89 (49%), Gaps = 2/89 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPP--PPE 212
           EPPPP +P  P +P  P  P EP  P E     P  P E   P  P  P E PPP  PP 
Sbjct: 396 EPPPPDEPPPPSEPPPP--PNEPPPPDE-----PPPPNESPPPDAPPPPNEPPPPDAPPP 448

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           P   PP +   P ++PPPP +P  +  PP
Sbjct: 449 PDAPPPPDAPPPPDEPPPPGEPPALEGPP 477

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 39/101 (38%), Positives = 49/101 (48%), Gaps = 13/101 (12%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEP-EKPKEQEKPKPKKPKEPEKPKEPEKP--KEKPPPPP 209
           +PPP  +P  P  P  PV+P  P E P     P P +P    KP   ++P    +PPPP 
Sbjct: 325 KPPPGGRPP-PSNPPPPVRPPPPGEPPLPDNPPPPDEPPVSGKPPPGDEPPASARPPPPD 383

Query: 210 EP----------KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P          +P PP EP  P E PPPP +P P  +PPP
Sbjct: 384 RPPPPDRPPPPDEPPPPDEPPPPSEPPPPPNEPPPPDEPPP 424

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 37/92 (40%), Positives = 48/92 (52%), Gaps = 6/92 (6%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKP--KEKPPPPPEP- 215
           PPP KP    +P  P  P  P +P     P P +P  P+ P  P++P    KPPP  EP 
Sbjct: 321 PPPNKPPPGGRPP-PSNPPPPVRP-----PPPGEPPLPDNPPPPDEPPVSGKPPPGDEPP 374

Query: 216 ---KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
              +P PP  P  P ++PPPP +P P  +PPP
Sbjct: 375 ASARPPPPDRP-PPPDRPPPPDEPPPPDEPPP 405

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 39/105 (37%), Positives = 49/105 (46%), Gaps = 14/105 (13%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKPPPPPEP-- 215
           PP P    P +P  PV+P   + P    KP P K +   +P  P+ P   +PPPP  P  
Sbjct: 127 PPAPASPPPNRPPPPVRPPA-DNPPPPGKPPPNKLEGFGRPPAPDSPPPNRPPPPVRPPG 185

Query: 216 -------KPEPPKEPEKPKEKP----PPPPQPQPMPQPPPHIPAS 317
                  KP PP EP  P+  P    PPP +P P  +PP   PAS
Sbjct: 186 LGRPPPNKPPPPVEPPAPERAPAPGKPPPSKPPPPARPPGRPPAS 230

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 39/94 (41%), Positives = 47/94 (50%), Gaps = 10/94 (10%)
 Frame = +3

Query: 51  PPKPKEPEK----PKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKE--KPPPPPE 212
           PP+P  P      P+    P  P+ P   E P P +P  P +P  P KP    KPP PP+
Sbjct: 524 PPRPGNPPALGGPPRRGEPPAPPKPPPFGEPPAPPRPPAPPRPPAPPKPPPFGKPPAPPK 583

Query: 213 PKPEPPKEPEKPKE----KPPPPPQPQPMPQPPP 302
           P P PPK P  PK     KPP PP+P    +PPP
Sbjct: 584 P-PAPPKPPAPPKPPPFGKPPGPPEP---GKPPP 613

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 35/92 (38%), Positives = 44/92 (47%), Gaps = 5/92 (5%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PP P    P +P  PV+P    +P   + P P +P  PE+   P KP    PPPP     
Sbjct: 166 PPAPDSPPPNRPPPPVRPPGLGRPPPNKPPPPVEPPAPERAPAPGKPPPSKPPPP---AR 222

Query: 225 PPKEPEKPKEKPPPPPQPQP-----MPQPPPH 305
           PP  P  P  KPPPP +P P       +PPP+
Sbjct: 223 PPGRP--PASKPPPPGRPPPSRLAGSGRPPPN 252

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/96 (38%), Positives = 44/96 (45%), Gaps = 9/96 (9%)
 Frame = +3

Query: 42  PPP---------PPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEK 194
           PPP         PP    P +P  P  P     P+  E P P KP    +P  P +P   
Sbjct: 506 PPPLGRPPAFGGPPDLGGPPRPGNP--PALGGPPRRGEPPAPPKPPPFGEPPAPPRPPAP 563

Query: 195 PPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P PP  PKP P  +P  P  KPP PP+P   P+PPP
Sbjct: 564 PRPPAPPKPPPFGKPPAPP-KPPAPPKPPAPPKPPP 598

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 39/110 (35%), Positives = 46/110 (41%), Gaps = 21/110 (19%)
 Frame = +3

Query: 45  PPPPKPKEPEKPK--------EPVKPK-------EPEKPKEQEKPKPKKPKEPEKPKEPE 179
           PPP KP  P++P         +P   K        P KP    +P P  P  P +P  P 
Sbjct: 288 PPPNKPPPPDRPPPSRLAGSGKPPPSKLAGSGKPPPNKPPPGGRPPPSNPPPPVRPPPPG 347

Query: 180 KPK--EKPPPPPEP----KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           +P   + PPPP EP    KP P  EP      PPP   P P   PPP  P
Sbjct: 348 EPPLPDNPPPPDEPPVSGKPPPGDEPPASARPPPPDRPPPPDRPPPPDEP 397

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 33/88 (37%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = +3

Query: 39  EPPPPP-KPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EPPPPP +P  P++P  P +   P+ P     P P +P  P+ P  P+ P     PPP  
Sbjct: 408 EPPPPPNEPPPPDEPPPPNESPPPDAP-----PPPNEPPPPDAPPPPDAPPPPDAPPPPD 462

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           +P PP EP    E PP   +P    +PP
Sbjct: 463 EPPPPGEP-PALEGPPAGGKPPAFGRPP 489

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/112 (33%), Positives = 47/112 (41%), Gaps = 22/112 (19%)
 Frame = +3

Query: 42  PPPPPKPK--------EPEKPKEPVKPKEPE-------KPKEQEKPKPKKPKEPEKPKEP 176
           PPPP KP         +P  P  P   K P        KP     P P +P  P +P   
Sbjct: 88  PPPPGKPPPNKLEGFGKPPAPASPPPGKPPPNKLEGFGKPPAPASPPPNRPPPPVRP--- 144

Query: 177 EKPKEKPPPPPEPKPE-------PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
             P + PPPP +P P        PP     P  +PPPP +P  + +PPP+ P
Sbjct: 145 --PADNPPPPGKPPPNKLEGFGRPPAPDSPPPNRPPPPVRPPGLGRPPPNKP 194

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 33/97 (34%), Positives = 44/97 (45%), Gaps = 11/97 (11%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPE-----KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP 209
           PPPP     + P  P KP   +     +P   + P P +P  P +P    +P    PPPP
Sbjct: 138 PPPPVRPPADNPPPPGKPPPNKLEGFGRPPAPDSPPPNRPPPPVRPPGLGRPPPNKPPPP 197

Query: 210 EPKPEPPKEP---EKPKEKPPPPPQP---QPMPQPPP 302
              P P + P   + P  KPPPP +P    P  +PPP
Sbjct: 198 VEPPAPERAPAPGKPPPSKPPPPARPPGRPPASKPPP 234

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 34/98 (34%), Positives = 43/98 (43%), Gaps = 11/98 (11%)
 Frame = +3

Query: 42  PPPPPKPKE-----------PEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK 188
           PPPP KP             P+ P  P +P  P +P    +P P KP  P +P  PE+  
Sbjct: 149 PPPPGKPPPNKLEGFGRPPAPDSPP-PNRPPPPVRPPGLGRPPPNKPPPPVEPPAPERAP 207

Query: 189 EKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
               PPP   P P + P +P    PPPP      +PPP
Sbjct: 208 APGKPPPSKPPPPARPPGRPPASKPPPP-----GRPPP 240

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 41/126 (32%), Positives = 48/126 (38%), Gaps = 39/126 (30%)
 Frame = +3

Query: 42  PPPPPKP-----KEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP 206
           PPPP +P       P KP  PV+P  PE+     KP P KP  P +P     P  KPPPP
Sbjct: 177 PPPPVRPPGLGRPPPNKPPPPVEPPAPERAPAPGKPPPSKPPPPARP-PGRPPASKPPPP 235

Query: 207 PEPKPE--------PPKE--------PEK------------------PKEKPPPPPQPQP 284
             P P         PP +        P K                  P    PPP +P P
Sbjct: 236 GRPPPSRLAGSGRPPPNKLAGSGSPSPNKLAGSGSPPPSKLAGSGKAPAPGRPPPNKPPP 295

Query: 285 MPQPPP 302
             +PPP
Sbjct: 296 PDRPPP 301

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/96 (35%), Positives = 39/96 (40%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EPPPP +P  P +   P  P  P +P   + P P  P  P  P  P  P E PPP   P 
Sbjct: 415 EPPPPDEPPPPNESPPPDAPPPPNEPPPPDAPPP--PDAPPPPDAPPPPDEPPPPGEPPA 472

Query: 219 PEPPKEPEKPKE--------KPPPPPQPQPMPQPPP 302
            E P    KP           PP P +P     PPP
Sbjct: 473 LEGPPAGGKPPAFGRPPGFGGPPAPGRPPGFGGPPP 508

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 34/96 (35%), Positives = 43/96 (44%), Gaps = 7/96 (7%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP- 221
           PPP +P  P KP  P K +   KP     P P +P  P +P     P + PPPP +P P 
Sbjct: 5   PPPNRPPPPGKP-PPSKLEGFGKPPAPASPPPNRPPPPVRP-----PADNPPPPGKPPPN 58

Query: 222 ------EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
                 +PP     P  +P PP +P     PPP  P
Sbjct: 59  KLEGFGKPPAPDSPPPNRPLPPVRPPADNPPPPGKP 94

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 33/91 (36%), Positives = 40/91 (43%), Gaps = 2/91 (2%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP--EPK 218
           PP P    P +P  PV+P   + P    KP P K +   KP  P  P    PPP   E  
Sbjct: 66  PPAPDSPPPNRPLPPVRP-PADNPPPPGKPPPNKLEGFGKPPAPASPPPGKPPPNKLEGF 124

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            +PP     P  +PPPP +P     PPP  P
Sbjct: 125 GKPPAPASPPPNRPPPPVRPPADNPPPPGKP 155

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/107 (34%), Positives = 43/107 (40%), Gaps = 18/107 (16%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPE-----KPKEQEKPKPKKPKEPEKPKEPEKPKE-KPPP- 203
           PPPP     + P  P KP   +     KP   + P P +P  P +P     P   KPPP 
Sbjct: 38  PPPPVRPPADNPPPPGKPPPNKLEGFGKPPAPDSPPPNRPLPPVRPPADNPPPPGKPPPN 97

Query: 204 -------PPEPKPEPPKEPEKPK----EKPPPPPQPQPMPQPPPHIP 311
                  PP P   PP +P   K     KPP P  P P   PPP  P
Sbjct: 98  KLEGFGKPPAPASPPPGKPPPNKLEGFGKPPAPASPPPNRPPPPVRP 144

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 34/89 (38%), Positives = 40/89 (44%), Gaps = 8/89 (8%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKE-------KPP 200
           PPPP KP  P K +   KP  P  P     P P +P   + P  P KP         KPP
Sbjct: 10  PPPPGKPP-PSKLEGFGKPPAPASPPPNRPPPPVRPPA-DNPPPPGKPPPNKLEGFGKPP 67

Query: 201 PPPEPKPEPPKEPEK-PKEKPPPPPQPQP 284
            P  P P  P  P + P + PPPP +P P
Sbjct: 68  APDSPPPNRPLPPVRPPADNPPPPGKPPP 96

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 33/93 (35%), Positives = 40/93 (43%), Gaps = 8/93 (8%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPK-EKPPPPPEPKP 221
           PP P    P +P  PV+P   + P    KP P K +   KP  P+ P   +P PP  P  
Sbjct: 27  PPAPASPPPNRPPPPVRPPA-DNPPPPGKPPPNKLEGFGKPPAPDSPPPNRPLPPVRPPA 85

Query: 222 EPPKEPEKPKE-------KPPPPPQPQPMPQPP 299
           + P  P KP         KPP P  P P   PP
Sbjct: 86  DNPPPPGKPPPNKLEGFGKPPAPASPPPGKPPP 118

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 30/63 (47%), Positives = 31/63 (49%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP PP+P  P KP    KP  P KP     P P KP  P KP     P  KPP PPEP  
Sbjct: 560 PPAPPRPPAPPKPPPFGKPPAPPKP-----PAPPKPPAPPKP----PPFGKPPGPPEPGK 610

Query: 222 EPP 230
            PP
Sbjct: 611 PPP 613

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 31/88 (35%), Positives = 40/88 (45%), Gaps = 2/88 (2%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP- 221
           PPP K     K   P +P  P KP   ++P P +     KP   +      PPP +P P 
Sbjct: 271 PPPSKLAGSGKAPAPGRPP-PNKPPPPDRPPPSRLAGSGKPPPSKLAGSGKPPPNKPPPG 329

Query: 222 -EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
             PP     P  +PPPP +P P+P  PP
Sbjct: 330 GRPPPSNPPPPVRPPPPGEP-PLPDNPP 356

[95][TOP]
>UniRef100_UPI0001B7B13D gamma-aminobutyric acid A receptor, epsilon n=1 Tax=Rattus
           norvegicus RepID=UPI0001B7B13D
          Length = 914

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 45/100 (45%), Positives = 59/100 (59%), Gaps = 12/100 (12%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-----------KP 185
           +P P P+P EPE   EP    EPE P+ Q +P+P+   EPE   EPE           +P
Sbjct: 242 QPEPQPEPPEPEPEPEPEPEPEPE-PEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEP 300

Query: 186 KEKPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           + +P P PEP+PEP  EPE +P+ +P P P+PQP PQP P
Sbjct: 301 EPEPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEP 340

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 45/90 (50%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   EPE   EP+ P+ +P P PE
Sbjct: 263 EPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQ-PEPEPEPEPE 321

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE P+ +P P P+PQP PQP P
Sbjct: 322 PEPEPEPEPE-PQPEPQPEPEPQPEPQPDP 350

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EP+   EPE +P+ +P P P
Sbjct: 255 EPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQPEP 314

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P PQP+P PQP P
Sbjct: 315 EPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEP 346

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 44/91 (48%), Positives = 59/91 (64%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   +PE   EPE P+ +P P PE
Sbjct: 267 EPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQPEPE-PEPEPEPEPE 325

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  +PE +P+ +P P PQP P PQP P
Sbjct: 326 PEPEPEPQPEPQPEPEPQPEPQPDPEPQPEP 356

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 41/87 (47%), Positives = 56/87 (64%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P+P+ PE   EP    EPE P+ + +P+P+   EPE   EPE P+ +P P PEP+P
Sbjct: 241 PQPEPQPEPPEPEPEPEPEPEPE-PEPEPQPEPEPEPEPEPEPEPE-PEPEPEPQPEPQP 298

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP  EPE P+ +P P P+P+P P+P P
Sbjct: 299 EPEPEPE-PQPEPQPEPEPEPEPEPEP 324

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 41/88 (46%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+P+   +P EP    EPE P+ + +P+P+   EPE   EPE P+ +P P PEP+
Sbjct: 236 DPHPHPQPEPQPEPPEPEPEPEPE-PEPEPEPEPQPEPEPEPEPEPE-PEPEPEPEPEPQ 293

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP  EPE P+ +P P PQP+P P+P P
Sbjct: 294 PEPQPEPE-PEPEPQPEPQPEPEPEPEP 320

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 42/90 (46%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+ EPE   EP    EPE P+ + +P+P+   EPE   EP+ P+ +P P PEP
Sbjct: 261 EPEPEPEPQPEPEPEPEPEPEPEPE-PEPEPEPQPEPQPEPEPEPEPQ-PEPQPEPEPEP 318

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 319 EPEPEPEPEPEPEPQPEPQPEPEPQPEPQP 348

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EP+ +P+ + +P+P+   EPE   EPE P+ +P P PE
Sbjct: 273 EPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQPEPEPEPEPE-PEPEPEPEPE 331

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE +P+ +P P PQP+P P+P P
Sbjct: 332 PQPEPQPEPEPQPEPQPDPEPQPEPGPEPGP 362

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 39/89 (43%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+P +P    +P    EP +P+ + +P+P+   EPE   EPE P+ +P P PEP+
Sbjct: 228 QPRPKPQP-DPHPHPQPEPQPEPPEPEPEPEPEPEPEPEPEPQPEPE-PEPEPEPEPEPE 285

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EP+ +P+ +P P P+PQP PQP P
Sbjct: 286 PEPEPEPQPEPQPEPEPEPEPQPEPQPEP 314

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/90 (47%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+ EPE   EP    EPE P+ Q +P+P+   EPE   EPE P+ +P P PEP
Sbjct: 279 EPEPEPEPEPEPEPQPEPQPEPEPE-PEPQPEPQPEPEPEPEPEPEPE-PEPEPEPQPEP 336

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  +PE +P  +P P P P+P P+P P
Sbjct: 337 QPEPEPQPEPQPDPEPQPEPGPEPGPEPEP 366

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 38/88 (43%), Positives = 57/88 (64%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P P +PE   EP +P+   +P+ + +P+P+   EPE   EPE P+ +P P PEP+
Sbjct: 234 QPDPHPHP-QPEPQPEPPEPEPEPEPEPEPEPEPEPQPEPEPEPEPE-PEPEPEPEPEPE 291

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+P  +PE P+ +P P P+PQP P+P P
Sbjct: 292 PQPEPQPE-PEPEPEPQPEPQPEPEPEP 318

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 34/89 (38%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   +P+ P + +   +P+ + +P P    +PE   EP +P+ +P P PEP+
Sbjct: 204 EPQPEPQPEPQPQPQTPGQVQAGRQPRPKPQPDPHPHPQPEPQPEPPEPEPEPEPEPEPE 263

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  +PE +P+ +P P P+P+P P+P P
Sbjct: 264 PEPEPQPEPEPEPEPEPEPEPEPEPEPEP 292

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 34/89 (38%), Positives = 54/89 (60%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+P+   +P+   +P+ P + +   +P+PK   +P    +PE   E P P PEP+
Sbjct: 198 QPDPQPEPQPEPQPEPQPQPQTPGQVQAGRQPRPKPQPDPHPHPQPEPQPEPPEPEPEPE 257

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 258 PEPEPEPEPEPQPEPEPEPEPEPEPEPEP 286

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 41/91 (45%), Positives = 57/91 (62%), Gaps = 5/91 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPP 206
           EP P P+P EPE   EP    EPE +P+ + +P+P+   +PE   EPE   +P+  P P 
Sbjct: 295 EPQPEPEP-EPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQPDPEPQ 353

Query: 207 PEPKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           PEP PEP  EPE +P+ +P P P+P+P P+P
Sbjct: 354 PEPGPEPGPEPEPEPQLEPQPEPEPEPQPEP 384

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/97 (42%), Positives = 59/97 (60%), Gaps = 7/97 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE---KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPP 200
           EP P P+P +PE   EP    EPE   +P+ + +P+P+   E E   EPE   +P  +P 
Sbjct: 345 EPQPDPEP-QPEPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQ 403

Query: 201 PPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
           P PEP+PEP  EPE +P+ +P P P+P+P P+P P +
Sbjct: 404 PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEL 440

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 42/102 (41%), Positives = 58/102 (56%), Gaps = 14/102 (13%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   +PE   +PE +P+  P P P
Sbjct: 303 EPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQPDPEPQPEPGPEPGP 362

Query: 210 EPKPEPPKEPEKPKEKPP-----------PPPQPQPMPQPPP 302
           EP+PEP  EP+   E  P           P P+PQP+P+P P
Sbjct: 363 EPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQP 404

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 40/93 (43%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
           EP P P+P+ +PE   EP     PE +P+ Q +P+P+   EP+   E E   +P+ +P P
Sbjct: 339 EPEPQPEPQPDPEPQPEPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQP 398

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PEP+PEP  EPE P+ +P P P+P+P P+P P
Sbjct: 399 LPEPQPEPEPEPE-PEPEPEPEPEPEPEPEPEP 430

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 39/94 (41%), Positives = 57/94 (60%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    +PE +P+ + +P+P+   EPE   EP+ +P+ +P P P
Sbjct: 289 EPEPQPEPQPEPEPEPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQP 348

Query: 210 EPKPEPPKEPEKPKEKPPPP---PQPQPMPQPPP 302
           +P+P+P   PE   E  P P   PQP+P P+P P
Sbjct: 349 DPEPQPEPGPEPGPEPEPEPQLEPQPEPEPEPQP 382

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/99 (41%), Positives = 56/99 (56%), Gaps = 11/99 (11%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   +P    EPE +P+ Q  P+P+    PE   EPE P+ +  P PE
Sbjct: 317 EPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQPDPEPQPEPGPEPGPEPE-PEPQLEPQPE 375

Query: 213 PKPEPPKEPE---------KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE         +P+  P P P+P+P P+P P
Sbjct: 376 PEPEPQPEPESELDLEPEPEPQPLPEPQPEPEPEPEPEP 414

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 12/100 (12%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEK---PKEQEKPKPKKPKEPEKPKEPEKPKE----- 191
           EP P P+P+ EPE   EP    EP+    P+   +P+P+   EP+   EPE   E     
Sbjct: 329 EPEPQPEPQPEPEPQPEPQPDPEPQPEPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESEL 388

Query: 192 --KPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
             +P P P+P PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 389 DLEPEPEPQPLPEPQPEPEPEPEPEPEPEPEPEPEPEPEP 428

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP---EKPKEKPPPPP 209
           +P P P+P    +P    +P+   +P+ Q +P+P   ++P     P    +P+ +P P P
Sbjct: 84  QPLPQPQPLPEPQPLPEPEPQPQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQPEPEPQP 143

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EP+ +P+ +P P PQP+P PQP P
Sbjct: 144 EPQPEPQPEPQPEPQPEPQPEPQPEPQPQPQP 175

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 40/113 (35%), Positives = 59/113 (52%), Gaps = 22/113 (19%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEP---------EKPKEPEKP 185
           EP P P+P+ +PE   EP    +PE +P+ Q +P+P   ++P          +P+   +P
Sbjct: 140 EPQPEPQPEPQPEPQPEPQPEPQPEPQPEPQPQPQPLAGRQPLPWPLPLPLPEPQPDPQP 199

Query: 186 KEKPPPPPEPKPEPPKEPE-----------KPKEKPPPPPQPQPMPQPPPHIP 311
             +P P PEP+PEP  +P+           +PK +P P P PQP PQP P  P
Sbjct: 200 DPQPEPQPEPQPEPQPQPQTPGQVQAGRQPRPKPQPDPHPHPQPEPQPEPPEP 252

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 35/103 (33%), Positives = 57/103 (55%), Gaps = 15/103 (14%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKP---------KEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE--- 179
           EP P P+P    +P          EP    +P+ +P+ Q +P+P+   +P+ P + +   
Sbjct: 168 EPQPQPQPLAGRQPLPWPLPLPLPEPQPDPQPDPQPEPQPEPQPEPQPQPQTPGQVQAGR 227

Query: 180 --KPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
             +PK +P P P P+PEP  EP +P+ +P P P+P+P P+P P
Sbjct: 228 QPRPKPQPDPHPHPQPEPQPEPPEPEPEPEPEPEPEPEPEPQP 270

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 30/90 (33%), Positives = 53/90 (58%), Gaps = 3/90 (3%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPPPE 212
           P P P P+    P+   +P+   +P+ + +P+P+ P + +  ++P    +P   P P PE
Sbjct: 185 PLPLPLPEPQPDPQPDPQPEPQPEPQPEPQPQPQTPGQVQAGRQPRPKPQPDPHPHPQPE 244

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+PEPP+   +P+ +P P P+P+P P+P P
Sbjct: 245 PQPEPPEPEPEPEPEPEPEPEPEPQPEPEP 274

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 38/92 (41%), Positives = 53/92 (57%), Gaps = 2/92 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPP-PPPEP 215
           P P P+P EPE   EP    +PE +P+ Q +P+P+   EP+   +P   ++  P P P P
Sbjct: 131 PLPQPQP-EPEPQPEPQPEPQPEPQPEPQPEPQPEPQPEPQPQPQPLAGRQPLPWPLPLP 189

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PEP  +P+ P  +P P P+PQP PQP P  P
Sbjct: 190 LPEPQPDPQ-PDPQPEPQPEPQPEPQPQPQTP 220

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 32/88 (36%), Positives = 52/88 (59%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+P+   +P+   +P+   +P+ Q +P+P+ P    +P     P   P P PEP+
Sbjct: 82  QPQPLPQPQPLPEPQPLPEPEPQPQPQPQPQPQPQ-PLAGRQPLPQPLPWPLPQPQPEPE 140

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+P  +PE P+ +P P PQP+P P+P P
Sbjct: 141 PQPEPQPE-PQPEPQPEPQPEPQPEPQP 167

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 36/92 (39%), Positives = 55/92 (59%), Gaps = 1/92 (1%)
 Frame = +3

Query: 30  EILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP 209
           ++    P P P +P+   EP    EPE P+ Q +P+P+   +P   ++P  P+  P P P
Sbjct: 77  DVFSSQPQPLP-QPQPLPEPQPLPEPE-PQPQPQPQPQPQPQPLAGRQP-LPQPLPWPLP 133

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+PEP  +PE +P+ +P P P+PQP PQP P
Sbjct: 134 QPQPEPEPQPEPQPEPQPEPQPEPQPEPQPEP 165

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/92 (43%), Positives = 52/92 (56%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQE-----KPKPKKPKEPEKPKEPEKPKEKPP 200
           EP P P P+ EPE   EP    EPE   E E     +P+P+    PE   EPE P+ +P 
Sbjct: 355 EPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQPEPE-PEPEPE 413

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           P PEP+PEP  EPE P+ +P P P+P+   +P
Sbjct: 414 PEPEPEPEPEPEPE-PEPEPEPEPEPELELEP 444

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/96 (41%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPK---EPEKPKEPVKPKEPEKPKEQE-KPKPKKPKEPEKPKEPEKPKEKPPPP 206
           EP P P+P+   EP+   EP    EPE   + E +P+P+   EP+   EPE P+ +P P 
Sbjct: 359 EPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQPEPEPE-PEPEPEPE 417

Query: 207 PEPKPEPPKEPEKPKEKPPPPP----QPQPMPQPPP 302
           PEP+PEP  EPE P+ +P P P    +PQ   +P P
Sbjct: 418 PEPEPEPEPEPE-PEPEPEPEPELELEPQSQLEPQP 452

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 41/87 (47%), Positives = 51/87 (58%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           LEP P P+P EP+   E     EPE P+ Q  P+P+   EPE   EPE P+ +P P PEP
Sbjct: 370 LEPQPEPEP-EPQPEPESELDLEPE-PEPQPLPEPQPEPEPEPEPEPE-PEPEPEPEPEP 426

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PEP  EPE P+ +    PQ Q  PQP
Sbjct: 427 EPEPEPEPE-PEPELELEPQSQLEPQP 452

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 29/117 (24%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEP-------EKPKEQEKPKPKKPKEPEKPKEPEKPKEK 194
           EP P P+P+ +P+   +P+  ++P         P+ Q +P+P+   +PE   EP+ P+ +
Sbjct: 100 EPEPQPQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQPEPEPQPEPQPEPQPEPQ-PEPQ 158

Query: 195 PPPPPEPKPEPPKEPEK---------------------PKEKPPPPPQPQPMPQPPP 302
           P P PEP+PEP  +P+                      P+  P P PQP+P P+P P
Sbjct: 159 PEPQPEPQPEPQPQPQPLAGRQPLPWPLPLPLPEPQPDPQPDPQPEPQPEPQPEPQP 215

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 36/91 (39%), Positives = 52/91 (57%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +P+   +P+       Q  P+P     P+   EPE +P+ +P P PEP
Sbjct: 94  EPQPLPEPEPQPQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQPEPEPQPEPQPEPQPEP 153

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMP--QPPP 302
           +PEP  EP+ P+ +P P PQPQP+   QP P
Sbjct: 154 QPEPQPEPQ-PEPQPEPQPQPQPLAGRQPLP 183

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/104 (34%), Positives = 53/104 (50%), Gaps = 16/104 (15%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPK--EPVKPKEPEKPKE------------QEKPKPKKPKEPEKPKE 173
           +P P P+P   PE P   + V   +P+   E            Q  P+P+   EP+   E
Sbjct: 41  QPQPVPQPLIPPESPAGDDVVFDSQPQPQSESPGHDDVFSSQPQPLPQPQPLPEPQPLPE 100

Query: 174 PE-KPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PE +P+ +P P P+P+P   ++P  P+  P P PQPQP P+P P
Sbjct: 101 PEPQPQPQPQPQPQPQPLAGRQP-LPQPLPWPLPQPQPEPEPQP 143

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 36/115 (31%), Positives = 52/115 (45%), Gaps = 26/115 (22%)
 Frame = +3

Query: 36  LEPPPPPKPK-----EPEKPKEPVKPKEPEKPK-------EQEKPKPKKPKEPEKPKEPE 179
           LE  PP + K     +P+   +P+ P  PE P         Q +P+ + P   +      
Sbjct: 26  LENKPPAQDKVVFGPQPQPVPQPLIP--PESPAGDDVVFDSQPQPQSESPGHDDVFSSQP 83

Query: 180 KPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQ--------------PMPQPPP 302
           +P  +P P PEP+P P  EP+ P+ +P P PQPQ              P+PQP P
Sbjct: 84  QPLPQPQPLPEPQPLPEPEPQ-PQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQP 137

[96][TOP]
>UniRef100_Q2W2A9 Periplasmic protein TonB, links inner and outer membranes n=1
           Tax=Magnetospirillum magneticum AMB-1 RepID=Q2W2A9_MAGSA
          Length = 313

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 45/92 (48%), Positives = 55/92 (59%), Gaps = 5/92 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPK-EPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP-PE 212
           +P P P+  EPE PK EP KP+ P       KP+P KP  P  P  P  P   PPPP PE
Sbjct: 60  KPQPEPQKAEPEPPKPEPPKPEPP-------KPEPPKPPPPPTPAPPPPPTPAPPPPKPE 112

Query: 213 PKPEPPKEPE---KPKEKPPPPPQPQPMPQPP 299
           P P P  +PE   +PK +PPPPP+P+P P+PP
Sbjct: 113 PAPAPIPKPEPKPEPKPEPPPPPKPEPRPEPP 144

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 39/80 (48%), Positives = 46/80 (57%), Gaps = 1/80 (1%)
 Frame = +3

Query: 45  PPPPKPKEPEKPK-EPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP P+P +PE PK EP KP  P  P     P P  P  P KP+    P  KP P PEPKP
Sbjct: 72  PPKPEPPKPEPPKPEPPKPPPPPTPAPPPPPTPAPP--PPKPEPAPAPIPKPEPKPEPKP 129

Query: 222 EPPKEPEKPKEKPPPPPQPQ 281
           EPP  P KP+ +P PP +P+
Sbjct: 130 EPPPPP-KPEPRPEPPKKPK 148

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/76 (48%), Positives = 42/76 (55%)
 Frame = +3

Query: 87  PVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPP 266
           P+  K    P +  KP+P    EP+K  EPE PK +PP P  PKPEPPK P  P   PPP
Sbjct: 46  PIGAKTNPPPLQDNKPQP----EPQKA-EPEPPKPEPPKPEPPKPEPPKPPPPPTPAPPP 100

Query: 267 PPQPQPMPQPPPHIPA 314
           PP P P P  P   PA
Sbjct: 101 PPTPAPPPPKPEPAPA 116

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 38/83 (45%), Positives = 45/83 (54%)
 Frame = +3

Query: 54  PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPK 233
           P P +  KP+   +  EPE PK    P+P KP EP KP+ P     KPPPPP P P PP 
Sbjct: 53  PPPLQDNKPQPEPQKAEPEPPK----PEPPKP-EPPKPEPP-----KPPPPPTPAPPPPP 102

Query: 234 EPEKPKEKPPPPPQPQPMPQPPP 302
            P       PPPP+P+P P P P
Sbjct: 103 TPA------PPPPKPEPAPAPIP 119

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 34/78 (43%), Positives = 44/78 (56%), Gaps = 7/78 (8%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK-------EPEKPKEPEKPKEKPPP 203
           PP P+P +PE PK P  P     P     P P KP+       +PE   EP KP+  PPP
Sbjct: 77  PPKPEPPKPEPPKPPPPPTPAPPPPPTPAPPPPKPEPAPAPIPKPEPKPEP-KPEPPPPP 135

Query: 204 PPEPKPEPPKEPEKPKEK 257
            PEP+PEPPK+P+  K++
Sbjct: 136 KPEPRPEPPKKPKDVKDE 153

[97][TOP]
>UniRef100_B3XPV9 LPXTG-motif cell wall anchor domain protein n=1 Tax=Lactobacillus
           reuteri 100-23 RepID=B3XPV9_LACRE
          Length = 710

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 43/91 (47%), Positives = 59/91 (64%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 543 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 602

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EP +PK  P P P+P+P P+P P
Sbjct: 603 EPEPEPEPEPVEPKPDPGPEPEPEPEPKPKP 633

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+PK EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 515 EPEPEPEPKPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 574

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 575 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 606

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           EP P P+P EPE   EP    EPE KP+ + +P+P+   EPE   EPE +P+ +P P PE
Sbjct: 499 EPEPEPEP-EPEPEPEPEPEPEPEPKPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE 557

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 558 PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 588

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 44/95 (46%), Positives = 62/95 (65%), Gaps = 4/95 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 521 EPKPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 580

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHIP 311
           EP+PEP  EPE +P+ +P P P+P+P P+P P  P
Sbjct: 581 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPVEP 615

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/93 (46%), Positives = 61/93 (65%), Gaps = 4/93 (4%)
 Frame = +3

Query: 36  LEPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPP 206
           ++P P P P+ EPE   EP    EPE +P+ + KP+P+   EPE   EPE +P+ +P P 
Sbjct: 490 IDPKPDPGPEPEPEPEPEPEPEPEPEPEPEPEPKPEPEPEPEPEPEPEPEPEPEPEPEPE 549

Query: 207 PEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 550 PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 582

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 505 EPEPEPEPEPEPEPEPEPKPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 564

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 565 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 596

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE P+ + +P+P+   EPE   EPE +P+ +P P PE
Sbjct: 503 EPEPEPEPEPEPEPEPEPEPKPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE 561

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 562 PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 592

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE P+ + +P+P+   EPE   EPE +P+ +P P PE
Sbjct: 509 EPEPEPEPEPEPEPKPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE 567

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 568 PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 598

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 43/95 (45%), Positives = 60/95 (63%), Gaps = 4/95 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 525 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 584

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHIP 311
           EP+PEP  EPE +P+ +P P P+P+P P  P   P
Sbjct: 585 EPEPEPEPEPEPEPEPEPEPEPEPEPEPVEPKPDP 619

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 37/88 (42%), Positives = 56/88 (63%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP  PKP    +P+   +P+   +P+ + +P+P+   EPE   EPE P+ +P P PEP+P
Sbjct: 488 PPIDPKPDPGPEPEPEPEPEPEPEPEPEPEPEPEPKPEPEPEPEPE-PEPEPEPEPEPEP 546

Query: 222 EPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP  EPE +P+ +P P P+P+P P+P P
Sbjct: 547 EPEPEPEPEPEPEPEPEPEPEPEPEPEP 574

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 43/94 (45%), Positives = 59/94 (62%), Gaps = 3/94 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 547 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 606

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           EP+PE P EP KP   P P P+P+P P+P   +P
Sbjct: 607 EPEPE-PVEP-KPDPGPEPEPEPEPKPKPEQSVP 638

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = +3

Query: 87  PVKPKEP--EKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPKPEPPKEPEKPKEK 257
           PV P +   E P    KP P    EPE   EPE +P+ +P P PEPKPEP  EPE P+ +
Sbjct: 477 PVFPDDSFIEIPPIDPKPDPGPEPEPEPEPEPEPEPEPEPEPEPEPKPEPEPEPE-PEPE 535

Query: 258 PPPPPQPQPMPQPPP 302
           P P P+P+P P+P P
Sbjct: 536 PEPEPEPEPEPEPEP 550

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 2/75 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EP +PK  P P PE
Sbjct: 565 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPVEPKPDPGPEPE 624

Query: 213 PKPEPPKEPEKPKEK 257
           P+PEP  +PE+   K
Sbjct: 625 PEPEPKPKPEQSVPK 639

[98][TOP]
>UniRef100_C4JK96 Putative uncharacterized protein n=1 Tax=Uncinocarpus reesii 1704
           RepID=C4JK96_UNCRE
          Length = 815

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 46/106 (43%), Positives = 56/106 (52%), Gaps = 19/106 (17%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKE-----PEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKP 197
           PPPPP P +PE P++  KP+      P  PK   KP P+   +PE   EPE   +PK KP
Sbjct: 236 PPPPPPPPQPEPPRDNPKPQRAPSPAPPPPKPAPKPAPEPEAKPEPEPEPEPAPEPKPKP 295

Query: 198 PPPPEPKPEPPKEPE-----------KPKEKPPPPPQPQPMPQPPP 302
            P  EPKP+P   PE           KP  KP P P+P+  PQPPP
Sbjct: 296 QPRAEPKPQPEVRPEPASKPESKPEPKPDHKPEPEPRPEQKPQPPP 341

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/94 (45%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP+   P  P  P  P +PE P++   PKP++   P  P  P KP  KP P PE KPE
Sbjct: 225 PPPPRSSAPPPPPPPPPPPQPEPPRDN--PKPQRAPSPAPP--PPKPAPKPAPEPEAKPE 280

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHI---PAS 317
           P  EPE P  +P P PQP+  P+P P +   PAS
Sbjct: 281 PEPEPE-PAPEPKPKPQPRAEPKPQPEVRPEPAS 313

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 41/101 (40%), Positives = 59/101 (58%), Gaps = 10/101 (9%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-------KPKEPEKPKEPEKPKEKPPP 203
           PPPPKP     P+   KP+   +P+   +PKPK       KP+   +P+   KP+ KP P
Sbjct: 262 PPPPKPAPKPAPEPEAKPEPEPEPEPAPEPKPKPQPRAEPKPQPEVRPEPASKPESKPEP 321

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQ---PPPHIPAS 317
            P+ KPEP  EP +P++KP PPP+P+P P+   P P  P++
Sbjct: 322 KPDHKPEP--EP-RPEQKPQPPPEPKPEPKQDTPAPPQPSN 359

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 41/100 (41%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +3

Query: 42  PPPPPKPK---EPEKPKEPVKPKEPE-----KPKEQEKPKPKKPKEPEKPKEPE-KPKEK 194
           PPP P PK   EPE   EP    EP      KP+ + +PKP+    PE   +PE KP+ K
Sbjct: 263 PPPKPAPKPAPEPEAKPEPEPEPEPAPEPKPKPQPRAEPKPQPEVRPEPASKPESKPEPK 322

Query: 195 PPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPA 314
           P   PEP+P P ++P+ P E  P P Q  P P  P +  A
Sbjct: 323 PDHKPEPEPRPEQKPQPPPEPKPEPKQDTPAPPQPSNTEA 362

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 36/87 (41%), Positives = 48/87 (55%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+   KP+  V+P+   KP+ + +PKP    EPE      +P++KP PPPEPK
Sbjct: 290 EPKPKPQPRAEPKPQPEVRPEPASKPESKPEPKPDHKPEPEP-----RPEQKPQPPPEPK 344

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           PEP       K+  P PPQP      P
Sbjct: 345 PEP-------KQDTPAPPQPSNTEAKP 364

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 28/66 (42%), Positives = 34/66 (51%), Gaps = 3/66 (4%)
 Frame = +3

Query: 114 PKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKP---PPPPQPQP 284
           P     P P+ P     P     P   PPPPP P+PEPP++  KP+  P   PPPP+P P
Sbjct: 215 PGANAAPPPRPP-----PPRSSAPPPPPPPPPPPQPEPPRDNPKPQRAPSPAPPPPKPAP 269

Query: 285 MPQPPP 302
            P P P
Sbjct: 270 KPAPEP 275

[99][TOP]
>UniRef100_UPI000155330F PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI000155330F
          Length = 387

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 44/93 (47%), Positives = 62/93 (66%), Gaps = 4/93 (4%)
 Frame = +3

Query: 36  LEPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPP 206
           LEP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P 
Sbjct: 213 LEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE 272

Query: 207 PEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 273 PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 305

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 43/94 (45%), Positives = 62/94 (65%), Gaps = 4/94 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 250 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 309

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
           EP+PEP  EPE +P+ +P P P+P+P P+P P +
Sbjct: 310 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEL 343

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 218 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 277

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 278 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 309

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 220 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 279

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 280 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 311

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 222 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 281

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 282 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 313

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 224 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 283

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 284 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 315

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 226 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 285

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 286 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 317

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 228 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 287

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 288 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 319

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 230 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 289

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 290 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 321

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 232 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 291

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 292 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 323

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 234 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 293

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 294 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 325

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 236 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 295

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 296 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 327

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 238 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 297

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 298 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 329

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 240 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 299

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 300 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 331

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 242 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 301

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 302 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 333

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 244 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 303

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 304 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 335

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 42/94 (44%), Positives = 61/94 (64%), Gaps = 4/94 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 254 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 313

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
           EP+PEP  EPE +P+ +P P P+P+P P+  P +
Sbjct: 314 EPEPEPEPEPEPEPEPEPEPEPEPEPEPELEPEL 347

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 42/95 (44%), Positives = 60/95 (63%), Gaps = 2/95 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P EPE   EP    EPE P+ + +P+P+   EPE   EPE +P+ +P P PEP
Sbjct: 264 EPEPEPEP-EPEPEPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 321

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHIPAS 317
           +PEP  EPE +P+ +P P P+ +P  +P P + A+
Sbjct: 322 EPEPEPEPEPEPEPEPEPEPELEPELEPEPELEAT 356

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (1%)
 Frame = +3

Query: 132 PKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+ +   EPE   EPE P+ +P P PEP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 207 PELELKLEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 263

[100][TOP]
>UniRef100_UPI0001B7B13C gamma-aminobutyric acid A receptor, epsilon n=1 Tax=Rattus
           norvegicus RepID=UPI0001B7B13C
          Length = 989

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 45/90 (50%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   EPE   EP+ P+ +P P PE
Sbjct: 338 EPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQ-PEPEPEPEPE 396

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE P+ +P P P+PQP PQP P
Sbjct: 397 PEPEPEPEPE-PQPEPQPEPEPQPEPQPDP 425

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 45/89 (50%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P EPE   EP    EPE P+ + +P+P+   EPE   EPE +P+ +P P PEP
Sbjct: 290 EPQPEPQP-EPEPQPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEP 347

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE P+ +P P P+PQP PQP P
Sbjct: 348 EPEPEPEPE-PEPEPEPEPEPQPEPQPEP 375

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 294 EPQPEPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEP 353

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P PQP P
Sbjct: 354 EPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEP 385

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EP+ +P+ +P P P
Sbjct: 324 EPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQP 383

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+PQP PQP P
Sbjct: 384 EPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEP 415

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EP+   EPE +P+ +P P P
Sbjct: 330 EPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQPEP 389

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P PQP+P PQP P
Sbjct: 390 EPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEP 421

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE P+ +P P PE
Sbjct: 300 EPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPE-PEPEPEPEPE 358

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EP+ +P+ +P P P+PQP PQP P
Sbjct: 359 PEPEPEPEPQPEPQPEPEPEPEPQPEPQPEP 389

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 306 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEP 365

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE P+ +P P PQP+P P+P P
Sbjct: 366 EPQPEPQPEPE-PEPEPQPEPQPEPEPEPEP 395

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 44/94 (46%), Positives = 61/94 (64%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE   +P+ +P P
Sbjct: 318 EPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEP 377

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            PEP+PEP  EPE +P+ +P P P+P+P PQP P
Sbjct: 378 EPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEP 411

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 44/91 (48%), Positives = 59/91 (64%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   +PE   EPE P+ +P P PE
Sbjct: 342 EPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQPEPE-PEPEPEPEPE 400

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  +PE +P+ +P P PQP P PQP P
Sbjct: 401 PEPEPEPQPEPQPEPEPQPEPQPDPEPQPEP 431

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/90 (48%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    +PE +P+ Q +P+P+   EPE   EPE P+ +P P PE
Sbjct: 266 EPHPGPQPEPEPEPEPEPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPE-PEPEPEPEPE 324

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE P+ +P P PQP+P P+P P
Sbjct: 325 PEPEPEPEPE-PEPEPEPEPQPEPEPEPEP 353

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/92 (45%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ +PE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 282 EPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 341

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 342 EPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQP 373

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 310 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQP 369

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE P+ +P P P+P+P P+P P
Sbjct: 370 EPQPEPEPEPE-PQPEPQPEPEPEPEPEPEP 399

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   EPE   EPE +P+ +P P P
Sbjct: 314 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQP 373

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  +PE P+ +P P P+P+P P+P P
Sbjct: 374 EPEPEPEPQPE-PQPEPEPEPEPEPEPEPEP 403

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 38/90 (42%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +P+   +P+   +P+ Q +P+P+   EPE   EPE +P+ +P P PEP
Sbjct: 274 EPEPEPEPEPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 333

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 334 EPEPEPEPEPQPEPEPEPEPEPEPEPEPEP 363

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 42/90 (46%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+ EPE   EP    EPE P+ + +P+P+   EPE   EP+ P+ +P P PEP
Sbjct: 336 EPEPEPEPQPEPEPEPEPEPEPEPE-PEPEPEPQPEPQPEPEPEPEPQ-PEPQPEPEPEP 393

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 394 EPEPEPEPEPEPEPQPEPQPEPEPQPEPQP 423

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EP+ +P+ + +P+P+   EPE   EPE P+ +P P PE
Sbjct: 348 EPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQPEPEPEPEPE-PEPEPEPEPE 406

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE +P+ +P P PQP+P P+P P
Sbjct: 407 PQPEPQPEPEPQPEPQPDPEPQPEPGPEPGP 437

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           L P P P+P    +P+   +P+   +P+ Q +P+P+   EPE   EPE P+ +P P PEP
Sbjct: 259 LRPHPYPEPHPGPQPEPEPEPEPEPQPEPQPEPQPEPQPEPEPQPEPE-PEPEPEPEPEP 317

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P PQP P
Sbjct: 318 EPEPEPEPEPEPEPEPEPEPEPEPEPQPEP 347

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/90 (47%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+ EPE   EP    EPE P+ Q +P+P+   EPE   EPE P+ +P P PEP
Sbjct: 354 EPEPEPEPEPEPEPQPEPQPEPEPE-PEPQPEPQPEPEPEPEPEPEPE-PEPEPEPQPEP 411

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  +PE +P  +P P P P+P P+P P
Sbjct: 412 QPEPEPQPEPQPDPEPQPEPGPEPGPEPEP 441

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 41/91 (45%), Positives = 57/91 (62%), Gaps = 5/91 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPP 206
           EP P P+P EPE   EP    EPE +P+ + +P+P+   +PE   EPE   +P+  P P 
Sbjct: 370 EPQPEPEP-EPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQPDPEPQ 428

Query: 207 PEPKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           PEP PEP  EPE +P+ +P P P+P+P P+P
Sbjct: 429 PEPGPEPGPEPEPEPQLEPQPEPEPEPQPEP 459

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/97 (42%), Positives = 59/97 (60%), Gaps = 7/97 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE---KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPP 200
           EP P P+P +PE   EP    EPE   +P+ + +P+P+   E E   EPE   +P  +P 
Sbjct: 420 EPQPDPEP-QPEPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQ 478

Query: 201 PPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
           P PEP+PEP  EPE +P+ +P P P+P+P P+P P +
Sbjct: 479 PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEL 515

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 42/102 (41%), Positives = 58/102 (56%), Gaps = 14/102 (13%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   +PE   +PE +P+  P P P
Sbjct: 378 EPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQPDPEPQPEPGPEPGP 437

Query: 210 EPKPEPPKEPEKPKEKPP-----------PPPQPQPMPQPPP 302
           EP+PEP  EP+   E  P           P P+PQP+P+P P
Sbjct: 438 EPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQP 479

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 40/93 (43%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
           EP P P+P+ +PE   EP     PE +P+ Q +P+P+   EP+   E E   +P+ +P P
Sbjct: 414 EPEPQPEPQPDPEPQPEPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQP 473

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PEP+PEP  EPE P+ +P P P+P+P P+P P
Sbjct: 474 LPEPQPEPEPEPE-PEPEPEPEPEPEPEPEPEP 505

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 39/94 (41%), Positives = 57/94 (60%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    +PE +P+ + +P+P+   EPE   EP+ +P+ +P P P
Sbjct: 364 EPEPQPEPQPEPEPEPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQP 423

Query: 210 EPKPEPPKEPEKPKEKPPPP---PQPQPMPQPPP 302
           +P+P+P   PE   E  P P   PQP+P P+P P
Sbjct: 424 DPEPQPEPGPEPGPEPEPEPQLEPQPEPEPEPQP 457

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/99 (41%), Positives = 56/99 (56%), Gaps = 11/99 (11%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   +P    EPE +P+ Q  P+P+    PE   EPE P+ +  P PE
Sbjct: 392 EPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQPDPEPQPEPGPEPGPEPE-PEPQLEPQPE 450

Query: 213 PKPEPPKEPE---------KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE         +P+  P P P+P+P P+P P
Sbjct: 451 PEPEPQPEPESELDLEPEPEPQPLPEPQPEPEPEPEPEP 489

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 12/100 (12%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEK---PKEQEKPKPKKPKEPEKPKEPEKPKE----- 191
           EP P P+P+ EPE   EP    EP+    P+   +P+P+   EP+   EPE   E     
Sbjct: 404 EPEPQPEPQPEPEPQPEPQPDPEPQPEPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESEL 463

Query: 192 --KPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
             +P P P+P PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 464 DLEPEPEPQPLPEPQPEPEPEPEPEPEPEPEPEPEPEPEP 503

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 34/90 (37%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+P+     +  ++P    +P    +P+P+   EPE   EP+ +P+ +P P PEP
Sbjct: 242 QPEPQPEPRLHPFHRLRLRPHPYPEPHPGPQPEPEPEPEPEPQPEPQPEPQPEPQPEPEP 301

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 302 QPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 331

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP---EKPKEKPPPPP 209
           +P P P+P    +P    +P+   +P+ Q +P+P   ++P     P    +P+ +P P P
Sbjct: 84  QPLPQPQPLPEPQPLPEPEPQPQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQPEPEPQP 143

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EP+ +P+ +P P PQP+P PQP P
Sbjct: 144 EPQPEPQPEPQPEPQPEPQPEPQPEPQPQPQP 175

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 39/112 (34%), Positives = 59/112 (52%), Gaps = 22/112 (19%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEP---------EKPKEPEKP 185
           EP P P+P+ +PE   EP    +PE +P+ Q +P+P   ++P          +P+   +P
Sbjct: 140 EPQPEPQPEPQPEPQPEPQPEPQPEPQPEPQPQPQPLAGRQPLPWPLPLPLPEPQPDPQP 199

Query: 186 KEKPPPPPEPKPEPPKEPE-----------KPKEKPPPPPQPQPMPQPPPHI 308
             +P P PEP+PEP  +P+           +PK +P P P PQP PQP P +
Sbjct: 200 DPQPEPQPEPQPEPQPQPQTPGQVQAGRQPRPKPQPDPHPHPQPEPQPEPRL 251

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P P+   +P+  + P    + +    P+P    +PE   EPE P+ +P P PEP+
Sbjct: 234 QPDPHPHPQPEPQPEPRLHPFHRLRLRPHPYPEPHPGPQPEPEPEPE-PEPQPEPQPEPQ 292

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 293 PEPQPEPEPQPEPEPEPEPEPEPEPEPEP 321

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 38/92 (41%), Positives = 53/92 (57%), Gaps = 2/92 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPP-PPPEP 215
           P P P+P EPE   EP    +PE +P+ Q +P+P+   EP+   +P   ++  P P P P
Sbjct: 131 PLPQPQP-EPEPQPEPQPEPQPEPQPEPQPEPQPEPQPEPQPQPQPLAGRQPLPWPLPLP 189

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PEP  +P+ P  +P P P+PQP PQP P  P
Sbjct: 190 LPEPQPDPQ-PDPQPEPQPEPQPEPQPQPQTP 220

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 24/112 (21%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE------------- 179
           EP P P+P+   +P+ P + +   +P+ + +P P    +PE   EP              
Sbjct: 204 EPQPEPQPEPQPQPQTPGQVQAGRQPRPKPQPDPHPHPQPEPQPEPRLHPFHRLRLRPHP 263

Query: 180 --------KPKEKPPPPPEPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
                   +P+ +P P PEP+PEP  EP+   +P+ +P P P+P+P P+P P
Sbjct: 264 YPEPHPGPQPEPEPEPEPEPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPEP 315

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 32/88 (36%), Positives = 52/88 (59%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+P+   +P+   +P+   +P+ Q +P+P+ P    +P     P   P P PEP+
Sbjct: 82  QPQPLPQPQPLPEPQPLPEPEPQPQPQPQPQPQPQ-PLAGRQPLPQPLPWPLPQPQPEPE 140

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+P  +PE P+ +P P PQP+P P+P P
Sbjct: 141 PQPEPQPE-PQPEPQPEPQPEPQPEPQP 167

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 36/92 (39%), Positives = 55/92 (59%), Gaps = 1/92 (1%)
 Frame = +3

Query: 30  EILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP 209
           ++    P P P +P+   EP    EPE P+ Q +P+P+   +P   ++P  P+  P P P
Sbjct: 77  DVFSSQPQPLP-QPQPLPEPQPLPEPE-PQPQPQPQPQPQPQPLAGRQP-LPQPLPWPLP 133

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+PEP  +PE +P+ +P P P+PQP PQP P
Sbjct: 134 QPQPEPEPQPEPQPEPQPEPQPEPQPEPQPEP 165

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/92 (43%), Positives = 52/92 (56%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQE-----KPKPKKPKEPEKPKEPEKPKEKPP 200
           EP P P P+ EPE   EP    EPE   E E     +P+P+    PE   EPE P+ +P 
Sbjct: 430 EPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQPEPE-PEPEPE 488

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           P PEP+PEP  EPE P+ +P P P+P+   +P
Sbjct: 489 PEPEPEPEPEPEPE-PEPEPEPEPEPELELEP 519

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/96 (41%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPK---EPEKPKEPVKPKEPEKPKEQE-KPKPKKPKEPEKPKEPEKPKEKPPPP 206
           EP P P+P+   EP+   EP    EPE   + E +P+P+   EP+   EPE P+ +P P 
Sbjct: 434 EPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQPEPEPE-PEPEPEPE 492

Query: 207 PEPKPEPPKEPEKPKEKPPPPP----QPQPMPQPPP 302
           PEP+PEP  EPE P+ +P P P    +PQ   +P P
Sbjct: 493 PEPEPEPEPEPE-PEPEPEPEPELELEPQSQLEPQP 527

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 41/87 (47%), Positives = 51/87 (58%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           LEP P P+P EP+   E     EPE P+ Q  P+P+   EPE   EPE P+ +P P PEP
Sbjct: 445 LEPQPEPEP-EPQPEPESELDLEPE-PEPQPLPEPQPEPEPEPEPEPE-PEPEPEPEPEP 501

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PEP  EPE P+ +    PQ Q  PQP
Sbjct: 502 EPEPEPEPE-PEPELELEPQSQLEPQP 527

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 29/117 (24%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEP-------EKPKEQEKPKPKKPKEPEKPKEPEKPKEK 194
           EP P P+P+ +P+   +P+  ++P         P+ Q +P+P+   +PE   EP+ P+ +
Sbjct: 100 EPEPQPQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQPEPEPQPEPQPEPQPEPQ-PEPQ 158

Query: 195 PPPPPEPKPEPPKEPEK---------------------PKEKPPPPPQPQPMPQPPP 302
           P P PEP+PEP  +P+                      P+  P P PQP+P P+P P
Sbjct: 159 PEPQPEPQPEPQPQPQPLAGRQPLPWPLPLPLPEPQPDPQPDPQPEPQPEPQPEPQP 215

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 36/91 (39%), Positives = 52/91 (57%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +P+   +P+       Q  P+P     P+   EPE +P+ +P P PEP
Sbjct: 94  EPQPLPEPEPQPQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQPEPEPQPEPQPEPQPEP 153

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMP--QPPP 302
           +PEP  EP+ P+ +P P PQPQP+   QP P
Sbjct: 154 QPEPQPEPQ-PEPQPEPQPQPQPLAGRQPLP 183

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 31/102 (30%), Positives = 52/102 (50%), Gaps = 15/102 (14%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P P+    P+   +P+   +P+ + +P+P+ P + +  ++P +PK +P P P P+P
Sbjct: 185 PLPLPLPEPQPDPQPDPQPEPQPEPQPEPQPQPQTPGQVQAGRQP-RPKPQPDPHPHPQP 243

Query: 222 EPPKEPE---------------KPKEKPPPPPQPQPMPQPPP 302
           EP  EP                +P   P P P+P+P P+P P
Sbjct: 244 EPQPEPRLHPFHRLRLRPHPYPEPHPGPQPEPEPEPEPEPQP 285

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 24/112 (21%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKP---------KEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE--- 179
           EP P P+P    +P          EP    +P+ +P+ Q +P+P+   +P+ P + +   
Sbjct: 168 EPQPQPQPLAGRQPLPWPLPLPLPEPQPDPQPDPQPEPQPEPQPEPQPQPQTPGQVQAGR 227

Query: 180 --KPKEKPPPPPEPKPEPPKEPE---------KPKEKPPPPPQPQPMPQPPP 302
             +PK +P P P P+PEP  EP          +P   P P P PQP P+P P
Sbjct: 228 QPRPKPQPDPHPHPQPEPQPEPRLHPFHRLRLRPHPYPEPHPGPQPEPEPEP 279

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/104 (34%), Positives = 53/104 (50%), Gaps = 16/104 (15%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPK--EPVKPKEPEKPKE------------QEKPKPKKPKEPEKPKE 173
           +P P P+P   PE P   + V   +P+   E            Q  P+P+   EP+   E
Sbjct: 41  QPQPVPQPLIPPESPAGDDVVFDSQPQPQSESPGHDDVFSSQPQPLPQPQPLPEPQPLPE 100

Query: 174 PE-KPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PE +P+ +P P P+P+P   ++P  P+  P P PQPQP P+P P
Sbjct: 101 PEPQPQPQPQPQPQPQPLAGRQP-LPQPLPWPLPQPQPEPEPQP 143

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 36/115 (31%), Positives = 52/115 (45%), Gaps = 26/115 (22%)
 Frame = +3

Query: 36  LEPPPPPKPK-----EPEKPKEPVKPKEPEKPK-------EQEKPKPKKPKEPEKPKEPE 179
           LE  PP + K     +P+   +P+ P  PE P         Q +P+ + P   +      
Sbjct: 26  LENKPPAQDKVVFGPQPQPVPQPLIP--PESPAGDDVVFDSQPQPQSESPGHDDVFSSQP 83

Query: 180 KPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQ--------------PMPQPPP 302
           +P  +P P PEP+P P  EP+ P+ +P P PQPQ              P+PQP P
Sbjct: 84  QPLPQPQPLPEPQPLPEPEPQ-PQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQP 137

[101][TOP]
>UniRef100_Q9JLE9 GABA-A receptor epsilon-like subunit n=1 Tax=Rattus norvegicus
           RepID=Q9JLE9_RAT
          Length = 989

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 45/90 (50%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   EPE   EP+ P+ +P P PE
Sbjct: 338 EPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQ-PEPEPEPEPE 396

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE P+ +P P P+PQP PQP P
Sbjct: 397 PEPEPEPEPE-PQPEPQPEPEPQPEPQPDP 425

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 45/89 (50%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P EPE   EP    EPE P+ + +P+P+   EPE   EPE +P+ +P P PEP
Sbjct: 290 EPQPEPQP-EPEPQPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEP 347

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE P+ +P P P+PQP PQP P
Sbjct: 348 EPEPEPEPE-PEPEPEPEPEPQPEPQPEP 375

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 294 EPQPEPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEP 353

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P PQP P
Sbjct: 354 EPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEP 385

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EP+ +P+ +P P P
Sbjct: 324 EPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQP 383

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+PQP PQP P
Sbjct: 384 EPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEP 415

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EP+   EPE +P+ +P P P
Sbjct: 330 EPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQPEP 389

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P PQP+P PQP P
Sbjct: 390 EPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEP 421

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE P+ +P P PE
Sbjct: 300 EPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPE-PEPEPEPEPE 358

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EP+ +P+ +P P P+PQP PQP P
Sbjct: 359 PEPEPEPEPQPEPQPEPEPEPEPQPEPQPEP 389

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 306 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEP 365

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE P+ +P P PQP+P P+P P
Sbjct: 366 EPQPEPQPEPE-PEPEPQPEPQPEPEPEPEP 395

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 44/94 (46%), Positives = 61/94 (64%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE   +P+ +P P
Sbjct: 318 EPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEP 377

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            PEP+PEP  EPE +P+ +P P P+P+P PQP P
Sbjct: 378 EPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEP 411

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 44/91 (48%), Positives = 59/91 (64%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   +PE   EPE P+ +P P PE
Sbjct: 342 EPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQPEPE-PEPEPEPEPE 400

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  +PE +P+ +P P PQP P PQP P
Sbjct: 401 PEPEPEPQPEPQPEPEPQPEPQPDPEPQPEP 431

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/90 (48%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    +PE +P+ Q +P+P+   EPE   EPE P+ +P P PE
Sbjct: 266 EPHPGPQPEPEPEPEPEPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPE-PEPEPEPEPE 324

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE P+ +P P PQP+P P+P P
Sbjct: 325 PEPEPEPEPE-PEPEPEPEPQPEPEPEPEP 353

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/92 (45%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ +PE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 282 EPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 341

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 342 EPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQP 373

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 310 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQP 369

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE P+ +P P P+P+P P+P P
Sbjct: 370 EPQPEPEPEPE-PQPEPQPEPEPEPEPEPEP 399

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   EPE   EPE +P+ +P P P
Sbjct: 314 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQP 373

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  +PE P+ +P P P+P+P P+P P
Sbjct: 374 EPEPEPEPQPE-PQPEPEPEPEPEPEPEPEP 403

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 38/90 (42%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +P+   +P+   +P+ Q +P+P+   EPE   EPE +P+ +P P PEP
Sbjct: 274 EPEPEPEPEPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 333

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 334 EPEPEPEPEPQPEPEPEPEPEPEPEPEPEP 363

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 42/90 (46%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+ EPE   EP    EPE P+ + +P+P+   EPE   EP+ P+ +P P PEP
Sbjct: 336 EPEPEPEPQPEPEPEPEPEPEPEPE-PEPEPEPQPEPQPEPEPEPEPQ-PEPQPEPEPEP 393

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 394 EPEPEPEPEPEPEPQPEPQPEPEPQPEPQP 423

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EP+ +P+ + +P+P+   EPE   EPE P+ +P P PE
Sbjct: 348 EPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQPEPEPEPEPE-PEPEPEPEPE 406

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE +P+ +P P PQP+P P+P P
Sbjct: 407 PQPEPQPEPEPQPEPQPDPEPQPEPGPEPGP 437

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           L P P P+P    +P+   +P+   +P+ Q +P+P+   EPE   EPE P+ +P P PEP
Sbjct: 259 LRPHPYPEPHPGPQPEPEPEPEPEPQPEPQPEPQPEPQPEPEPQPEPE-PEPEPEPEPEP 317

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P PQP P
Sbjct: 318 EPEPEPEPEPEPEPEPEPEPEPEPEPQPEP 347

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/90 (47%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+ EPE   EP    EPE P+ Q +P+P+   EPE   EPE P+ +P P PEP
Sbjct: 354 EPEPEPEPEPEPEPQPEPQPEPEPE-PEPQPEPQPEPEPEPEPEPEPE-PEPEPEPQPEP 411

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  +PE +P  +P P P P+P P+P P
Sbjct: 412 QPEPEPQPEPQPDPEPQPEPGPEPGPEPEP 441

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 41/91 (45%), Positives = 57/91 (62%), Gaps = 5/91 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPP 206
           EP P P+P EPE   EP    EPE +P+ + +P+P+   +PE   EPE   +P+  P P 
Sbjct: 370 EPQPEPEP-EPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQPDPEPQ 428

Query: 207 PEPKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           PEP PEP  EPE +P+ +P P P+P+P P+P
Sbjct: 429 PEPGPEPGPEPEPEPQLEPQPEPEPEPQPEP 459

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/97 (42%), Positives = 59/97 (60%), Gaps = 7/97 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE---KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPP 200
           EP P P+P +PE   EP    EPE   +P+ + +P+P+   E E   EPE   +P  +P 
Sbjct: 420 EPQPDPEP-QPEPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQ 478

Query: 201 PPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
           P PEP+PEP  EPE +P+ +P P P+P+P P+P P +
Sbjct: 479 PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEL 515

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 42/102 (41%), Positives = 58/102 (56%), Gaps = 14/102 (13%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   +PE   +PE +P+  P P P
Sbjct: 378 EPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQPDPEPQPEPGPEPGP 437

Query: 210 EPKPEPPKEPEKPKEKPP-----------PPPQPQPMPQPPP 302
           EP+PEP  EP+   E  P           P P+PQP+P+P P
Sbjct: 438 EPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQP 479

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 40/93 (43%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
           EP P P+P+ +PE   EP     PE +P+ Q +P+P+   EP+   E E   +P+ +P P
Sbjct: 414 EPEPQPEPQPDPEPQPEPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQP 473

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PEP+PEP  EPE P+ +P P P+P+P P+P P
Sbjct: 474 LPEPQPEPEPEPE-PEPEPEPEPEPEPEPEPEP 505

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 39/94 (41%), Positives = 57/94 (60%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    +PE +P+ + +P+P+   EPE   EP+ +P+ +P P P
Sbjct: 364 EPEPQPEPQPEPEPEPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQP 423

Query: 210 EPKPEPPKEPEKPKEKPPPP---PQPQPMPQPPP 302
           +P+P+P   PE   E  P P   PQP+P P+P P
Sbjct: 424 DPEPQPEPGPEPGPEPEPEPQLEPQPEPEPEPQP 457

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/99 (41%), Positives = 56/99 (56%), Gaps = 11/99 (11%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   +P    EPE +P+ Q  P+P+    PE   EPE P+ +  P PE
Sbjct: 392 EPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQPDPEPQPEPGPEPGPEPE-PEPQLEPQPE 450

Query: 213 PKPEPPKEPE---------KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE         +P+  P P P+P+P P+P P
Sbjct: 451 PEPEPQPEPESELDLEPEPEPQPLPEPQPEPEPEPEPEP 489

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 12/100 (12%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEK---PKEQEKPKPKKPKEPEKPKEPEKPKE----- 191
           EP P P+P+ EPE   EP    EP+    P+   +P+P+   EP+   EPE   E     
Sbjct: 404 EPEPQPEPQPEPEPQPEPQPDPEPQPEPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESEL 463

Query: 192 --KPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
             +P P P+P PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 464 DLEPEPEPQPLPEPQPEPEPEPEPEPEPEPEPEPEPEPEP 503

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 34/90 (37%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+P+     +  ++P    +P    +P+P+   EPE   EP+ +P+ +P P PEP
Sbjct: 242 QPEPQPEPRLHPFHRLRLRPHPYPEPHPGPQPEPEPEPEPEPQPEPQPEPQPEPQPEPEP 301

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 302 QPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 331

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP---EKPKEKPPPPP 209
           +P P P+P    +P    +P+   +P+ Q +P+P   ++P     P    +P+ +P P P
Sbjct: 84  QPLPQPQPLPEPQPLPEPEPQPQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQPEPEPQP 143

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EP+ +P+ +P P PQP+P PQP P
Sbjct: 144 EPQPEPQPEPQPEPQPEPQPEPQPEPQPQPQP 175

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 39/112 (34%), Positives = 59/112 (52%), Gaps = 22/112 (19%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEP---------EKPKEPEKP 185
           EP P P+P+ +PE   EP    +PE +P+ Q +P+P   ++P          +P+   +P
Sbjct: 140 EPQPEPQPEPQPEPQPEPQPEPQPEPQPEPQPQPQPLAGRQPLPWPLPLPLPEPQPDPQP 199

Query: 186 KEKPPPPPEPKPEPPKEPE-----------KPKEKPPPPPQPQPMPQPPPHI 308
             +P P PEP+PEP  +P+           +PK +P P P PQP PQP P +
Sbjct: 200 DPQPEPQPEPQPEPQPQPQTPGQVQAGRQPRPKPQPDPHPHPQPEPQPEPRL 251

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P P+   +P+  + P    + +    P+P    +PE   EPE P+ +P P PEP+
Sbjct: 234 QPDPHPHPQPEPQPEPRLHPFHRLRLRPHPYPEPHPGPQPEPEPEPE-PEPQPEPQPEPQ 292

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 293 PEPQPEPEPQPEPEPEPEPEPEPEPEPEP 321

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 38/92 (41%), Positives = 53/92 (57%), Gaps = 2/92 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPP-PPPEP 215
           P P P+P EPE   EP    +PE +P+ Q +P+P+   EP+   +P   ++  P P P P
Sbjct: 131 PLPQPQP-EPEPQPEPQPEPQPEPQPEPQPEPQPEPQPEPQPQPQPLAGRQPLPWPLPLP 189

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PEP  +P+ P  +P P P+PQP PQP P  P
Sbjct: 190 LPEPQPDPQ-PDPQPEPQPEPQPEPQPQPQTP 220

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 24/112 (21%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE------------- 179
           EP P P+P+   +P+ P + +   +P+ + +P P    +PE   EP              
Sbjct: 204 EPQPEPQPEPQPQPQTPGQVQAGRQPRPKPQPDPHPHPQPEPQPEPRLHPFHRLRLRPHP 263

Query: 180 --------KPKEKPPPPPEPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
                   +P+ +P P PEP+PEP  EP+   +P+ +P P P+P+P P+P P
Sbjct: 264 YPEPHPGPQPEPEPEPEPEPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPEP 315

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 32/88 (36%), Positives = 52/88 (59%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+P+   +P+   +P+   +P+ Q +P+P+ P    +P     P   P P PEP+
Sbjct: 82  QPQPLPQPQPLPEPQPLPEPEPQPQPQPQPQPQPQ-PLAGRQPLPQPLPWPLPQPQPEPE 140

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+P  +PE P+ +P P PQP+P P+P P
Sbjct: 141 PQPEPQPE-PQPEPQPEPQPEPQPEPQP 167

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 36/92 (39%), Positives = 55/92 (59%), Gaps = 1/92 (1%)
 Frame = +3

Query: 30  EILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP 209
           ++    P P P +P+   EP    EPE P+ Q +P+P+   +P   ++P  P+  P P P
Sbjct: 77  DVFSSQPQPLP-QPQPLPEPQPLPEPE-PQPQPQPQPQPQPQPLAGRQP-LPQPLPWPLP 133

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+PEP  +PE +P+ +P P P+PQP PQP P
Sbjct: 134 QPQPEPEPQPEPQPEPQPEPQPEPQPEPQPEP 165

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/92 (43%), Positives = 52/92 (56%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQE-----KPKPKKPKEPEKPKEPEKPKEKPP 200
           EP P P P+ EPE   EP    EPE   E E     +P+P+    PE   EPE P+ +P 
Sbjct: 430 EPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQPEPE-PEPEPE 488

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           P PEP+PEP  EPE P+ +P P P+P+   +P
Sbjct: 489 PEPEPEPEPEPEPE-PEPEPEPEPEPELELEP 519

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/96 (41%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPK---EPEKPKEPVKPKEPEKPKEQE-KPKPKKPKEPEKPKEPEKPKEKPPPP 206
           EP P P+P+   EP+   EP    EPE   + E +P+P+   EP+   EPE P+ +P P 
Sbjct: 434 EPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQPEPEPE-PEPEPEPE 492

Query: 207 PEPKPEPPKEPEKPKEKPPPPP----QPQPMPQPPP 302
           PEP+PEP  EPE P+ +P P P    +PQ   +P P
Sbjct: 493 PEPEPEPEPEPE-PEPEPEPEPELELEPQSQLEPQP 527

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 41/87 (47%), Positives = 51/87 (58%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           LEP P P+P EP+   E     EPE P+ Q  P+P+   EPE   EPE P+ +P P PEP
Sbjct: 445 LEPQPEPEP-EPQPEPESELDLEPE-PEPQPLPEPQPEPEPEPEPEPE-PEPEPEPEPEP 501

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PEP  EPE P+ +    PQ Q  PQP
Sbjct: 502 EPEPEPEPE-PEPELELEPQSQLEPQP 527

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 29/117 (24%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEP-------EKPKEQEKPKPKKPKEPEKPKEPEKPKEK 194
           EP P P+P+ +P+   +P+  ++P         P+ Q +P+P+   +PE   EP+ P+ +
Sbjct: 100 EPEPQPQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQPEPEPQPEPQPEPQPEPQ-PEPQ 158

Query: 195 PPPPPEPKPEPPKEPEK---------------------PKEKPPPPPQPQPMPQPPP 302
           P P PEP+PEP  +P+                      P+  P P PQP+P P+P P
Sbjct: 159 PEPQPEPQPEPQPQPQPLAGRQPLPWPLPLPLPEPQPDPQPDPQPEPQPEPQPEPQP 215

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 36/91 (39%), Positives = 52/91 (57%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +P+   +P+       Q  P+P     P+   EPE +P+ +P P PEP
Sbjct: 94  EPQPLPEPEPQPQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQPEPEPQPEPQPEPQPEP 153

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMP--QPPP 302
           +PEP  EP+ P+ +P P PQPQP+   QP P
Sbjct: 154 QPEPQPEPQ-PEPQPEPQPQPQPLAGRQPLP 183

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 31/102 (30%), Positives = 52/102 (50%), Gaps = 15/102 (14%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P P+    P+   +P+   +P+ + +P+P+ P + +  ++P +PK +P P P P+P
Sbjct: 185 PLPLPLPEPQPDPQPDPQPEPQPEPQPEPQPQPQTPGQVQAGRQP-RPKPQPDPHPHPQP 243

Query: 222 EPPKEPE---------------KPKEKPPPPPQPQPMPQPPP 302
           EP  EP                +P   P P P+P+P P+P P
Sbjct: 244 EPQPEPRLHPFHRLRLRPHPYPEPHPGPQPEPEPEPEPEPQP 285

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 24/112 (21%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKP---------KEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE--- 179
           EP P P+P    +P          EP    +P+ +P+ Q +P+P+   +P+ P + +   
Sbjct: 168 EPQPQPQPLAGRQPLPWPLPLPLPEPQPDPQPDPQPEPQPEPQPEPQPQPQTPGQVQAGR 227

Query: 180 --KPKEKPPPPPEPKPEPPKEPE---------KPKEKPPPPPQPQPMPQPPP 302
             +PK +P P P P+PEP  EP          +P   P P P PQP P+P P
Sbjct: 228 QPRPKPQPDPHPHPQPEPQPEPRLHPFHRLRLRPHPYPEPHPGPQPEPEPEP 279

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/104 (34%), Positives = 53/104 (50%), Gaps = 16/104 (15%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPK--EPVKPKEPEKPKE------------QEKPKPKKPKEPEKPKE 173
           +P P P+P   PE P   + V   +P+   E            Q  P+P+   EP+   E
Sbjct: 41  QPQPVPQPLIPPESPAGDDVVFDSQPQPQSESPGHDDVFSSQPQPLPQPQPLPEPQPLPE 100

Query: 174 PE-KPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PE +P+ +P P P+P+P   ++P  P+  P P PQPQP P+P P
Sbjct: 101 PEPQPQPQPQPQPQPQPLAGRQP-LPQPLPWPLPQPQPEPEPQP 143

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 36/115 (31%), Positives = 52/115 (45%), Gaps = 26/115 (22%)
 Frame = +3

Query: 36  LEPPPPPKPK-----EPEKPKEPVKPKEPEKPK-------EQEKPKPKKPKEPEKPKEPE 179
           LE  PP + K     +P+   +P+ P  PE P         Q +P+ + P   +      
Sbjct: 26  LENKPPAQDKVVFGPQPQPVPQPLIP--PESPAGDDVVFDSQPQPQSESPGHDDVFSSQP 83

Query: 180 KPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQ--------------PMPQPPP 302
           +P  +P P PEP+P P  EP+ P+ +P P PQPQ              P+PQP P
Sbjct: 84  QPLPQPQPLPEPQPLPEPEPQ-PQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQP 137

[102][TOP]
>UniRef100_Q9EQF1 GABA-A epsilon subunit splice variant (Fragment) n=1 Tax=Rattus
           norvegicus RepID=Q9EQF1_RAT
          Length = 823

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 45/90 (50%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   EPE   EP+ P+ +P P PE
Sbjct: 198 EPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQ-PEPEPEPEPE 256

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE P+ +P P P+PQP PQP P
Sbjct: 257 PEPEPEPEPE-PQPEPQPEPEPQPEPQPDP 285

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 45/89 (50%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P EPE   EP    EPE P+ + +P+P+   EPE   EPE +P+ +P P PEP
Sbjct: 150 EPQPEPQP-EPEPQPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEP 207

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE P+ +P P P+PQP PQP P
Sbjct: 208 EPEPEPEPE-PEPEPEPEPEPQPEPQPEP 235

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 154 EPQPEPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEP 213

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P PQP P
Sbjct: 214 EPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEP 245

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EP+ +P+ +P P P
Sbjct: 184 EPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQP 243

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+PQP PQP P
Sbjct: 244 EPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEP 275

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EP+   EPE +P+ +P P P
Sbjct: 190 EPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQPEP 249

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P PQP+P PQP P
Sbjct: 250 EPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEP 281

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE P+ +P P PE
Sbjct: 160 EPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPE-PEPEPEPEPE 218

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EP+ +P+ +P P P+PQP PQP P
Sbjct: 219 PEPEPEPEPQPEPQPEPEPEPEPQPEPQPEP 249

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 166 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEP 225

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE P+ +P P PQP+P P+P P
Sbjct: 226 EPQPEPQPEPE-PEPEPQPEPQPEPEPEPEP 255

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 44/94 (46%), Positives = 61/94 (64%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE   +P+ +P P
Sbjct: 178 EPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEP 237

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            PEP+PEP  EPE +P+ +P P P+P+P PQP P
Sbjct: 238 EPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEP 271

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 44/91 (48%), Positives = 59/91 (64%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   +PE   EPE P+ +P P PE
Sbjct: 202 EPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQPEPE-PEPEPEPEPE 260

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  +PE +P+ +P P PQP P PQP P
Sbjct: 261 PEPEPEPQPEPQPEPEPQPEPQPDPEPQPEP 291

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/90 (48%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    +PE +P+ Q +P+P+   EPE   EPE P+ +P P PE
Sbjct: 126 EPHPGPQPEPEPEPEPEPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPE-PEPEPEPEPE 184

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE P+ +P P PQP+P P+P P
Sbjct: 185 PEPEPEPEPE-PEPEPEPEPQPEPEPEPEP 213

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/92 (45%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ +PE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 142 EPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 201

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 202 EPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQP 233

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 170 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQP 229

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE P+ +P P P+P+P P+P P
Sbjct: 230 EPQPEPEPEPE-PQPEPQPEPEPEPEPEPEP 259

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   EPE   EPE +P+ +P P P
Sbjct: 174 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQP 233

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  +PE P+ +P P P+P+P P+P P
Sbjct: 234 EPEPEPEPQPE-PQPEPEPEPEPEPEPEPEP 263

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 38/90 (42%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +P+   +P+   +P+ Q +P+P+   EPE   EPE +P+ +P P PEP
Sbjct: 134 EPEPEPEPEPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 193

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 194 EPEPEPEPEPQPEPEPEPEPEPEPEPEPEP 223

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 42/90 (46%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+ EPE   EP    EPE P+ + +P+P+   EPE   EP+ P+ +P P PEP
Sbjct: 196 EPEPEPEPQPEPEPEPEPEPEPEPE-PEPEPEPQPEPQPEPEPEPEPQ-PEPQPEPEPEP 253

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 254 EPEPEPEPEPEPEPQPEPQPEPEPQPEPQP 283

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EP+ +P+ + +P+P+   EPE   EPE P+ +P P PE
Sbjct: 208 EPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQPEPEPEPEPE-PEPEPEPEPE 266

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE +P+ +P P PQP+P P+P P
Sbjct: 267 PQPEPQPEPEPQPEPQPDPEPQPEPGPEPGP 297

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           L P P P+P    +P+   +P+   +P+ Q +P+P+   EPE   EPE P+ +P P PEP
Sbjct: 119 LRPHPYPEPHPGPQPEPEPEPEPEPQPEPQPEPQPEPQPEPEPQPEPE-PEPEPEPEPEP 177

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P PQP P
Sbjct: 178 EPEPEPEPEPEPEPEPEPEPEPEPEPQPEP 207

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/90 (47%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+ EPE   EP    EPE P+ Q +P+P+   EPE   EPE P+ +P P PEP
Sbjct: 214 EPEPEPEPEPEPEPQPEPQPEPEPE-PEPQPEPQPEPEPEPEPEPEPE-PEPEPEPQPEP 271

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  +PE +P  +P P P P+P P+P P
Sbjct: 272 QPEPEPQPEPQPDPEPQPEPGPEPGPEPEP 301

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 41/91 (45%), Positives = 57/91 (62%), Gaps = 5/91 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPP 206
           EP P P+P EPE   EP    EPE +P+ + +P+P+   +PE   EPE   +P+  P P 
Sbjct: 230 EPQPEPEP-EPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQPDPEPQ 288

Query: 207 PEPKPEPPKEPE-KPKEKPPPPPQPQPMPQP 296
           PEP PEP  EPE +P+ +P P P+P+P P+P
Sbjct: 289 PEPGPEPGPEPEPEPQLEPQPEPEPEPQPEP 319

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/97 (42%), Positives = 59/97 (60%), Gaps = 7/97 (7%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE---KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPP 200
           EP P P+P +PE   EP    EPE   +P+ + +P+P+   E E   EPE   +P  +P 
Sbjct: 280 EPQPDPEP-QPEPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQ 338

Query: 201 PPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
           P PEP+PEP  EPE +P+ +P P P+P+P P+P P +
Sbjct: 339 PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEL 375

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 42/102 (41%), Positives = 58/102 (56%), Gaps = 14/102 (13%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   +PE   +PE +P+  P P P
Sbjct: 238 EPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQPDPEPQPEPGPEPGP 297

Query: 210 EPKPEPPKEPEKPKEKPP-----------PPPQPQPMPQPPP 302
           EP+PEP  EP+   E  P           P P+PQP+P+P P
Sbjct: 298 EPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQP 339

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 40/93 (43%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
           EP P P+P+ +PE   EP     PE +P+ Q +P+P+   EP+   E E   +P+ +P P
Sbjct: 274 EPEPQPEPQPDPEPQPEPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQP 333

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PEP+PEP  EPE P+ +P P P+P+P P+P P
Sbjct: 334 LPEPQPEPEPEPE-PEPEPEPEPEPEPEPEPEP 365

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 39/94 (41%), Positives = 57/94 (60%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    +PE +P+ + +P+P+   EPE   EP+ +P+ +P P P
Sbjct: 224 EPEPQPEPQPEPEPEPEPQPEPQPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQP 283

Query: 210 EPKPEPPKEPEKPKEKPPPP---PQPQPMPQPPP 302
           +P+P+P   PE   E  P P   PQP+P P+P P
Sbjct: 284 DPEPQPEPGPEPGPEPEPEPQLEPQPEPEPEPQP 317

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/99 (41%), Positives = 56/99 (56%), Gaps = 11/99 (11%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   +P    EPE +P+ Q  P+P+    PE   EPE P+ +  P PE
Sbjct: 252 EPEPEPEPEPEPEPEPQPEPQPEPEPQPEPQPDPEPQPEPGPEPGPEPE-PEPQLEPQPE 310

Query: 213 PKPEPPKEPE---------KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE         +P+  P P P+P+P P+P P
Sbjct: 311 PEPEPQPEPESELDLEPEPEPQPLPEPQPEPEPEPEPEP 349

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 12/100 (12%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEK---PKEQEKPKPKKPKEPEKPKEPEKPKE----- 191
           EP P P+P+ EPE   EP    EP+    P+   +P+P+   EP+   EPE   E     
Sbjct: 264 EPEPQPEPQPEPEPQPEPQPDPEPQPEPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESEL 323

Query: 192 --KPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
             +P P P+P PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 324 DLEPEPEPQPLPEPQPEPEPEPEPEPEPEPEPEPEPEPEP 363

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 34/90 (37%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+P+     +  ++P    +P    +P+P+   EPE   EP+ +P+ +P P PEP
Sbjct: 102 QPEPQPEPRLHPFHRLRLRPHPYPEPHPGPQPEPEPEPEPEPQPEPQPEPQPEPQPEPEP 161

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 162 QPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 191

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P P+   +P+  + P    + +    P+P    +PE   EPE P+ +P P PEP+
Sbjct: 94  QPDPHPHPQPEPQPEPRLHPFHRLRLRPHPYPEPHPGPQPEPEPEPE-PEPQPEPQPEPQ 152

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 153 PEPQPEPEPQPEPEPEPEPEPEPEPEPEP 181

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 20/110 (18%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEP---------EKPKEPEKPKE 191
           +P P P+P+   +P+   +P+   +P+ Q +P+P   ++P          +P+   +P  
Sbjct: 2   QPEPQPEPQPEPQPEPQPEPQPEPQPEPQPQPQPLAGRQPLPWPLPLPLPEPQPDPQPDP 61

Query: 192 KPPPPPEPKPEPPKEPE-----------KPKEKPPPPPQPQPMPQPPPHI 308
           +P P PEP+PEP  +P+           +PK +P P P PQP PQP P +
Sbjct: 62  QPEPQPEPQPEPQPQPQTPGQVQAGRQPRPKPQPDPHPHPQPEPQPEPRL 111

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 24/112 (21%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE------------- 179
           EP P P+P+   +P+ P + +   +P+ + +P P    +PE   EP              
Sbjct: 64  EPQPEPQPEPQPQPQTPGQVQAGRQPRPKPQPDPHPHPQPEPQPEPRLHPFHRLRLRPHP 123

Query: 180 --------KPKEKPPPPPEPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
                   +P+ +P P PEP+PEP  EP+   +P+ +P P P+P+P P+P P
Sbjct: 124 YPEPHPGPQPEPEPEPEPEPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPEP 175

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/92 (43%), Positives = 52/92 (56%), Gaps = 6/92 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQE-----KPKPKKPKEPEKPKEPEKPKEKPP 200
           EP P P P+ EPE   EP    EPE   E E     +P+P+    PE   EPE P+ +P 
Sbjct: 290 EPGPEPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQPEPE-PEPEPE 348

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           P PEP+PEP  EPE P+ +P P P+P+   +P
Sbjct: 349 PEPEPEPEPEPEPE-PEPEPEPEPEPELELEP 379

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/96 (41%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPK---EPEKPKEPVKPKEPEKPKEQE-KPKPKKPKEPEKPKEPEKPKEKPPPP 206
           EP P P+P+   EP+   EP    EPE   + E +P+P+   EP+   EPE P+ +P P 
Sbjct: 294 EPGPEPEPEPQLEPQPEPEPEPQPEPESELDLEPEPEPQPLPEPQPEPEPE-PEPEPEPE 352

Query: 207 PEPKPEPPKEPEKPKEKPPPPP----QPQPMPQPPP 302
           PEP+PEP  EPE P+ +P P P    +PQ   +P P
Sbjct: 353 PEPEPEPEPEPE-PEPEPEPEPELELEPQSQLEPQP 387

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 41/87 (47%), Positives = 51/87 (58%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           LEP P P+P EP+   E     EPE P+ Q  P+P+   EPE   EPE P+ +P P PEP
Sbjct: 305 LEPQPEPEP-EPQPEPESELDLEPE-PEPQPLPEPQPEPEPEPEPEPE-PEPEPEPEPEP 361

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           +PEP  EPE P+ +    PQ Q  PQP
Sbjct: 362 EPEPEPEPE-PEPELELEPQSQLEPQP 387

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 31/102 (30%), Positives = 52/102 (50%), Gaps = 15/102 (14%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P P+    P+   +P+   +P+ + +P+P+ P + +  ++P +PK +P P P P+P
Sbjct: 45  PLPLPLPEPQPDPQPDPQPEPQPEPQPEPQPQPQTPGQVQAGRQP-RPKPQPDPHPHPQP 103

Query: 222 EPPKEPE---------------KPKEKPPPPPQPQPMPQPPP 302
           EP  EP                +P   P P P+P+P P+P P
Sbjct: 104 EPQPEPRLHPFHRLRLRPHPYPEPHPGPQPEPEPEPEPEPQP 145

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 24/112 (21%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKP---------KEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE--- 179
           EP P P+P    +P          EP    +P+ +P+ Q +P+P+   +P+ P + +   
Sbjct: 28  EPQPQPQPLAGRQPLPWPLPLPLPEPQPDPQPDPQPEPQPEPQPEPQPQPQTPGQVQAGR 87

Query: 180 --KPKEKPPPPPEPKPEPPKEPE---------KPKEKPPPPPQPQPMPQPPP 302
             +PK +P P P P+PEP  EP          +P   P P P PQP P+P P
Sbjct: 88  QPRPKPQPDPHPHPQPEPQPEPRLHPFHRLRLRPHPYPEPHPGPQPEPEPEP 139

[103][TOP]
>UniRef100_B4U1K4 Fibronectin-binding protein FbpZ.2 n=1 Tax=Streptococcus equi
           subsp. zooepidemicus MGCS10565 RepID=B4U1K4_STREM
          Length = 482

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 43/94 (45%), Positives = 56/94 (59%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   KP+   KP+   KP+ Q KP+P+   +PE   +PE KP  +P P PEP
Sbjct: 284 EPKPEPEPKPEPKPEPQPKPEPQPKPEPQPKPEPQPKPDPELKPDPEPKPDPEPKPDPEP 343

Query: 216 KPEPPKEPEK-----PKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE      P+ KP P P+P P P+P P
Sbjct: 344 KPEPQPKPEPQPKPDPELKPDPEPKPDPEPKPDP 377

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 41/90 (45%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+PK   +PK   KP+   KP+ Q KP+P+   EP+   +PE KP  +P P PEP
Sbjct: 278 EPKPDPEPKPEPEPKPEPKPEPQPKPEPQPKPEPQPKPEPQPKPDPELKPDPEPKPDPEP 337

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KP+P  +PE +PK +P P P P+  P P P
Sbjct: 338 KPDPEPKPEPQPKPEPQPKPDPELKPDPEP 367

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 4/93 (4%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           L+P P PKP    KP    KP+   KP+ Q KP P+   +PE   +PE KP  +P P P+
Sbjct: 325 LKPDPEPKPDPEPKPDPEPKPEPQPKPEPQPKPDPELKPDPEPKPDPEPKPDPEPKPEPQ 384

Query: 213 PKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
           PKP+P  +P+   KP  +P P P+P+P PQP P
Sbjct: 385 PKPDPELKPDPEPKPDPEPKPDPEPKPEPQPKP 417

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPK 218
           P P P+PK   +PK   +PK   KP+ Q KP+P+   EP+   EP+ KP  +  P PEPK
Sbjct: 273 PKPEPEPKPDPEPKPEPEPKPEPKPEPQPKPEPQPKPEPQPKPEPQPKPDPELKPDPEPK 332

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           P+P  +P+ P+ KP P P+P+P P+P P +
Sbjct: 333 PDPEPKPD-PEPKPEPQPKPEPQPKPDPEL 361

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 41/96 (42%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           E  PP KPK    PK   +PK   +PK + +PKP+   EP+   EP+ KP+ +P P P+P
Sbjct: 260 EAGPPEKPKLDPAPKPEPEPKPDPEPKPEPEPKPEPKPEPQPKPEPQPKPEPQPKPEPQP 319

Query: 216 KPEP-------PKEPEKPKEKPPPPPQPQPMPQPPP 302
           KP+P       PK   +PK  P P P+PQP P+P P
Sbjct: 320 KPDPELKPDPEPKPDPEPKPDPEPKPEPQPKPEPQP 355

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 41/87 (47%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP+   KP   +KP    KP  + KP P+   EP+   +PE KP  +P P PEP
Sbjct: 344 KPEPQPKPEPQPKPDPELKPDPEPKPDPEPKPDPEPKPEPQPKPDPELKPDPEPKPDPEP 403

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQP 296
           KP+P  EP KP+ +P P PQP+P PQP
Sbjct: 404 KPDP--EP-KPEPQPKPEPQPKPAPQP 427

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 38/91 (41%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP+   KP+   KP    KP  + KP P+   +PE   EP+ KP+ +P P PE 
Sbjct: 302 KPEPQPKPEPQPKPEPQPKPDPELKPDPEPKPDPEPKPDPEPKPEPQPKPEPQPKPDPEL 361

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           KP+P  +P+ P+ KP P P+P+P P+P P +
Sbjct: 362 KPDPEPKPD-PEPKPDPEPKPEPQPKPDPEL 391

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 42/96 (43%), Positives = 58/96 (60%), Gaps = 8/96 (8%)
 Frame = +3

Query: 39  EPPPPPKPK---EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPP 203
           EP P P P+   +PE   +P    +PE KP+ Q KP+P+   +PE   +PE KP  +P P
Sbjct: 316 EPQPKPDPELKPDPEPKPDPEPKPDPEPKPEPQPKPEPQPKPDPELKPDPEPKPDPEPKP 375

Query: 204 PPEPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
            PEPKPEP  +P+   KP  +P P P+P+P P+P P
Sbjct: 376 DPEPKPEPQPKPDPELKPDPEPKPDPEPKPDPEPKP 411

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 40/94 (42%), Positives = 52/94 (55%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP    KP    KP    KP  + KP+P+   EP+   +PE KP  +P P PEP
Sbjct: 314 KPEPQPKPDPELKPDPEPKPDPEPKPDPEPKPEPQPKPEPQPKPDPELKPDPEPKPDPEP 373

Query: 216 KPEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
           KP+P  +PE      P+ KP P P+P P P+P P
Sbjct: 374 KPDPEPKPEPQPKPDPELKPDPEPKPDPEPKPDP 407

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/92 (41%), Positives = 53/92 (57%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK---PKEKPPPPP 209
           +P P PKP+   KP   +KP    KP  + KP P+   EP+   EP+    P+ KP P P
Sbjct: 308 KPEPQPKPEPQPKPDPELKPDPEPKPDPEPKPDPEPKPEPQPKPEPQPKPDPELKPDPEP 367

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P PEP  +PE KP+ +P P P+ +P P+P P
Sbjct: 368 KPDPEPKPDPEPKPEPQPKPDPELKPDPEPKP 399

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 42/91 (46%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = +3

Query: 48  PPPKPKEPEKPKEPV----KPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           P P P E  + K P     +   PEKPK    PKP    EPE   +PE PK +P P PEP
Sbjct: 241 PKPLPGEDGQTKYPKGESGEAGPPEKPKLDPAPKP----EPEPKPDPE-PKPEPEPKPEP 295

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           KPEP  +PE P+ KP P P+P+P P+P P +
Sbjct: 296 KPEPQPKPE-PQPKPEPQPKPEPQPKPDPEL 325

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 45/90 (50%), Positives = 54/90 (60%), Gaps = 4/90 (4%)
 Frame = +3

Query: 45  PPPPKPKEPEK-PKEPVKPKEPEKPKEQEKPKPKKPKEPEKPK-EPE-KPKEKPPPPPEP 215
           P PP  K P+  P E  + K P K +  E   P+KPK    PK EPE KP  +P P PEP
Sbjct: 233 PKPPGGKNPKPLPGEDGQTKYP-KGESGEAGPPEKPKLDPAPKPEPEPKPDPEPKPEPEP 291

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           KPEP  EP+ KP+ +P P PQP+P PQP P
Sbjct: 292 KPEPKPEPQPKPEPQPKPEPQPKPEPQPKP 321

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 43/91 (47%), Positives = 52/91 (57%), Gaps = 10/91 (10%)
 Frame = +3

Query: 60  PKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK-------EPEKPK--EPEKPKEKPPPPPE 212
           PK+PE   +P   K P KP   E  + K PK        PEKPK     KP+ +P P PE
Sbjct: 226 PKKPESGPKPPGGKNP-KPLPGEDGQTKYPKGESGEAGPPEKPKLDPAPKPEPEPKPDPE 284

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PKPEP  +PE KP+ +P P PQP+P PQP P
Sbjct: 285 PKPEPEPKPEPKPEPQPKPEPQPKPEPQPKP 315

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 37/89 (41%), Positives = 48/89 (53%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P PKP    KP    KP    KP  + KP+P+   +PE   +PE KP  +P P PEP
Sbjct: 350 KPEPQPKPDPELKPDPEPKPDPEPKPDPEPKPEPQPKPDPELKPDPEPKPDPEPKPDPEP 409

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           KPEP  +PE P+ KP P P+ +      P
Sbjct: 410 KPEPQPKPE-PQPKPAPQPEVKSQKPTKP 437

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 33/78 (42%), Positives = 44/78 (56%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           L+P P PKP    KP    KP+   KP  + KP P+   +PE   +PE PK +P P PEP
Sbjct: 361 LKPDPEPKPDPEPKPDPEPKPEPQPKPDPELKPDPEPKPDPEPKPDPE-PKPEPQPKPEP 419

Query: 216 KPEPPKEPEKPKEKPPPP 269
           +P+P  +PE   +KP  P
Sbjct: 420 QPKPAPQPEVKSQKPTKP 437

[104][TOP]
>UniRef100_B5W6P6 Na-Ca exchanger/integrin-beta4 n=1 Tax=Arthrospira maxima CS-328
           RepID=B5W6P6_SPIMA
          Length = 1152

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 43/92 (46%), Positives = 62/92 (67%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 315 EPEPTPEPEPEPEPTPEPTPEPEPELEPEPEPEPEPEPTPEPEPEPEPEPEPEPEPEPTP 374

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P+P+P P
Sbjct: 375 EPEPEPTPEPEPEPEPEPLPEPEPEPLPEPEP 406

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 44/90 (48%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           LEP P P+P EPE   EP    EPE P+ + +P+P    EPE   EPE P+ +P P PEP
Sbjct: 340 LEPEPEPEP-EPEPTPEPEPEPEPE-PEPEPEPEPTPEPEPEPTPEPE-PEPEPEPLPEP 396

Query: 216 KPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE  P+ +P P P+P+P P+P P
Sbjct: 397 EPEPLPEPEPTPEPEPTPEPEPEPTPEPTP 426

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/93 (46%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE---KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPP 206
           EP P P P EPE   EP    EPE   +P+ + +P P+   EPE   EPE +P+ +P P 
Sbjct: 295 EPTPEPTP-EPEPTPEPEPEPEPEPTPEPEPEPEPTPEPTPEPEPELEPEPEPEPEPEPT 353

Query: 207 PEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 354 PEPEPEPEPEPEPEPEPEPTPEPEPEPTPEPEP 386

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 43/91 (47%), Positives = 56/91 (61%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           EP P P+P EPE   EP    EPE +P  +  P+P+   EPE   EPE +P  +P P PE
Sbjct: 303 EPEPTPEP-EPEPEPEPTPEPEPEPEPTPEPTPEPEPELEPEPEPEPEPEPTPEPEPEPE 361

Query: 213 PKPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE  P+ +P P P+P+P P+P P
Sbjct: 362 PEPEPEPEPEPTPEPEPEPTPEPEPEPEPEP 392

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 42/90 (46%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P  EPE   EP     PE P+ + +P+P+   EPE   EPE P+ +P P PEP
Sbjct: 311 EPEPEPEPTPEPEPEPEPTPEPTPE-PEPELEPEPEPEPEPEPTPEPE-PEPEPEPEPEP 368

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P  +P P P+P+P+P+P P
Sbjct: 369 EPEPTPEPEPEPTPEPEPEPEPEPLPEPEP 398

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE---KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP 206
           EP P P P+ EPE   EP    EPE   +P+ + +P+P+   EPE   EPE P+  P P 
Sbjct: 327 EPTPEPTPEPEPELEPEPEPEPEPEPTPEPEPEPEPEPEPEPEPEPTPEPE-PEPTPEPE 385

Query: 207 PEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP+PEP  EPE +P  +P P P+P+P P+P P
Sbjct: 386 PEPEPEPLPEPEPEPLPEPEPTPEPEPTPEPEP 418

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 43/93 (46%), Positives = 55/93 (59%), Gaps = 5/93 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE---KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPP 206
           EP P P+P EPE   EP    EPE   +P+ +  P+P+   EPE   EPE +P  +P P 
Sbjct: 369 EPEPTPEP-EPEPTPEPEPEPEPEPLPEPEPEPLPEPEPTPEPEPTPEPEPEPTPEPTPE 427

Query: 207 PEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           PEP PEP  EPE +P  +P P P P+P P+P P
Sbjct: 428 PEPTPEPEPEPEPEPTPEPEPEPTPEPTPEPEP 460

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 42/92 (45%), Positives = 55/92 (59%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEK-PKEQEKPKPKKPKEPEKPKEPE---KPKEKPPPP 206
           EP P P+P EPE   EP+   EPE  P+ +  P+P+   EPE    PE   +P+  P P 
Sbjct: 377 EPEPTPEP-EPEPEPEPLPEPEPEPLPEPEPTPEPEPTPEPEPEPTPEPTPEPEPTPEPE 435

Query: 207 PEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP+PEP  EPE P+  P P P+P+P P+P P
Sbjct: 436 PEPEPEPTPEPE-PEPTPEPTPEPEPTPEPEP 466

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 42/94 (44%), Positives = 57/94 (60%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEK-PKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P  EPE   EP    EPE  P+ + +P P+   EPE   EPE +P+ +P P P
Sbjct: 417 EPEPTPEPTPEPEPTPEPEPEPEPEPTPEPEPEPTPEPTPEPEPTPEPEPEPEPEPTPEP 476

Query: 210 EPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
            P+PEP  EPE   +P+ +P P P+P+P P+P P
Sbjct: 477 TPEPEPELEPEPEPEPEPEPTPEPEPEPEPEPEP 510

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 43/98 (43%), Positives = 57/98 (58%), Gaps = 10/98 (10%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE---KPKEQEKPKPKKPKEPEKPKEPE---KPKEKP 197
           EP P P+P+ EPE   EP    EPE   +P+ + +P+P    EPE   EPE   +P+  P
Sbjct: 355 EPEPEPEPEPEPEPEPEPTPEPEPEPTPEPEPEPEPEPLPEPEPEPLPEPEPTPEPEPTP 414

Query: 198 PPPPEPKPEPPKEPE---KPKEKPPPPPQPQPMPQPPP 302
            P PEP PEP  EPE   +P+ +P P P P+P P+P P
Sbjct: 415 EPEPEPTPEPTPEPEPTPEPEPEPEPEPTPEPEPEPTP 452

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 42/89 (47%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEK-PKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P EPE   EP    EPE  P+ + +P P+   EPE   EPE P+ +P P PEP
Sbjct: 389 EPEPLPEP-EPEPLPEPEPTPEPEPTPEPEPEPTPEPTPEPEPTPEPE-PEPEPEPTPEP 446

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           +PEP  EP  P+ +P P P+P+P P+P P
Sbjct: 447 EPEPTPEPT-PEPEPTPEPEPEPEPEPTP 474

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P EPE   EP    EPE P  +  P+P+   EPE   EPE P  +P P PEP+
Sbjct: 427 EPEPTPEP-EPEPEPEPTPEPEPE-PTPEPTPEPEPTPEPEPEPEPE-PTPEPTPEPEPE 483

Query: 219 PEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
            EP  EPE +P+  P P P+P+P P+P P +
Sbjct: 484 LEPEPEPEPEPEPTPEPEPEPEPEPEPEPEL 514

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 42/92 (45%), Positives = 54/92 (58%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE---KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP 209
           EP P P+P EPE   EP    EPE   +P+ +  P+P+   EPE   EPE P+  P P P
Sbjct: 349 EPEPTPEP-EPEPEPEPEPEPEPEPTPEPEPEPTPEPEPEPEPEPLPEPE-PEPLPEPEP 406

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            P+PEP  EPE +P  +P P P+P P P+P P
Sbjct: 407 TPEPEPTPEPEPEPTPEPTPEPEPTPEPEPEP 438

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKE-PEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEK-PKEKPPPPP 209
           EP P P+P+  PE   EP    EPE +P+ +  P+P+    PE   EPE  P+ +P P P
Sbjct: 411 EPTPEPEPEPTPEPTPEPEPTPEPEPEPEPEPTPEPEPEPTPEPTPEPEPTPEPEPEPEP 470

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP PEP  EPE P+ +P P P+P+P P P P
Sbjct: 471 EPTPEPTPEPE-PELEPEPEPEPEPEPTPEP 500

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 40/92 (43%), Positives = 52/92 (56%), Gaps = 2/92 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P P EPE   EP    EPE +P  +  P+P+   EPE   EPE P  +P P P P
Sbjct: 395 EPEPEPLP-EPEPTPEPEPTPEPEPEPTPEPTPEPEPTPEPEPEPEPE-PTPEPEPEPTP 452

Query: 216 KPEPPKEP-EKPKEKPPPPPQPQPMPQPPPHI 308
           +P P  EP  +P+ +P P P P+P P+P P +
Sbjct: 453 EPTPEPEPTPEPEPEPEPEPTPEPTPEPEPEL 484

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 41/92 (44%), Positives = 53/92 (57%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEK-PKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P  EPE   EP     PE  P+ +  P+P+   EPE   EPE +P  +P P P
Sbjct: 399 EPLPEPEPTPEPEPTPEPEPEPTPEPTPEPEPTPEPEPEPEPEPTPEPEPEPTPEPTPEP 458

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP PEP  EPE +P  +P P P+P+  P+P P
Sbjct: 459 EPTPEPEPEPEPEPTPEPTPEPEPELEPEPEP 490

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 39/90 (43%), Positives = 53/90 (58%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEK-PKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P  PE    P     PE  P+ +  P+P+   EPE   EPE P+ +P P P P
Sbjct: 277 EPTPTPEPT-PESTVLPTPEPTPEPTPEPEPTPEPEPEPEPEPTPEPE-PEPEPTPEPTP 334

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 335 EPEPELEPEPEPEPEPEPTPEPEPEPEPEP 364

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 39/90 (43%), Positives = 53/90 (58%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK-PKEKPPPPPEP 215
           EP P P+P EPE   EP    EP  P+ + +P+P+   EPE    PE  P+ +P P PEP
Sbjct: 409 EPEPTPEP-EPEPTPEPTPEPEPT-PEPEPEPEPEPTPEPEPEPTPEPTPEPEPTPEPEP 466

Query: 216 KPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
           +PEP   PE  P+ +P   P+P+P P+P P
Sbjct: 467 EPEPEPTPEPTPEPEPELEPEPEPEPEPEP 496

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 27/68 (39%), Positives = 36/68 (52%), Gaps = 3/68 (4%)
 Frame = +3

Query: 114 PKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEK---PKEKPPPPPQPQP 284
           P ++  P P+   E      PE P  +P P PEP PEP  EPE    P+ +P P P P+P
Sbjct: 274 PSDEPTPTPEPTPESTVLPTPE-PTPEPTPEPEPTPEPEPEPEPEPTPEPEPEPEPTPEP 332

Query: 285 MPQPPPHI 308
            P+P P +
Sbjct: 333 TPEPEPEL 340

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 28/75 (37%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +3

Query: 81  KEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPKPEPPKEPEKPKEK 257
           K  + P +   P  +  P+      PE   EP  +P+  P P PEP+PEP  EPE P+ +
Sbjct: 269 KATIFPSDEPTPTPEPTPESTVLPTPEPTPEPTPEPEPTPEPEPEPEPEPTPEPE-PEPE 327

Query: 258 PPPPPQPQPMPQPPP 302
           P P P P+P P+  P
Sbjct: 328 PTPEPTPEPEPELEP 342

[105][TOP]
>UniRef100_UPI0001B7B13E gamma-aminobutyric acid A receptor, epsilon n=1 Tax=Rattus
           norvegicus RepID=UPI0001B7B13E
          Length = 914

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 45/89 (50%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P EPE   EP    EPE P+ + +P+P+   EPE   EPE +P+ +P P PEP
Sbjct: 256 EPQPEPQP-EPEPQPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEP 313

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE P+ +P P P+PQP PQP P
Sbjct: 314 EPEPEPEPE-PEPEPEPEPEPQPEPQPEP 341

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 260 EPQPEPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEP 319

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P PQP P
Sbjct: 320 EPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEP 351

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 43/90 (47%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE P+ + +P+P+   +PE   EPE +P+ +P P PE
Sbjct: 296 EPEPEPEPEPEPEPQPEPEPEPEPE-PEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQPE 354

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE   E  P PP+P+P PQP P
Sbjct: 355 PEPEPEPEPEPEPEPEPEPPEPEPEPQPEP 384

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE P+ +P P PE
Sbjct: 266 EPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPE-PEPEPEPEPE 324

Query: 213 PKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EP+ +P+ +P P P+PQP PQP P
Sbjct: 325 PEPEPEPEPQPEPQPEPEPEPEPQPEPQPEP 355

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 272 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEP 331

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE P+ +P P PQP+P P+P P
Sbjct: 332 EPQPEPQPEPE-PEPEPQPEPQPEPEPEPEP 361

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 44/97 (45%), Positives = 62/97 (63%), Gaps = 6/97 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
           EP P P+P+ EPE   EP    EPE +P+ Q +P+P+   EPE   EPE   +P+ +P P
Sbjct: 280 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQP 339

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHIP 311
            PEP+PEP  EP+ +P+ +P P P+P+P P+P P  P
Sbjct: 340 EPEPEPEPQPEPQPEPEPEPEPEPEPEPEPEPEPPEP 376

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 42/92 (45%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ +PE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 248 EPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 307

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 308 EPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQP 339

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 276 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQP 335

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE P+ +P P P+P+P P+P P
Sbjct: 336 EPQPEPEPEPE-PQPEPQPEPEPEPEPEPEP 365

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 44/96 (45%), Positives = 61/96 (63%), Gaps = 5/96 (5%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE   +P+ +P P
Sbjct: 284 EPEPEPEPEPEPEPEPEPEPEPEPEPQPEPEPEPEPEPEPEPEPEPEPEPQPEPQPEPEP 343

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PEP+PEP  EPE P+ +P P P+P+P P+PP   P
Sbjct: 344 EPEPQPEPQPEPE-PEPEPEPEPEPEPEPEPPEPEP 378

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 43/95 (45%), Positives = 58/95 (61%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           EP P P+P+ EPE   EP    +PE +P+ + +P+P+   EPE   EPE   E  P PPE
Sbjct: 316 EPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQPEPEPEPEPEPEPEPEPEPEPPE 375

Query: 213 PKPEPPKEPE-----KPKEKPPPPPQPQPMPQPPP 302
           P+PEP  EPE     +P+ +P P P+PQP P+P P
Sbjct: 376 PEPEPQPEPESELDLEPEPEPQPLPEPQPEPEPEP 410

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 38/90 (42%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +P+   +P+   +P+ Q +P+P+   EPE   EPE +P+ +P P PEP
Sbjct: 240 EPEPEPEPEPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 299

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 300 EPEPEPEPEPQPEPEPEPEPEPEPEPEPEP 329

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/89 (48%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           +P P P+P EPE   EP    +PE +P+ Q +P+P+   EPE   EPE P+ +P P PEP
Sbjct: 234 QPGPQPEP-EPEPEPEPQPEPQPEPQPEPQPEPEPQPEPEPEPEPEPE-PEPEPEPEPEP 291

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE P+ +P P PQP+P P+P P
Sbjct: 292 EPEPEPEPE-PEPEPEPEPQPEPEPEPEP 319

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 41/92 (44%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P EPE   EP    EPE P+ + +P+P+   E +   EPE +P  +P P PEP
Sbjct: 350 EPQPEPEP-EPEPEPEPEPEPEPEPPEPEPEPQPEPESELDLEPEPEPQPLPEPQPEPEP 408

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHI 308
           +PEP  EPE +P+ +P P P+P+P P+P P +
Sbjct: 409 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEL 440

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 44/101 (43%), Positives = 59/101 (58%), Gaps = 13/101 (12%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P EPE   EP    EPE +P+ Q +P+P+   EPE   EP+ P+ +P P PEP
Sbjct: 306 EPEPQPEP-EPEPEPEPEPEPEPEPEPEPQPEPQPEPEPEPEPQPEPQ-PEPEPEPEPEP 363

Query: 216 KPEPPKEPEKPKEKP------------PPPPQPQPMPQPPP 302
           +PEP  EPE P+ +P             P P+PQP+P+P P
Sbjct: 364 EPEPEPEPEPPEPEPEPQPEPESELDLEPEPEPQPLPEPQP 404

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query: 48  PPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEP 227
           P PKP+   +P+   +P+   +P+ Q +P+P+   EPE   EPE P+ +P P PEP+PEP
Sbjct: 229 PRPKPQPGPQPEPEPEPEPEPQPEPQPEPQPEPQPEPEPQPEPE-PEPEPEPEPEPEPEP 287

Query: 228 PKEPE-KPKEKPPPPPQPQPMPQPPP 302
             EPE +P+ +P P P+P+P PQP P
Sbjct: 288 EPEPEPEPEPEPEPEPEPEPEPQPEP 313

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/86 (47%), Positives = 54/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+ EPE   EP    EPE P+ + +P+P+   EPE   EP+ P+ +P P PEP
Sbjct: 302 EPEPEPEPQPEPEPEPEPEPEPEPE-PEPEPEPQPEPQPEPEPEPEPQ-PEPQPEPEPEP 359

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQ 293
           +PEP  EPE   E P P P+PQP P+
Sbjct: 360 EPEPEPEPEPEPEPPEPEPEPQPEPE 385

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/98 (44%), Positives = 62/98 (63%), Gaps = 10/98 (10%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE---KPKEQEKPKPKKPK-EPEKPKEPE-----KPKE 191
           EP P P+P EPE   EP    EPE   +P+ + +P+P+ P+ EPE   EPE     +P+ 
Sbjct: 336 EPQPEPEP-EPEPQPEPQPEPEPEPEPEPEPEPEPEPEPPEPEPEPQPEPESELDLEPEP 394

Query: 192 KPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P P PEP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 395 EPQPLPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 432

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 39/94 (41%), Positives = 58/94 (61%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEP--VKPKEPEKPKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
           EP P P+P+   +P+ P  V+     +PK Q  P+P+   EPE   +PE   +P+ +P P
Sbjct: 204 EPQPEPQPEPQPQPQTPGQVQAGRQPRPKPQPGPQPEPEPEPEPEPQPEPQPEPQPEPQP 263

Query: 204 PPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            PEP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 264 EPEPQPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 297

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 35/90 (38%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           +P P P+P+   +P+   +P+ P + +   +P+PK    P+   EPE +P+ +P P PEP
Sbjct: 198 QPDPQPEPQPEPQPEPQPQPQTPGQVQAGRQPRPKPQPGPQPEPEPEPEPEPQPEPQPEP 257

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 258 QPEPQPEPEPQPEPEPEPEPEPEPEPEPEP 287

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 37/100 (37%), Positives = 60/100 (60%), Gaps = 12/100 (12%)
 Frame = +3

Query: 39  EPPPPPKPKEP----------EKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KP 185
           +P P P+P+ P           KP+   +P+   +P+ + +P+P+   +PE   EPE +P
Sbjct: 210 QPEPQPQPQTPGQVQAGRQPRPKPQPGPQPEPEPEPEPEPQPEPQPEPQPEPQPEPEPQP 269

Query: 186 KEKPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           + +P P PEP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 270 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 309

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 34/88 (38%), Positives = 56/88 (63%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P P+    P+   +P+   +P+ + +P+P+ P + +  ++P +PK +P P PEP+P
Sbjct: 185 PLPLPLPEPQPDPQPDPQPEPQPEPQPEPQPQPQTPGQVQAGRQP-RPKPQPGPQPEPEP 243

Query: 222 EPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP  EP+ +P+ +P P PQP+P PQP P
Sbjct: 244 EPEPEPQPEPQPEPQPEPQPEPEPQPEP 271

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEP---EKPKEKPPPPP 209
           +P P P+P    +P    +P+   +P+ Q +P+P   ++P     P    +P+ +P P P
Sbjct: 84  QPLPQPQPLPEPQPLPEPEPQPQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQPEPEPQP 143

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EP+ +P+ +P P PQP+P PQP P
Sbjct: 144 EPQPEPQPEPQPEPQPEPQPEPQPEPQPQPQP 175

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 38/108 (35%), Positives = 59/108 (54%), Gaps = 20/108 (18%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEP---------EKPKEPEKP 185
           EP P P+P+ +PE   EP    +PE +P+ Q +P+P   ++P          +P+   +P
Sbjct: 140 EPQPEPQPEPQPEPQPEPQPEPQPEPQPEPQPQPQPLAGRQPLPWPLPLPLPEPQPDPQP 199

Query: 186 KEKPPPPPEPKPEPPKEPE---------KPKEKPPPPPQPQPMPQPPP 302
             +P P PEP+PEP  +P+         +P+ KP P PQP+P P+P P
Sbjct: 200 DPQPEPQPEPQPEPQPQPQTPGQVQAGRQPRPKPQPGPQPEPEPEPEP 247

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 41/91 (45%), Positives = 49/91 (53%), Gaps = 5/91 (5%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           EP P P+P+ PE   EP    E E   E E P+P+   EP+   EPE P+ +P P PEP+
Sbjct: 364 EPEPEPEPEPPEPEPEPQPEPESELDLEPE-PEPQPLPEPQPEPEPE-PEPEPEPEPEPE 421

Query: 219 PEPPKEPEKPKEKPPPP-----PQPQPMPQP 296
           PEP  EPE   E  P P     PQ Q  PQP
Sbjct: 422 PEPEPEPEPEPEPEPEPELELEPQSQLEPQP 452

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 38/92 (41%), Positives = 53/92 (57%), Gaps = 2/92 (2%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEKPKEKPP-PPPEP 215
           P P P+P EPE   EP    +PE +P+ Q +P+P+   EP+   +P   ++  P P P P
Sbjct: 131 PLPQPQP-EPEPQPEPQPEPQPEPQPEPQPEPQPEPQPEPQPQPQPLAGRQPLPWPLPLP 189

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PEP  +P+ P  +P P P+PQP PQP P  P
Sbjct: 190 LPEPQPDPQ-PDPQPEPQPEPQPEPQPQPQTP 220

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 32/88 (36%), Positives = 52/88 (59%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P P+P+   +P+   +P+   +P+ Q +P+P+ P    +P     P   P P PEP+
Sbjct: 82  QPQPLPQPQPLPEPQPLPEPEPQPQPQPQPQPQPQ-PLAGRQPLPQPLPWPLPQPQPEPE 140

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+P  +PE P+ +P P PQP+P P+P P
Sbjct: 141 PQPEPQPE-PQPEPQPEPQPEPQPEPQP 167

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 36/92 (39%), Positives = 55/92 (59%), Gaps = 1/92 (1%)
 Frame = +3

Query: 30  EILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP 209
           ++    P P P +P+   EP    EPE P+ Q +P+P+   +P   ++P  P+  P P P
Sbjct: 77  DVFSSQPQPLP-QPQPLPEPQPLPEPE-PQPQPQPQPQPQPQPLAGRQP-LPQPLPWPLP 133

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P+PEP  +PE +P+ +P P P+PQP PQP P
Sbjct: 134 QPQPEPEPQPEPQPEPQPEPQPEPQPEPQPEP 165

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 29/117 (24%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEP-------EKPKEQEKPKPKKPKEPEKPKEPEKPKEK 194
           EP P P+P+ +P+   +P+  ++P         P+ Q +P+P+   +PE   EP+ P+ +
Sbjct: 100 EPEPQPQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQPEPEPQPEPQPEPQPEPQ-PEPQ 158

Query: 195 PPPPPEPKPEPPKEPEK---------------------PKEKPPPPPQPQPMPQPPP 302
           P P PEP+PEP  +P+                      P+  P P PQP+P P+P P
Sbjct: 159 PEPQPEPQPEPQPQPQPLAGRQPLPWPLPLPLPEPQPDPQPDPQPEPQPEPQPEPQP 215

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 36/91 (39%), Positives = 52/91 (57%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEP 215
           EP P P+P+   +P+   +P+       Q  P+P     P+   EPE +P+ +P P PEP
Sbjct: 94  EPQPLPEPEPQPQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQPEPEPQPEPQPEPQPEP 153

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMP--QPPP 302
           +PEP  EP+ P+ +P P PQPQP+   QP P
Sbjct: 154 QPEPQPEPQ-PEPQPEPQPQPQPLAGRQPLP 183

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/104 (34%), Positives = 53/104 (50%), Gaps = 16/104 (15%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPK--EPVKPKEPEKPKE------------QEKPKPKKPKEPEKPKE 173
           +P P P+P   PE P   + V   +P+   E            Q  P+P+   EP+   E
Sbjct: 41  QPQPVPQPLIPPESPAGDDVVFDSQPQPQSESPGHDDVFSSQPQPLPQPQPLPEPQPLPE 100

Query: 174 PE-KPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PE +P+ +P P P+P+P   ++P  P+  P P PQPQP P+P P
Sbjct: 101 PEPQPQPQPQPQPQPQPLAGRQP-LPQPLPWPLPQPQPEPEPQP 143

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 36/115 (31%), Positives = 52/115 (45%), Gaps = 26/115 (22%)
 Frame = +3

Query: 36  LEPPPPPKPK-----EPEKPKEPVKPKEPEKPK-------EQEKPKPKKPKEPEKPKEPE 179
           LE  PP + K     +P+   +P+ P  PE P         Q +P+ + P   +      
Sbjct: 26  LENKPPAQDKVVFGPQPQPVPQPLIP--PESPAGDDVVFDSQPQPQSESPGHDDVFSSQP 83

Query: 180 KPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQ--------------PMPQPPP 302
           +P  +P P PEP+P P  EP+ P+ +P P PQPQ              P+PQP P
Sbjct: 84  QPLPQPQPLPEPQPLPEPEPQ-PQPQPQPQPQPQPLAGRQPLPQPLPWPLPQPQP 137

[106][TOP]
>UniRef100_A7IWJ7 Putative uncharacterized protein B322R n=1 Tax=Paramecium bursaria
           Chlorella virus NY2A RepID=A7IWJ7_PBCVN
          Length = 309

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 51/112 (45%), Positives = 56/112 (50%), Gaps = 10/112 (8%)
 Frame = +3

Query: 15  AIKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK-PKEPEKPKEPEKPKE 191
           A KS     P P PKP     PK   KP     PK   KPKPK  PK   KPK   KPK 
Sbjct: 52  APKSAPKPAPKPVPKPVPKPAPKPAPKPVPKPTPKPAPKPKPKPAPKPSPKPKPAPKPKP 111

Query: 192 KPPPPPEPKPEP-PKEPEKPKEKPPPPPQPQPMPQPPP--------HIPASC 320
           KP P P PKP+P PK   KP  KP P P+P P P+P P         +P+SC
Sbjct: 112 KPAPKPSPKPKPAPKPKPKPAPKPKPAPKPAPKPKPKPKSNPASKLKMPSSC 163

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 43/91 (47%), Positives = 46/91 (50%), Gaps = 4/91 (4%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPPPE 212
           P P PKP     PK   KP     PK   KP PK   KP     PK   KPK KP P P 
Sbjct: 41  PKPAPKPAPKPAPKSAPKPAPKPVPKPVPKPAPKPAPKPVPKPTPKPAPKPKPKPAPKPS 100

Query: 213 PKPEP-PKEPEKPKEKPPPPPQPQPMPQPPP 302
           PKP+P PK   KP  KP P P+P P P+P P
Sbjct: 101 PKPKPAPKPKPKPAPKPSPKPKPAPKPKPKP 131

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 42/94 (44%), Positives = 48/94 (51%), Gaps = 7/94 (7%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-------KPKEPEKPKEPEKPKEKPP 200
           P P PKP     PK   KP     PK   KP PK       KP    KPK   KP  KP 
Sbjct: 45  PKPAPKPAPKSAPKPAPKPVPKPVPKPAPKPAPKPVPKPTPKPAPKPKPKPAPKPSPKPK 104

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P P+PKP+P  +P  PK KP P P+P+P P+P P
Sbjct: 105 PAPKPKPKPAPKPS-PKPKPAPKPKPKPAPKPKP 137

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 43/96 (44%), Positives = 47/96 (48%), Gaps = 6/96 (6%)
 Frame = +3

Query: 33  ILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPP 203
           I +P P PKP     PK   KP     PK   KP PK   KP     PK   KP  KP P
Sbjct: 30  IPKPAPMPKPAPKPAPKPAPKPAPKSAPKPAPKPVPKPVPKPAPKPAPKPVPKPTPKPAP 89

Query: 204 PPEPKPEP---PKEPEKPKEKPPPPPQPQPMPQPPP 302
            P+PKP P   PK    PK KP P P+P P P+P P
Sbjct: 90  KPKPKPAPKPSPKPKPAPKPKPKPAPKPSPKPKPAP 125

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 43/98 (43%), Positives = 47/98 (47%), Gaps = 3/98 (3%)
 Frame = +3

Query: 18  IKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKP 197
           I  I  + P P P PK   KP    KP     PK   KP PK   +P  PK   KP  KP
Sbjct: 23  IAPIRPIIPKPAPMPKPAPKPAP--KPAPKPAPKSAPKPAPKPVPKPV-PKPAPKPAPKP 79

Query: 198 PPPPEPKPEP---PKEPEKPKEKPPPPPQPQPMPQPPP 302
            P P PKP P   PK   KP  KP P P+P+P P P P
Sbjct: 80  VPKPTPKPAPKPKPKPAPKPSPKPKPAPKPKPKPAPKP 117

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 40/94 (42%), Positives = 42/94 (44%), Gaps = 10/94 (10%)
 Frame = +3

Query: 51  PPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK---KPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P  P     P  P+ PK    PK   KP PK   KP     PK   KP  KP P P PKP
Sbjct: 16  PALPNTNIAPIRPIIPKPAPMPKPAPKPAPKPAPKPAPKSAPKPAPKPVPKPVPKPAPKP 75

Query: 222 EP-------PKEPEKPKEKPPPPPQPQPMPQPPP 302
            P       PK   KPK KP P P P+P P P P
Sbjct: 76  APKPVPKPTPKPAPKPKPKPAPKPSPKPKPAPKP 109

[107][TOP]
>UniRef100_C0N825 Putative uncharacterized protein n=1 Tax=Methylophaga thiooxidans
           DMS010 RepID=C0N825_9GAMM
          Length = 894

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/97 (45%), Positives = 63/97 (64%), Gaps = 4/97 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 535 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 594

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPHIPAS 317
           EP+PEP  EPE +P+ +P P P+P+P P+P P   +S
Sbjct: 595 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPRADSS 631

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 43/90 (47%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           EP P P+P+ EPE   EP    EPE P+ + +P+P+   EPE   EPE P+ +P P PEP
Sbjct: 533 EPEPEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEP 590

Query: 216 KPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 591 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 620

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 42/87 (48%), Positives = 56/87 (64%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P+P EPE   EP    EPE P+ + +P+P+   EPE   EPE P+ +P P PEP+P
Sbjct: 532 PEPEPEP-EPEPEPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEP 588

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP  EPE P+ +P P P+P+P P+P P
Sbjct: 589 EPEPEPE-PEPEPEPEPEPEPEPEPEP 614

[108][TOP]
>UniRef100_B7CI24 Endo/excinuclease domain protein n=1 Tax=Burkholderia pseudomallei
           576 RepID=B7CI24_BURPS
          Length = 314

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 42/79 (53%), Positives = 52/79 (65%)
 Frame = +3

Query: 60  PKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEP 239
           PK P+ PK P  PK P+ PK  + PKP KP +P KP +P KP  KPP PP+P P+PPK P
Sbjct: 189 PKAPKAPKAPKAPKPPKPPKPPKPPKPPKPPKPPKPPKPPKP-PKPPKPPKP-PKPPKPP 246

Query: 240 EKPKEKPPPPPQPQPMPQP 296
           + P  KPP PP+P   P+P
Sbjct: 247 KPP--KPPKPPKPSKPPKP 263

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 42/85 (49%), Positives = 54/85 (63%), Gaps = 1/85 (1%)
 Frame = +3

Query: 21  KSIEILEPPPPPK-PKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKP 197
           K++ + + P  PK PK P+ PK P  PK P+ PK  + PKP KP +P KP +P KP  KP
Sbjct: 181 KTVRLSKAPKAPKAPKAPKAPKPPKPPKPPKPPKPPKPPKPPKPPKPPKPPKPPKP-PKP 239

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPP 272
           P PP+P P+PPK P+ PK   PP P
Sbjct: 240 PKPPKP-PKPPKPPKPPKPSKPPKP 263

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 42/81 (51%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +3

Query: 78  PKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPK-E 254
           PK P  PK P+ PK  + PKP KP +P KP +P KP  KPP PP+P P+PPK P+ PK  
Sbjct: 189 PKAPKAPKAPKAPKPPKPPKPPKPPKPPKPPKPPKP-PKPPKPPKP-PKPPKPPKPPKPP 246

Query: 255 KPPPPPQPQPMPQPPPHIPAS 317
           KPP PP+P    +PP  I A+
Sbjct: 247 KPPKPPKPPKPSKPPKPIAAT 267

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 41/93 (44%), Positives = 53/93 (56%), Gaps = 3/93 (3%)
 Frame = +3

Query: 30  EILEPPPPPKPKEPEKPKEPVK-PKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP 206
           E  + P   K  E  K  + V+  K P+ PK  + PK  KP +P KP +P KP + P PP
Sbjct: 163 EATQAPKERKATEAAKTSKTVRLSKAPKAPKAPKAPKAPKPPKPPKPPKPPKPPKPPKPP 222

Query: 207 PEPK-PEPPKEPEKPK-EKPPPPPQPQPMPQPP 299
             PK P+PPK P+ PK  KPP PP+P   P+PP
Sbjct: 223 KPPKPPKPPKPPKPPKPPKPPKPPKPPKPPKPP 255

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 5/83 (6%)
 Frame = +3

Query: 66  EPEKPKEPVKPKEPEKPKEQEKPK----PKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPK 233
           E E  + P + K  E  K  +  +    PK PK P+ PK P+ PK  PP PP+P P+PPK
Sbjct: 161 EGEATQAPKERKATEAAKTSKTVRLSKAPKAPKAPKAPKAPKPPK--PPKPPKP-PKPPK 217

Query: 234 EPEKPK-EKPPPPPQPQPMPQPP 299
            P+ PK  KPP PP+P   P+PP
Sbjct: 218 PPKPPKPPKPPKPPKPPKPPKPP 240

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 37/115 (32%), Positives = 51/115 (44%), Gaps = 19/115 (16%)
 Frame = +3

Query: 12  GAIKSIEILEPPPPPKPKEPEKPK--------------EPVKPKEPEKPKEQEKPKPKKP 149
           G +K ++       P P+ P +                E    + P++ K  E  K  K 
Sbjct: 123 GRVKRVDAERATGTPTPRSPRRATRATAEALDAGTPADEGEATQAPKERKATEAAKTSKT 182

Query: 150 ----KEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPK-EKPPPPPQPQPMPQPP 299
               K P+ PK P+ PK   PP P   P+PPK P+ PK  KPP PP+P   P+PP
Sbjct: 183 VRLSKAPKAPKAPKAPKAPKPPKP---PKPPKPPKPPKPPKPPKPPKPPKPPKPP 234

[109][TOP]
>UniRef100_Q9LJ64 Extensin protein-like n=1 Tax=Arabidopsis thaliana
           RepID=Q9LJ64_ARATH
          Length = 956

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 46/96 (47%), Positives = 58/96 (60%), Gaps = 9/96 (9%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE----KPKEKPPP 203
           E P P +PK +PE PK+    +EP KP+E  KP+P KP+E  KP+ P+    KP+E P P
Sbjct: 493 EAPKPEQPKPKPESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKP 552

Query: 204 PPEPKPEPPKEPEKPKEKPP----PPPQPQPMPQPP 299
            P PK E PK  E PK +PP    P P+  P PQPP
Sbjct: 553 QP-PKQETPKPEESPKPQPPKQETPKPEESPKPQPP 587

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 58/128 (45%), Positives = 66/128 (51%), Gaps = 40/128 (31%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPK-----------EPVKPKEP-------EKPK-EQEKPKPKKPKEP 158
           LE P  PKP+E  KP+           EP  PKEP       E PK EQ KPKP+ PK+ 
Sbjct: 429 LEEPSKPKPEESPKPQQPSPKPETPSHEPSNPKEPKPESPKQESPKTEQPKPKPESPKQ- 487

Query: 159 EKPKE----PEKPKEKP-----------PPPPE--PKPEPPKEPEKPKEKPP----PPPQ 275
           E PK+    PE+PK KP           PP PE  PKPEPPK  E PK +PP    P P+
Sbjct: 488 ESPKQEAPKPEQPKPKPESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPE 547

Query: 276 PQPMPQPP 299
             P PQPP
Sbjct: 548 ESPKPQPP 555

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 45/99 (45%), Positives = 59/99 (59%), Gaps = 12/99 (12%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK--------EPEKPKE--PEKPK 188
           +P P PK  EP+K   P   +EP KPK +E PKP++P         EP  PKE  PE PK
Sbjct: 410 KPTPTPKAPEPKKEINPPNLEEPSKPKPEESPKPQQPSPKPETPSHEPSNPKEPKPESPK 469

Query: 189 EKPP--PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           ++ P    P+PKPE PK+ E PK++ P P QP+P P+ P
Sbjct: 470 QESPKTEQPKPKPESPKQ-ESPKQEAPKPEQPKPKPESP 507

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 8/93 (8%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKE---PEKPKEQEKPKPKKPKE----PEKPKEPEKPKEKPPP 203
           P P  PK+    +EP KP+E   PE PK +E PKP+ PK+    PE+  +P+ PK++ P 
Sbjct: 502 PKPESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPK 561

Query: 204 PPE-PKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           P E PKP+PPK+ E PK +  P PQP    QPP
Sbjct: 562 PEESPKPQPPKQ-ETPKPEESPKPQPPKQEQPP 593

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 45/96 (46%), Positives = 56/96 (58%), Gaps = 5/96 (5%)
 Frame = +3

Query: 39  EPPPP---PKPKEPEKPKEPVKPKEP--EKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPP 203
           EPP P   PKP EP KP+E  KP+ P  E PK +E PKP+ PK+ E PK  E PK +PP 
Sbjct: 515 EPPKPEESPKP-EPPKPEESPKPQPPKQETPKPEESPKPQPPKQ-ETPKPEESPKPQPPK 572

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
              PKPE   +P+ PK++ PP  +   M  PP   P
Sbjct: 573 QETPKPEESPKPQPPKQEQPPKTEAPKMGSPPLESP 608

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/96 (48%), Positives = 57/96 (59%), Gaps = 14/96 (14%)
 Frame = +3

Query: 54  PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKP---PPPPE--PK 218
           PKPK PE PK+    +E  KP EQ KPKP+ PK+    +EP KP+E P   PP PE  PK
Sbjct: 478 PKPK-PESPKQESPKQEAPKP-EQPKPKPESPKQESSKQEPPKPEESPKPEPPKPEESPK 535

Query: 219 PEPPKEP-----EKPKEKPP----PPPQPQPMPQPP 299
           P+PPK+      E PK +PP    P P+  P PQPP
Sbjct: 536 PQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPP 571

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 40/108 (37%), Positives = 51/108 (47%), Gaps = 18/108 (16%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEP--EKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           P P P  +E  KP+E  KP+ P  E PK +E PKP+ PK+ E+P + E PK   PP   P
Sbjct: 550 PKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQ-EQPPKTEAPKMGSPPLESP 608

Query: 216 KPEPPKEPEKPKEKPPPPPQP----------------QPMPQPPPHIP 311
            P  P +    K++ P PP P                 P P PP H P
Sbjct: 609 VPNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSP 656

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 45/103 (43%), Positives = 55/103 (53%), Gaps = 16/103 (15%)
 Frame = +3

Query: 39  EPPPP---PKPKEPE----KPKEPVKPKEP--EKPKEQEKPKPKKPKEPEKPKEPEKPKE 191
           EPP P   PKP+ P+    KP+E  KP+ P  E PK +E PKP+ PK+ E PK  E PK 
Sbjct: 526 EPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQ-ETPKPEESPKP 584

Query: 192 KPPPPPE-PKPEPPKEPEKPKEKPPP------PPQPQPMPQPP 299
           +PP   + PK E PK    P E P P       P  +  PQPP
Sbjct: 585 QPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQPP 627

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 44/119 (36%), Positives = 56/119 (47%), Gaps = 22/119 (18%)
 Frame = +3

Query: 21  KSIEILEPPPP----PKPKE---PEKPK-EPVKPKE---PEKPKEQEKPKPKKPKEPEKP 167
           K  E  +P PP    PKP+E   P+ PK E  KP+E   P+ PK+++ PK + PK    P
Sbjct: 545 KPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQEQPPKTEAPKMGSPP 604

Query: 168 KEPEKP---------KEKPPPPPEPKPEPPK--EPEKPKEKPPPPPQPQPMPQPPPHIP 311
            E   P         K++ P PP P  E  K   P+ P    PPPP P   P PP   P
Sbjct: 605 LESPVPNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSP 663

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 34/78 (43%), Positives = 44/78 (56%), Gaps = 4/78 (5%)
 Frame = +3

Query: 78  PKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEP--PKE--PEK 245
           PK    PK PE  KE   P  ++P +P KP+E  KP++  P P  P  EP  PKE  PE 
Sbjct: 409 PKPTPTPKAPEPKKEINPPNLEEPSKP-KPEESPKPQQPSPKPETPSHEPSNPKEPKPES 467

Query: 246 PKEKPPPPPQPQPMPQPP 299
           PK++ P   QP+P P+ P
Sbjct: 468 PKQESPKTEQPKPKPESP 485

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 33/95 (34%), Positives = 36/95 (37%), Gaps = 7/95 (7%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP    P  P     P     P     P P     P     P  P + PPPPP   P 
Sbjct: 684 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPP 743

Query: 225 PP----KEPEKPKEKPPPP---PQPQPMPQPPPHI 308
           PP      P  P   PPPP   P P P+  PPP +
Sbjct: 744 PPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPV 778

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 34/96 (35%), Positives = 36/96 (37%), Gaps = 7/96 (7%)
 Frame = +3

Query: 42   PPPP---PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
            PPPP   P P     P  PV    P  P     P P     P     P  P   PPPP  
Sbjct: 720  PPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVH 779

Query: 213  PKPEPPKEPEKPKEKPPP----PPQPQPMPQPPPHI 308
              P P   P  P   PPP    PP P P+  PPP +
Sbjct: 780  SPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPV 815

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 32/91 (35%), Positives = 32/91 (35%), Gaps = 4/91 (4%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP    P     P  P     P     P P     P     P  P   PPPP    P
Sbjct: 648 PPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPP 707

Query: 222 EPPKEPEKPKEKPPP----PPQPQPMPQPPP 302
            P   P  P   PPP    PP P   P PPP
Sbjct: 708 PPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 30/89 (33%), Positives = 32/89 (35%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP    P     P  P     P     P P     P     P  P   PPPP    P 
Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 722

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           P   P  P + PPPPP   P P  P + P
Sbjct: 723 PVHSPPPPVQSPPPPPVFSPPPPAPIYSP 751

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 32/93 (34%), Positives = 34/93 (36%), Gaps = 1/93 (1%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           +  PPPP    P     P  P     P     P P     P     P  P   PPPP   
Sbjct: 667 MHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS 726

Query: 216 KPEPPKEPEKPKEKPPPPPQPQPMPQPPP-HIP 311
            P P + P  P    PPPP P   P PPP H P
Sbjct: 727 PPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSP 759

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 34/95 (35%), Positives = 36/95 (37%), Gaps = 6/95 (6%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKP---KEPEKPKEPEKPKEKPPPPPEP 215
           PPPP    P     P  P +   P     P P  P     P     P  P   PPPPP  
Sbjct: 713 PPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVH 772

Query: 216 KPEPP-KEPEKPKEKPPPP--PQPQPMPQPPPHIP 311
            P PP   P  P   PPPP    P P+  PPP  P
Sbjct: 773 SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/97 (36%), Positives = 36/97 (37%), Gaps = 8/97 (8%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK--PKEPEKPKEPEKPKEKPPPPPEPK 218
           PPPP    P     P  P     P     P P +  P  P     P  P   PPPPP   
Sbjct: 699 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHS 758

Query: 219 PEPP--KEPEKPKEKPPPP----PQPQPMPQPPPHIP 311
           P PP    P  P   PPPP    P P   P PP H P
Sbjct: 759 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 795

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 34/96 (35%), Positives = 42/96 (43%), Gaps = 5/96 (5%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPK-EQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
           LE P P  P +      P+K + P+ P    E+ K   P+ P     P  P    PPPP 
Sbjct: 605 LESPVPNDPYD----ASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPV 660

Query: 213 PKPEPP-KEPEKPKEKPPPP---PQPQPMPQPPPHI 308
             P PP   P  P   PPPP   P P P+  PPP +
Sbjct: 661 FSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPV 696

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 34/97 (35%), Positives = 35/97 (36%), Gaps = 7/97 (7%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKP--KEPEKPKEKPPPPPEP 215
           PPPP     P     P     P  P +   P P     P  P    P  P   PPPP   
Sbjct: 706 PPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHS 765

Query: 216 KPEPP-KEPEKPKEKPPP----PPQPQPMPQPPPHIP 311
            P PP   P  P   PPP    PP P   P PP H P
Sbjct: 766 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 802

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 31/90 (34%), Positives = 32/90 (35%), Gaps = 1/90 (1%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE-PKP 221
           PPPP    P  P     P     P     P P     P     P  P   PPPP + P P
Sbjct: 677 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPP 736

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
            P   P  P     PPP P   P PP H P
Sbjct: 737 PPVFSPPPPAPIYSPPPPPVHSPPPPVHSP 766

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 31/91 (34%), Positives = 34/91 (37%), Gaps = 6/91 (6%)
 Frame = +3

Query: 57  KPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPP-- 230
           +P+ P    E  K   P+ P     P P     P  P     P    PPPP   P PP  
Sbjct: 623 RPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVH 682

Query: 231 KEPEKPKEKPPP----PPQPQPMPQPPPHIP 311
             P  P   PPP    PP P   P PP H P
Sbjct: 683 SPPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 713

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 34/103 (33%), Positives = 36/103 (34%), Gaps = 12/103 (11%)
 Frame = +3

Query: 39  EPPPPP-------KPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKP 197
           +PP P         P+ P     P  P     P     P P     P     P  P   P
Sbjct: 625 QPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSP 684

Query: 198 PPPPEPKPEPP-KEPEKPKEKPPP----PPQPQPMPQPPPHIP 311
           PPPP   P PP   P  P   PPP    PP P   P PP H P
Sbjct: 685 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 727

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 35/97 (36%), Positives = 35/97 (36%), Gaps = 8/97 (8%)
 Frame = +3

Query: 45  PPPPKPK-EPEKPKEPVKP--KEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           P PP P  E  K   P  P    P  P     P P     P     P  P   PPPP   
Sbjct: 624 PQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHS 683

Query: 216 KPEPP-KEPEKPKEKPPP----PPQPQPMPQPPPHIP 311
            P PP   P  P   PPP    PP P   P PP H P
Sbjct: 684 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 720

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 33/98 (33%), Positives = 36/98 (36%), Gaps = 8/98 (8%)
 Frame = +3

Query: 33   ILEPPPPP--KPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP 206
            +  PPPPP   P  P     P  P     P     P P     P  P     P    PPP
Sbjct: 731  VQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPP 790

Query: 207  PEPKPEPP---KEPEKPKEKPPPP---PQPQPMPQPPP 302
            P   P PP     P  P   PPPP   P P+P+   PP
Sbjct: 791  PVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPP 828

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 29/92 (31%), Positives = 32/92 (34%), Gaps = 2/92 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           + PP   P  P     P  P     P     P P     P     P  P   PPPP    
Sbjct: 640 QSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSP 699

Query: 219 PEPPKEPEKPKEKPPPP--PQPQPMPQPPPHI 308
           P P   P  P   PPPP    P P+  PPP +
Sbjct: 700 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPV 731

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 33/101 (32%), Positives = 35/101 (34%), Gaps = 11/101 (10%)
 Frame = +3

Query: 42   PPPP---PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE 212
            PPPP   P P     P  P     P  P     P P     P     P  P   PPPP  
Sbjct: 727  PPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVH 786

Query: 213  PKPEPPKEPEKPKEKPPPP------PQP--QPMPQPPPHIP 311
              P P   P  P   PPPP      P P   P P+P   +P
Sbjct: 787  SPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLP 827

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 31/90 (34%), Positives = 31/90 (34%), Gaps = 1/90 (1%)
 Frame = +3

Query: 33   ILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP-P 209
            I  PPPPP    P     P  P     P     P P     P     P  P   PPPP P
Sbjct: 748  IYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807

Query: 210  EPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
               P PP     PK   P PP   PM   P
Sbjct: 808  IYSPPPPVFSPPPKPVTPLPPATSPMANAP 837

[110][TOP]
>UniRef100_Q8RWX5 Putative uncharacterized protein At3g19020 (Fragment) n=1
           Tax=Arabidopsis thaliana RepID=Q8RWX5_ARATH
          Length = 712

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 46/96 (47%), Positives = 58/96 (60%), Gaps = 9/96 (9%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE----KPKEKPPP 203
           E P P +PK +PE PK+    +EP KP+E  KP+P KP+E  KP+ P+    KP+E P P
Sbjct: 493 EAPKPEQPKPKPESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKP 552

Query: 204 PPEPKPEPPKEPEKPKEKPP----PPPQPQPMPQPP 299
            P PK E PK  E PK +PP    P P+  P PQPP
Sbjct: 553 QP-PKQETPKPEESPKPQPPKQETPKPEESPKPQPP 587

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 58/128 (45%), Positives = 66/128 (51%), Gaps = 40/128 (31%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPK-----------EPVKPKEP-------EKPK-EQEKPKPKKPKEP 158
           LE P  PKP+E  KP+           EP  PKEP       E PK EQ KPKP+ PK+ 
Sbjct: 429 LEEPSKPKPEESPKPQQPSPKPETPSHEPSNPKEPKPESPKQESPKTEQPKPKPESPKQ- 487

Query: 159 EKPKE----PEKPKEKP-----------PPPPE--PKPEPPKEPEKPKEKPP----PPPQ 275
           E PK+    PE+PK KP           PP PE  PKPEPPK  E PK +PP    P P+
Sbjct: 488 ESPKQEAPKPEQPKPKPESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPE 547

Query: 276 PQPMPQPP 299
             P PQPP
Sbjct: 548 ESPKPQPP 555

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 45/99 (45%), Positives = 59/99 (59%), Gaps = 12/99 (12%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPK--------EPEKPKE--PEKPK 188
           +P P PK  EP+K   P   +EP KPK +E PKP++P         EP  PKE  PE PK
Sbjct: 410 KPTPTPKAPEPKKEINPPNLEEPSKPKPEESPKPQQPSPKPETPSHEPSNPKEPKPESPK 469

Query: 189 EKPP--PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           ++ P    P+PKPE PK+ E PK++ P P QP+P P+ P
Sbjct: 470 QESPKTEQPKPKPESPKQ-ESPKQEAPKPEQPKPKPESP 507

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 8/93 (8%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKE---PEKPKEQEKPKPKKPKE----PEKPKEPEKPKEKPPP 203
           P P  PK+    +EP KP+E   PE PK +E PKP+ PK+    PE+  +P+ PK++ P 
Sbjct: 502 PKPESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPK 561

Query: 204 PPE-PKPEPPKEPEKPKEKPPPPPQPQPMPQPP 299
           P E PKP+PPK+ E PK +  P PQP    QPP
Sbjct: 562 PEESPKPQPPKQ-ETPKPEESPKPQPPKQEQPP 593

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 45/96 (46%), Positives = 56/96 (58%), Gaps = 5/96 (5%)
 Frame = +3

Query: 39  EPPPP---PKPKEPEKPKEPVKPKEP--EKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPP 203
           EPP P   PKP EP KP+E  KP+ P  E PK +E PKP+ PK+ E PK  E PK +PP 
Sbjct: 515 EPPKPEESPKP-EPPKPEESPKPQPPKQETPKPEESPKPQPPKQ-ETPKPEESPKPQPPK 572

Query: 204 PPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
              PKPE   +P+ PK++ PP  +   M  PP   P
Sbjct: 573 QETPKPEESPKPQPPKQEQPPKTEAPKMGSPPLESP 608

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/96 (48%), Positives = 57/96 (59%), Gaps = 14/96 (14%)
 Frame = +3

Query: 54  PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKP---PPPPE--PK 218
           PKPK PE PK+    +E  KP EQ KPKP+ PK+    +EP KP+E P   PP PE  PK
Sbjct: 478 PKPK-PESPKQESPKQEAPKP-EQPKPKPESPKQESSKQEPPKPEESPKPEPPKPEESPK 535

Query: 219 PEPPKEP-----EKPKEKPP----PPPQPQPMPQPP 299
           P+PPK+      E PK +PP    P P+  P PQPP
Sbjct: 536 PQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPP 571

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 40/108 (37%), Positives = 50/108 (46%), Gaps = 18/108 (16%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEP--EKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
           P P P  +E  KP+E  KP+ P  E PK +E PKP+ PK+ E+P + E PK   PP   P
Sbjct: 550 PKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQ-EQPPKTEAPKMGSPPLESP 608

Query: 216 KPEPPKEPEKPKEKPPPPPQP----------------QPMPQPPPHIP 311
            P  P +    K+  P PP P                 P P PP H P
Sbjct: 609 VPNDPYDASPIKKCRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSP 656

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 34/78 (43%), Positives = 44/78 (56%), Gaps = 4/78 (5%)
 Frame = +3

Query: 78  PKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEP--PKE--PEK 245
           PK    PK PE  KE   P  ++P +P KP+E  KP++  P P  P  EP  PKE  PE 
Sbjct: 409 PKPTPTPKAPEPKKEINPPNLEEPSKP-KPEESPKPQQPSPKPETPSHEPSNPKEPKPES 467

Query: 246 PKEKPPPPPQPQPMPQPP 299
           PK++ P   QP+P P+ P
Sbjct: 468 PKQESPKTEQPKPKPESP 485

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 44/119 (36%), Positives = 55/119 (46%), Gaps = 22/119 (18%)
 Frame = +3

Query: 21  KSIEILEPPPP----PKPKE---PEKPK-EPVKPKE---PEKPKEQEKPKPKKPKEPEKP 167
           K  E  +P PP    PKP+E   P+ PK E  KP+E   P+ PK+++ PK + PK    P
Sbjct: 545 KPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQEQPPKTEAPKMGSPP 604

Query: 168 KEPEKP---------KEKPPPPPEPKPEPPK--EPEKPKEKPPPPPQPQPMPQPPPHIP 311
            E   P         K+  P PP P  E  K   P+ P    PPPP P   P PP   P
Sbjct: 605 LESPVPNDPYDASPIKKCRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSP 663

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 32/99 (32%), Positives = 38/99 (38%), Gaps = 8/99 (8%)
 Frame = +3

Query: 36  LEPPPPPKPKEPE-----KPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP 200
           LE P P  P +       +P+ P    E  K    + P    P  P     P  P   PP
Sbjct: 605 LESPVPNDPYDASPIKKCRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPP 664

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQ---PQPMPQPPPHI 308
           PP    P P   P  P   PPPPP    P P+  PPP +
Sbjct: 665 PPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPV 703

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 29/88 (32%), Positives = 34/88 (38%), Gaps = 4/88 (4%)
 Frame = +3

Query: 57  KPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPK-EPEKPKEKPPPPPEPKPEPPK 233
           +P+ P    E  K   P+ P     P P     P  P   P  P   PPPP    P P  
Sbjct: 623 RPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVH 682

Query: 234 EPEKPKEKPPPPP---QPQPMPQPPPHI 308
            P  P    PPPP    P P+  PPP +
Sbjct: 683 SPPPPPVHSPPPPVHSPPPPVHSPPPPV 710

[111][TOP]
>UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1
            Tax=Ostreococcus tauri RepID=Q010M7_OSTTA
          Length = 1449

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 40/92 (43%), Positives = 40/92 (43%), Gaps = 5/92 (5%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP-- 215
            PPPPP P  P  P  P  P  P  P     P    P  P  P  P  P   PPPPP P  
Sbjct: 806  PPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSP-PPAPSPPPPPNPPP 864

Query: 216  ---KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
                P PP  P  P   PPPPP P P P PPP
Sbjct: 865  APTPPPPPSPPPSPPPSPPPPPSPPPPPSPPP 896

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 41/94 (43%), Positives = 41/94 (43%), Gaps = 2/94 (2%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP-PEPK 218
            PP PP P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPP P P 
Sbjct: 788  PPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPP 847

Query: 219  PEPPKEPE-KPKEKPPPPPQPQPMPQPPPHIPAS 317
            P PP  P   P   PPP P P P P PPP  P S
Sbjct: 848  PSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPS 881

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 40/94 (42%), Positives = 40/94 (42%)
 Frame = +3

Query: 36   LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEP 215
            L P PPP P  P  P  P  P  P  P     P P  P  P     P  P   P PPP P
Sbjct: 795  LPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAP 854

Query: 216  KPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
             P PP  P  P   PPPPP P P P P P  P S
Sbjct: 855  SPPPPPNP-PPAPTPPPPPSPPPSPPPSPPPPPS 887

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 37/85 (43%), Positives = 37/85 (43%)
 Frame = +3

Query: 48   PPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEP 227
            PPP P  P  P  P  P  P  P     P P  P  P  P  P  P   P  PP P P P
Sbjct: 787  PPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSP 846

Query: 228  PKEPEKPKEKPPPPPQPQPMPQPPP 302
            P  P  P   PPPPP P P P PPP
Sbjct: 847  PPSP-PPAPSPPPPPNPPPAPTPPP 870

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 41/96 (42%), Positives = 42/96 (43%), Gaps = 4/96 (4%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEK--PKEQEKPKPKKPKEPEKPKEPEKPKEK-PPPPPE 212
            PPPPP P  P  P  P  P  P    P     P P  P  P  P  P  P    PPPPP 
Sbjct: 814  PPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPS 873

Query: 213  PKPEPPKEPEKPKEKPPPP-PQPQPMPQPPPHIPAS 317
            P P PP  P  P   PPPP P P P P P  + P S
Sbjct: 874  PPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLS 909

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 40/96 (41%), Positives = 40/96 (41%), Gaps = 4/96 (4%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPE-PK 218
            PPP P P  P  P  P  P  P  P     P P  P  P  P  P  P   PPPP   P 
Sbjct: 787  PPPSPPPPLPPSPPPPPSPPPPPPP-----PSPPPPPNPPTPPSPPPPPSPPPPPSSPPP 841

Query: 219  PE---PPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            P    PP  P  P   PPP P P P P PPP  P S
Sbjct: 842  PSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPS 877

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 33/87 (37%), Positives = 34/87 (39%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            PPPP  P  P  P  P     P  P     P P  P     P  P  P   PPP P P P
Sbjct: 827  PPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPP 886

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
             PP  P  P    PPP    P+  PPP
Sbjct: 887  SPPPPPSPPPSPSPPPSSNPPLSSPPP 913

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 34/87 (39%), Positives = 35/87 (40%), Gaps = 1/87 (1%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP-PEPKP 221
            PPPP P  P  P     P  P  P     P P     P  P  P  P   PPPP P P P
Sbjct: 839  PPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSP 898

Query: 222  EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
             PP     P   PPP   P P+  PPP
Sbjct: 899  SPPPSSNPPLSSPPPLSSPPPLSSPPP 925

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 36/94 (38%), Positives = 37/94 (39%), Gaps = 7/94 (7%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKK-----PKEPEKPKEPEKPKEKPPPP 206
            PPPPP P  P     P  P  P  P     P P       P  P  P  P  P   PPPP
Sbjct: 826  PPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPP 885

Query: 207  PE--PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P   P P PP  P  P    PP   P P+  PPP
Sbjct: 886  PSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPP 919

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 35/94 (37%), Positives = 36/94 (38%), Gaps = 4/94 (4%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP----PPP 209
            P PPP P  P  P  P  P  P  P     P P  P  P  P  P  P    P    PPP
Sbjct: 854  PSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPP 913

Query: 210  EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
               P P   P  P   PPP P   P P  PP+ P
Sbjct: 914  LSSPPPLSSPPPPSSPPPPSPPLPPSPPLPPNPP 947

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 36/95 (37%), Positives = 37/95 (38%), Gaps = 3/95 (3%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
            P PPP P  P  P  P  P  P  P     P P  P  P  P  P  P   P P P P  
Sbjct: 848  PSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPP---PSPSPPPSS 904

Query: 222  EPPKEPEKPKEKPPP---PPQPQPMPQPPPHIPAS 317
             PP     P   PPP   PP P   P P P +P S
Sbjct: 905  NPPLSSPPPLSSPPPLSSPPPPSSPPPPSPPLPPS 939

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 34/91 (37%), Positives = 34/91 (37%), Gaps = 4/91 (4%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPP----PPP 209
            P PPP P  P  P  P  P     P     P P  P  P  P     P   PP    PPP
Sbjct: 860  PNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPP 919

Query: 210  EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
               P PP  P  P    PP P   P P PPP
Sbjct: 920  LSSPPPPSSPPPPSPPLPPSPPLPPNPPPPP 950

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 33/95 (34%), Positives = 37/95 (38%), Gaps = 3/95 (3%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEP--EKPKEQEKPKPKKPKEPEKPKEPEKP-KEKPPPPPE 212
            P PPP P  P     P+    P    P     P P  P  P  P  P  P    PPPPP 
Sbjct: 892  PSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSPPLPPSPPLPPNPPPPPS 951

Query: 213  PKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHIPAS 317
            P P        P+   P PP P P   PPP + A+
Sbjct: 952  PSPXXXXXXXPPRLPTPSPPPPSPPLPPPPPLEAA 986

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 28/64 (43%), Positives = 31/64 (48%)
 Frame = +3

Query: 123 QEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           ++ P P  P  P  P  P  P   PPPPP P P PP  P  P   PPPP  P P   PPP
Sbjct: 784 RQSPPPSPP--PPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPP 841

Query: 303 HIPA 314
             P+
Sbjct: 842 PSPS 845

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 34/89 (38%), Positives = 34/89 (38%), Gaps = 3/89 (3%)
 Frame = +3

Query: 45   PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPP---PPEP 215
            PPPP    P  P  P  P  P  P     P P  P     P     P   PPP   PP P
Sbjct: 868  PPPPPSPPPSPPPSPPPPPSP-PPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPP 926

Query: 216  KPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
               PP  P  P   PP PP P P P P P
Sbjct: 927  SSPPPPSPPLP-PSPPLPPNPPPPPSPSP 954

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 35/98 (35%), Positives = 36/98 (36%), Gaps = 8/98 (8%)
 Frame = +3

Query: 42   PPPPPK-PKEPEKPKEPVKPKEPEKPKEQEKPKPKK--PKEPEKPKEPEKPKEKPPPPPE 212
            PPPP   P  P  P  P  P  P  P     P P    P     P     P   PPPP  
Sbjct: 869  PPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSS 928

Query: 213  PKPEPPKEPEKPKEKPPPPPQPQPMP-----QPPPHIP 311
            P P  P  P  P   P PPP P P P       PP +P
Sbjct: 929  PPPPSPPLPPSPPLPPNPPPPPSPSPXXXXXXXPPRLP 966

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/101 (35%), Positives = 36/101 (35%), Gaps = 11/101 (10%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVK-PKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
            P PPP P  P  P  P   P  P  P     P    P     P     P    PPPP P 
Sbjct: 876  PSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSP- 934

Query: 219  PEPPKEPEKPKEKPPPPPQPQ----------PMPQPPPHIP 311
            P PP  P  P   PPP P P           P P PPP  P
Sbjct: 935  PLPPSPPLPPNPPPPPSPSPXXXXXXXPPRLPTPSPPPPSP 975

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 28/68 (41%), Positives = 30/68 (44%), Gaps = 3/68 (4%)
 Frame = +3

Query: 117 KEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPKEPEKPKEKPPPPP---QPQPM 287
           ++   P P  P  P  P  P  P   PPP P P P PP  P  P    PPPP    P P 
Sbjct: 784 RQSPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPS 843

Query: 288 PQPPPHIP 311
           P PPP  P
Sbjct: 844 PSPPPSPP 851

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 33/101 (32%), Positives = 35/101 (34%), Gaps = 14/101 (13%)
 Frame = +3

Query: 42   PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKP--------------KPKKPKEPEKPKEPE 179
            PPPP  P  P  P  P  P     P     P               P  P  P  P  P 
Sbjct: 883  PPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSPPLPPSPPL 942

Query: 180  KPKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
             P   PPP P P       P +     PPPP P P+P PPP
Sbjct: 943  PPNPPPPPSPSPXXXXXXXPPRLPTPSPPPPSP-PLPPPPP 982

[112][TOP]
>UniRef100_Q95P09 Protein TsetseEP n=1 Tax=Glossina morsitans morsitans
           RepID=TSEP_GLOMM
          Length = 320

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 219 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 278

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P PQP P
Sbjct: 279 EPEPEPEPEPEPEPEPEPEPEPEPEPEPQPEP 310

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 195 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 254

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 255 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 286

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 197 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 256

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 257 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 288

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 199 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 258

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 259 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 290

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 201 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 260

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 261 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 292

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 203 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 262

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 263 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 294

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 205 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 264

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 265 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 296

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 207 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 266

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 267 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 298

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 209 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 268

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 269 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 300

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 211 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 270

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 271 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 302

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 213 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 272

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 273 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 304

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/93 (46%), Positives = 61/93 (65%), Gaps = 4/93 (4%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 223 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 282

Query: 210 EPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPPH 305
           EP+PEP  EPE +P+ +P P P+PQP P+  P+
Sbjct: 283 EPEPEPEPEPEPEPEPEPEPEPEPQPEPESKPN 315

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 42/87 (48%), Positives = 56/87 (64%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P+P EPE   EP    EPE P+ + +P+P+   EPE   EPE P+ +P P PEP+P
Sbjct: 194 PEPEPEP-EPEPEPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEP 250

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP  EPE P+ +P P P+P+P P+P P
Sbjct: 251 EPEPEPE-PEPEPEPEPEPEPEPEPEP 276

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 36/96 (37%), Positives = 54/96 (56%), Gaps = 1/96 (1%)
 Frame = +3

Query: 18  IKSIEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKP 197
           + +IE+ E     +  E  + K  +   E E    +  P+P+   EPE   EPE P+ +P
Sbjct: 156 LTNIELREKYCIDQAFEQAQEKSDILFTELENCLIEGLPEPEPEPEPEPEPEPE-PEPEP 214

Query: 198 PPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
            P PEP+PEP  EPE +P+ +P P P+P+P P+P P
Sbjct: 215 EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP 250

[113][TOP]
>UniRef100_Q21GG9 Fibro-slime n=1 Tax=Saccharophagus degradans 2-40
           RepID=Q21GG9_SACD2
          Length = 1004

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 548 EPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEP 607

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  +PE P+ +P P PQP+P PQP P
Sbjct: 608 EPQPEPEPQPE-PEPQPEPEPQPEPEPQPEP 637

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 554 EPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEP 613

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  +PE P+ +P P PQP+P PQP P
Sbjct: 614 EPQPEPEPQPE-PEPQPEPEPQPEPEPQPEP 643

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 560 EPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEP 619

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  +PE P+ +P P PQP+P PQP P
Sbjct: 620 EPQPEPEPQPE-PEPQPEPEPQPEPEPQPEP 649

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 566 EPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEP 625

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  +PE P+ +P P PQP+P PQP P
Sbjct: 626 EPQPEPEPQPE-PEPQPEPEPQPEPEPQPEP 655

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 572 EPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEP 631

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  +PE P+ +P P PQP+P PQP P
Sbjct: 632 EPQPEPEPQPE-PEPQPEPEPQPEPEPQPEP 661

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 578 EPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEP 637

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  +PE P+ +P P PQP+P PQP P
Sbjct: 638 EPQPEPEPQPE-PEPQPEPEPQPEPEPQPEP 667

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 584 EPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEP 643

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  +PE P+ +P P PQP+P PQP P
Sbjct: 644 EPQPEPEPQPE-PEPQPEPEPQPEPEPQPEP 673

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 590 EPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEP 649

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  +PE P+ +P P PQP+P PQP P
Sbjct: 650 EPQPEPEPQPE-PEPQPEPEPQPEPEPQPEP 679

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 596 EPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEP 655

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  +PE P+ +P P PQP+P PQP P
Sbjct: 656 EPQPEPEPQPE-PEPQPEPEPQPEPEPQPEP 685

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 602 EPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEP 661

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           EP+PEP  +PE P+ +P P PQP+P PQP P
Sbjct: 662 EPQPEPEPQPE-PEPQPEPEPQPEPEPQPEP 691

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 44/90 (48%), Positives = 59/90 (65%), Gaps = 2/90 (2%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           EP P P+P EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P PE
Sbjct: 544 EPEPEPQP-EPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPE 602

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+PEP  +PE P+ +P P PQP+P PQP P
Sbjct: 603 PQPEPEPQPE-PEPQPEPEPQPEPEPQPEP 631

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 44/93 (47%), Positives = 60/93 (64%), Gaps = 3/93 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPP 209
           EP P P+P+ EPE   EP    EPE +P+ + +P+P+   EPE   EPE +P+ +P P P
Sbjct: 608 EPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEP 667

Query: 210 EPKPEPPKEPEKPKEKPPPPPQPQPMPQPPPHI 308
           EP+PEP  +PE P+ +P P PQP+P PQ  P I
Sbjct: 668 EPQPEPEPQPE-PEPQPEPEPQPEPEPQNLPPI 699

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 41/90 (45%), Positives = 59/90 (65%), Gaps = 1/90 (1%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           ++P P P+P EP+   EP    EP+ P+ + +P+P+   EPE   EPE +P+ +P P PE
Sbjct: 539 IDPNPEPEP-EPQPEPEPQPEPEPQ-PEPEPQPEPEPQPEPEPQPEPEPQPEPEPQPEPE 596

Query: 213 PKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P+PEP  +PE P+ +P P PQP+P PQP P
Sbjct: 597 PQPEPEPQPE-PEPQPEPEPQPEPEPQPEP 625

[114][TOP]
>UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes
           scapularis RepID=B7Q3U3_IXOSC
          Length = 137

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 40/87 (45%), Positives = 40/87 (45%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PPPPP P  P  P  P  P  P        P P  P  P  P  P  P   PPPPP P P
Sbjct: 1   PPPPPPPPPPPPPPPPPPPPPP--------PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            PP  P  P   PPPPP P P P PPP
Sbjct: 53  PPPPPPPPPPPPPPPPPPPPPPPPPPP 79

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 39/89 (43%), Positives = 39/89 (43%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PPPP P  P  P  P  P           P P  P  P  P  P  P   PPPPP P P 
Sbjct: 1   PPPPPPPPPPPPPPPPPP-----------PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49

Query: 225 PPKEPEKPKEKPPPPPQPQPMPQPPPHIP 311
           PP  P  P   PPPPP P P P PPP  P
Sbjct: 50  PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78

[115][TOP]
>UniRef100_A8NGE6 LPXTG cell wall surface anchor family protein, putative (Fragment)
           n=1 Tax=Brugia malayi RepID=A8NGE6_BRUMA
          Length = 76

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/82 (53%), Positives = 50/82 (60%)
 Frame = +3

Query: 54  PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPEPPK 233
           PKPK   KPK   KPK   KPK + KPKPK      KPK   KPK KP P P+PKP+P  
Sbjct: 1   PKPKPKPKPKPKPKPKPKPKPKSKPKPKPKP-----KPKPKPKPKPKPKPKPKPKPKP-- 53

Query: 234 EPEKPKEKPPPPPQPQPMPQPP 299
              KPK KP P P+P+P P+PP
Sbjct: 54  ---KPKPKPKPKPKPKPKPKPP 72

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 41/71 (57%), Positives = 47/71 (66%), Gaps = 2/71 (2%)
 Frame = +3

Query: 96  PKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEPKPEP-PKEPEKPKEKPPPP 269
           PK   KPK + KPKPK KPK   KPK   KPK KP P P+PKP+P PK   KPK KP P 
Sbjct: 1   PKPKPKPKPKPKPKPKPKPKPKSKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPK 60

Query: 270 PQPQPMPQPPP 302
           P+P+P P+P P
Sbjct: 61  PKPKPKPKPKP 71

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 41/75 (54%), Positives = 45/75 (60%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P P PKPK   KPK   K K   KPK + KPKP KPK   KPK   KPK KP P P+PK
Sbjct: 4   KPKPKPKPKPKPKPKPKPKSKPKPKPKPKPKPKP-KPKPKPKPKPKPKPKPKPKPKPKPK 62

Query: 219 PEPPKEPEKPKEKPP 263
           P+P     KPK KPP
Sbjct: 63  PKP-----KPKPKPP 72

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 34/61 (55%), Positives = 36/61 (59%), Gaps = 1/61 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPK-KPKEPEKPKEPEKPKEKPPPPPEP 215
           +P P PKPK   KPK   KPK   KPK + KPKPK KPK   KPK   KPK KP P P  
Sbjct: 14  KPKPKPKPKSKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPKPPL 73

Query: 216 K 218
           K
Sbjct: 74  K 74

[116][TOP]
>UniRef100_A0DE74 Chromosome undetermined scaffold_47, whole genome shotgun sequence
            n=1 Tax=Paramecium tetraurelia RepID=A0DE74_PARTE
          Length = 1429

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 53/119 (44%), Positives = 70/119 (58%), Gaps = 26/119 (21%)
 Frame = +3

Query: 21   KSIEILEPP--PPPKPKEPEKPKEPVKP-------KEPEKP-KEQEKPKPKKPKEPE--- 161
            K I+  EPP  P P PKE +KP+ P KP       K+P+ P KE +KP+P K  EP+   
Sbjct: 719  KEIQKQEPPKKPDPPPKEIQKPEPPKKPEPKQDPPKKPDPPHKEIQKPEPPKKPEPKQDP 778

Query: 162  --KPKEPEKPKEKPPPP--PEPKPEPPKEPEKPK---EKPPPPPQPQP------MPQPP 299
              KP  P+K  +KP PP  PEPK +PPK+PE P+   +KP PP +P+P       P+PP
Sbjct: 779  PKKPDPPQKEIQKPEPPKKPEPKQDPPKKPEPPQKEIQKPEPPKKPEPPQKEIQKPEPP 837

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 48/111 (43%), Positives = 64/111 (57%), Gaps = 18/111 (16%)
 Frame = +3

Query: 21  KSIEILEPP--PPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEP--------EKPK 170
           K ++  EPP  P P PKE +KP+ P K + P  PKE +KP+P K  EP        E PK
Sbjct: 671 KEVQKQEPPKKPDPPPKEIQKPEPPKKSEPP--PKEIQKPEPPKKSEPPPKEIQKQEPPK 728

Query: 171 EPEKP-----KEKPPPPPEPKPEPPKEPEKPK---EKPPPPPQPQPMPQPP 299
           +P+ P     K +PP  PEPK +PPK+P+ P    +KP PP +P+P   PP
Sbjct: 729 KPDPPPKEIQKPEPPKKPEPKQDPPKKPDPPHKEIQKPEPPKKPEPKQDPP 779

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 54/121 (44%), Positives = 73/121 (60%), Gaps = 28/121 (23%)
 Frame = +3

Query: 21   KSIEILEPPPPPKPKE--PEKP----KEPVKPKEPEKPKEQEKPKPKKP-------KEPE 161
            K I+  EPP  P+PK+  P+KP    KE  KP+ P+KP+ ++ P PKKP       ++PE
Sbjct: 735  KEIQKPEPPKKPEPKQDPPKKPDPPHKEIQKPEPPKKPEPKQDP-PKKPDPPQKEIQKPE 793

Query: 162  KPKEPEKPKEKPPPPPEP------KPEPPKEPEKPK---EKPPPPPQPQP------MPQP 296
             PK+PE PK+ PP  PEP      KPEPPK+PE P+   +KP PP +P+P       P+P
Sbjct: 794  PPKKPE-PKQDPPKKPEPPQKEIQKPEPPKKPEPPQKEIQKPEPPKKPEPPQKEIQKPEP 852

Query: 297  P 299
            P
Sbjct: 853  P 853

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 46/104 (44%), Positives = 63/104 (60%), Gaps = 13/104 (12%)
 Frame = +3

Query: 30   EILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKE----PEKPKEKP 197
            EI +P PP KP+ P+K  +  +P +  +P ++E  KP+ PK+PE P++    PE PK+  
Sbjct: 830  EIQKPEPPKKPEPPQKEIQKPEPPKKSEPPQKEIQKPEPPKKPEPPQKEIQKPEPPKKSE 889

Query: 198  PPPPE-PKPEPPKEPEKP-----KEKPP---PPPQPQPMPQPPP 302
            PPP E  KPEPPK+PE P     K +PP    PPQ +P P P P
Sbjct: 890  PPPKEIQKPEPPKKPEPPLKDVQKSEPPKKTDPPQKKPEPHPEP 933

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/118 (41%), Positives = 68/118 (57%), Gaps = 28/118 (23%)
 Frame = +3

Query: 30   EILEPPPP----PKPKEPEKPKEPVK-------------PKEPE-KPKEQEKPKPKKPKE 155
            EI +P PP    P PKE +KP+ P K             PK+P+  PKE +KP+P K  E
Sbjct: 688  EIQKPEPPKKSEPPPKEIQKPEPPKKSEPPPKEIQKQEPPKKPDPPPKEIQKPEPPKKPE 747

Query: 156  PEK--PKEPEKP-----KEKPPPPPEPKPEPPKEPEKPK---EKPPPPPQPQPMPQPP 299
            P++  PK+P+ P     K +PP  PEPK +PPK+P+ P+   +KP PP +P+P   PP
Sbjct: 748  PKQDPPKKPDPPHKEIQKPEPPKKPEPKQDPPKKPDPPQKEIQKPEPPKKPEPKQDPP 805

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 50/107 (46%), Positives = 69/107 (64%), Gaps = 16/107 (14%)
 Frame = +3

Query: 21   KSIEILEPPPPPKPKE--PEKPKEPVK-------PKEPEKP-KEQEKPKP-KKPKEPEKP 167
            K I+  EPP  P+PK+  P+KP+ P K       PK+PE P KE +KP+P KKP+ P+K 
Sbjct: 787  KEIQKPEPPKKPEPKQDPPKKPEPPQKEIQKPEPPKKPEPPQKEIQKPEPPKKPEPPQKE 846

Query: 168  -KEPEKPKEKPPPPPE-PKPEPPKEPEKPK---EKPPPPPQPQPMPQ 293
             ++PE PK+  PP  E  KPEPPK+PE P+   +KP PP + +P P+
Sbjct: 847  IQKPEPPKKSEPPQKEIQKPEPPKKPEPPQKEIQKPEPPKKSEPPPK 893

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 54/126 (42%), Positives = 74/126 (58%), Gaps = 33/126 (26%)
 Frame = +3

Query: 21   KSIEILEPPPPPKPKE--PEKP----KEPVKPKEPEKPKEQEKPKPKKPKEPEK------ 164
            K I+  EPP  P+PK+  P+KP    KE  KP+ P+KP+ ++ P PKKP+ P+K      
Sbjct: 761  KEIQKPEPPKKPEPKQDPPKKPDPPQKEIQKPEPPKKPEPKQDP-PKKPEPPQKEIQKPE 819

Query: 165  -PKEPEKPK---EKPPPP--PEP------KPEPPKEPEKPK---EKPPPPPQPQP----- 284
             PK+PE P+   +KP PP  PEP      KPEPPK+ E P+   +KP PP +P+P     
Sbjct: 820  PPKKPEPPQKEIQKPEPPKKPEPPQKEIQKPEPPKKSEPPQKEIQKPEPPKKPEPPQKEI 879

Query: 285  -MPQPP 299
              P+PP
Sbjct: 880  QKPEPP 885

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/110 (42%), Positives = 63/110 (57%), Gaps = 16/110 (14%)
 Frame = +3

Query: 30   EILEPPPP----PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEK--PKEPEKP-- 185
            EI +P PP    P PKE +K + P KP  P  PKE +KP+P K  EP++  PK+P+ P  
Sbjct: 704  EIQKPEPPKKSEPPPKEIQKQEPPKKPDPP--PKEIQKPEPPKKPEPKQDPPKKPDPPHK 761

Query: 186  ---KEKPPPPPEPKPEPPKEPEKP-----KEKPPPPPQPQPMPQPPPHIP 311
               K +PP  PEPK +PPK+P+ P     K +PP  P+P+  P   P  P
Sbjct: 762  EIQKPEPPKKPEPKQDPPKKPDPPQKEIQKPEPPKKPEPKQDPPKKPEPP 811

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 47/96 (48%), Positives = 57/96 (59%), Gaps = 9/96 (9%)
 Frame = +3

Query: 39  EPPPP--PKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKE---PEKPKEKPPP 203
           EPP    P PKE +K + P KP  P  PKE +KP+P K  EP  PKE   PE PK+  PP
Sbjct: 661 EPPKKTDPPPKEVQKQEPPKKPDPP--PKEIQKPEPPKKSEPP-PKEIQKPEPPKKSEPP 717

Query: 204 PPE-PKPEPPKEPEKPK---EKPPPPPQPQPMPQPP 299
           P E  K EPPK+P+ P    +KP PP +P+P   PP
Sbjct: 718 PKEIQKQEPPKKPDPPPKEIQKPEPPKKPEPKQDPP 753

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 44/92 (47%), Positives = 59/92 (64%), Gaps = 8/92 (8%)
 Frame = +3

Query: 30   EILEPPPPPKPKEPEKP-KEPVKPKEPEKP-KEQEKPKPKKPKEPEKPKEPEKPKEKPPP 203
            EI +P PP K + P+K  ++P  PK+PE P KE +KP+P K  EP  PKE +KP  +PP 
Sbjct: 846  EIQKPEPPKKSEPPQKEIQKPEPPKKPEPPQKEIQKPEPPKKSEP-PPKEIQKP--EPPK 902

Query: 204  PPEP------KPEPPKEPEKPKEKPPPPPQPQ 281
             PEP      K EPPK+ + P++KP P P+PQ
Sbjct: 903  KPEPPLKDVQKSEPPKKTDPPQKKPEPHPEPQ 934

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 43/103 (41%), Positives = 61/103 (59%), Gaps = 18/103 (17%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKP----KEPEKPKEQEKPKPKKPKEPEKPKEPEKP-----KEKP 197
           PPP + ++ E PK+P  P    ++PE PK+ E P PK+ ++PE PK+ E P     K++P
Sbjct: 668 PPPKEVQKQEPPKKPDPPPKEIQKPEPPKKSEPP-PKEIQKPEPPKKSEPPPKEIQKQEP 726

Query: 198 PPPPEP------KPEPPKEPE---KPKEKPPPPPQPQPMPQPP 299
           P  P+P      KPEPPK+PE    P +KP PP +    P+PP
Sbjct: 727 PKKPDPPPKEIQKPEPPKKPEPKQDPPKKPDPPHKEIQKPEPP 769

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 11/94 (11%)
 Frame = +3

Query: 51  PPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKP-KEPEKPKEKPPPPPE-PKPE 224
           PP+  EP + + P K   P K  ++++P PKKP  P K  ++PE PK+  PPP E  KPE
Sbjct: 651 PPRKPEPPRQEPPKKTDPPPKEVQKQEP-PKKPDPPPKEIQKPEPPKKSEPPPKEIQKPE 709

Query: 225 PPKEPE---------KPKEKPPPPPQPQPMPQPP 299
           PPK+ E         +P +KP PPP+    P+PP
Sbjct: 710 PPKKSEPPPKEIQKQEPPKKPDPPPKEIQKPEPP 743

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 11/94 (11%)
 Frame = +3

Query: 54  PKPKEPEKPKEPVKPKEP-EKPKEQEKPKPKKPKEPEKPKEPEKPKEK--PPPPPEPKPE 224
           P P +  +   P KP+ P ++P ++  P PK+ ++ E PK+P+ P ++   P PP+    
Sbjct: 641 PDPGQQARKDPPRKPEPPRQEPPKKTDPPPKEVQKQEPPKKPDPPPKEIQKPEPPKKSEP 700

Query: 225 PPKE---PEKPKEKPPPP-----PQPQPMPQPPP 302
           PPKE   PE PK+  PPP      +P   P PPP
Sbjct: 701 PPKEIQKPEPPKKSEPPPKEIQKQEPPKKPDPPP 734

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 12/103 (11%)
 Frame = +3

Query: 30  EILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEP--EKPKEPEKP-----K 188
           E++  P  P     +  +   + K+P+  ++  K  P+KP+ P  E PK+ + P     K
Sbjct: 616 EVMGQPLDPIKLREDNERRYNQQKKPDPGQQARKDPPRKPEPPRQEPPKKTDPPPKEVQK 675

Query: 189 EKPPPPPEPKPEPPKEPEKPKEKPPPP-----PQPQPMPQPPP 302
           ++PP  P+P P+  ++PE PK+  PPP     P+P    +PPP
Sbjct: 676 QEPPKKPDPPPKEIQKPEPPKKSEPPPKEIQKPEPPKKSEPPP 718

[117][TOP]
>UniRef100_A8N1H1 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea
           okayama7#130 RepID=A8N1H1_COPC7
          Length = 317

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 49/95 (51%), Positives = 60/95 (63%), Gaps = 3/95 (3%)
 Frame = +3

Query: 36  LEPPPPPKPKEPEKPK-EPVKPKEPEK-PKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPP 209
           L  PP P+P +P  PK EP KP+ P+  P + E PKP+ PK P  PK PE PK +PP P 
Sbjct: 106 LPTPPKPEPPKPTLPKPEPPKPQPPKPTPPKPEPPKPQPPK-PTPPK-PEPPKPQPPKPT 163

Query: 210 EPKPEPPK-EPEKPKEKPPPPPQPQPMPQPPPHIP 311
            PKP+PPK  P KP+   P PP+PQP P+P P  P
Sbjct: 164 PPKPQPPKPTPPKPQPPKPTPPKPQP-PKPTPPKP 197

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 50/102 (49%), Positives = 60/102 (58%), Gaps = 11/102 (10%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVK-PKEPEKPKEQE-KPKPKKPKEPE-KPKEPEKPKEKPPPP 206
           EPP P  PK EP KP+ P   P +PE PK Q  KP P KP+ P+ +P +P  PK +PP P
Sbjct: 113 EPPKPTLPKPEPPKPQPPKPTPPKPEPPKPQPPKPTPPKPEPPKPQPPKPTPPKPQPPKP 172

Query: 207 PEPKPEPPK-EPEKPKEKPPPPPQPQ------PMPQPPPHIP 311
             PKP+PPK  P KP+   P PP+PQ      P PQPP   P
Sbjct: 173 TPPKPQPPKPTPPKPQPPKPTPPKPQPPKPTSPKPQPPKPTP 214

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 47/97 (48%), Positives = 58/97 (59%), Gaps = 7/97 (7%)
 Frame = +3

Query: 45  PPPPKPKEPEKPK-EPVKPK--EPEKPKEQE-KPKPKKPKEPE-KPKEPEKPKEKPPPPP 209
           PP P P +PE PK +P KP   +PE PK Q  KP P KP+ P+  P +P+ PK  PP P 
Sbjct: 129 PPKPTPPKPEPPKPQPPKPTPPKPEPPKPQPPKPTPPKPQPPKPTPPKPQPPKPTPPKPQ 188

Query: 210 EPKPEPPK-EPEKPKEKPPPPPQP-QPMPQPPPHIPA 314
            PKP PPK +P KP    P PP+P  P P+PP   P+
Sbjct: 189 PPKPTPPKPQPPKPTSPKPQPPKPTPPKPEPPKPTPS 225

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 45/98 (45%), Positives = 54/98 (55%), Gaps = 9/98 (9%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPE-KPKEPEKPKEKPPPPPEPKP 221
           P PPKP EP KP +P KP  P       KP+P KP  P+ +P +P  PK +PP P  PKP
Sbjct: 147 PTPPKP-EPPKP-QPPKPTPP-------KPQPPKPTPPKPQPPKPTPPKPQPPKPTPPKP 197

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPP--------PHIP 311
           +PPK P  PK +PP P  P+P P  P        PH P
Sbjct: 198 QPPK-PTSPKPQPPKPTPPKPEPPKPTPSKSWSHPHYP 234

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 45/96 (46%), Positives = 54/96 (56%), Gaps = 8/96 (8%)
 Frame = +3

Query: 48  PPPKPKEPEKPKE----PVKPKEPEKPKEQEKPKPKKPK-EPEKPKEPEKPKEKPPPPPE 212
           PP KP +PE  K+    PV  +    P + E PKP  PK EP KP+ P+    KP PP  
Sbjct: 83  PPNKPSKPECKKDWEWNPVVKRCLPTPPKPEPPKPTLPKPEPPKPQPPKPTPPKPEPPKP 142

Query: 213 --PKPEPPK-EPEKPKEKPPPPPQPQPMPQPPPHIP 311
             PKP PPK EP KP+   P PP+PQP P+P P  P
Sbjct: 143 QPPKPTPPKPEPPKPQPPKPTPPKPQP-PKPTPPKP 177

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 38/84 (45%), Positives = 48/84 (57%), Gaps = 3/84 (3%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQE-KPKPKKPKEPE-KPKEPEKPKEKPPPPPEPK 218
           PP P P +P+ PK P  PK P+ PK    KP+P KP  P+ +P +P  PK +PP P  PK
Sbjct: 159 PPKPTPPKPQPPK-PTPPK-PQPPKPTPPKPQPPKPTPPKPQPPKPTSPKPQPPKPTPPK 216

Query: 219 PEPPK-EPEKPKEKPPPPPQPQPM 287
           PEPPK  P K    P  P +  P+
Sbjct: 217 PEPPKPTPSKSWSHPHYPKRNVPL 240

[118][TOP]
>UniRef100_P40603 Anther-specific proline-rich protein APG (Fragment) n=1
           Tax=Brassica napus RepID=APG_BRANA
          Length = 449

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 42/93 (45%), Positives = 48/93 (51%), Gaps = 6/93 (6%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P PPPKP+    P     P  P+ PK Q KP P     P  P +P KP+ KPPP P P 
Sbjct: 5   QPKPPPKPQPKPPPAPTPSPCPPQPPKPQPKPPPAPTPSP-CPPQPPKPQPKPPPAPGPS 63

Query: 219 PE------PPKEPEKPKEKPPPPPQPQPMPQPP 299
           P+      PPK P  P  KP PPP P P P PP
Sbjct: 64  PKPGPSPSPPKPPPSPAPKPVPPPSPSPKPSPP 96

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 40/86 (46%), Positives = 43/86 (50%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           PP PPKP+    P     P  P+ PK Q KP P     P+    P  PK  PPP P PKP
Sbjct: 26  PPQPPKPQPKPPPAPTPSPCPPQPPKPQPKPPPAPGPSPKPGPSPSPPK--PPPSPAPKP 83

Query: 222 EPPKEPEKPKEKPPPPPQPQPMPQPP 299
            PP  P  PK  PP PP P P P PP
Sbjct: 84  VPPPSP-SPKPSPPKPPAPSPKPSPP 108

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/93 (43%), Positives = 43/93 (46%), Gaps = 1/93 (1%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           +P PPP P     P +P KP+    P     PKP     P KP     PK  PPP P PK
Sbjct: 33  QPKPPPAPTPSPCPPQPPKPQPKPPPAPGPSPKPGPSPSPPKPPPSPAPKPVPPPSPSPK 92

Query: 219 PEPPKEP-EKPKEKPPPPPQPQPMPQPPPHIPA 314
           P PPK P   PK  PP PP P P       IPA
Sbjct: 93  PSPPKPPAPSPKPSPPKPPAPSPPKPQNKTIPA 125

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 41/94 (43%), Positives = 49/94 (52%), Gaps = 4/94 (4%)
 Frame = +3

Query: 45  PPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKPE 224
           PP P+PK P KP+    PK P  P     P P  P       +P KP+ KPPP P P P 
Sbjct: 1   PPKPQPKPPPKPQ----PKPPPAPT----PSPCPP-------QPPKPQPKPPPAPTPSPC 45

Query: 225 PPKEPEKPKEKPPPPP----QPQPMPQPPPHIPA 314
           PP +P KP+ KPPP P    +P P P PP   P+
Sbjct: 46  PP-QPPKPQPKPPPAPGPSPKPGPSPSPPKPPPS 78

[119][TOP]
>UniRef100_UPI00015535D5 PREDICTED: hypothetical protein n=1 Tax=Mus musculus
           RepID=UPI00015535D5
          Length = 423

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 45/98 (45%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +3

Query: 27  IEILEPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEK---PKPKKPKEPEKPKEPE-KPKE 191
           + + EP P P+P+ EPE   EPV   EPE   E E    P+P+   EPE   EPE +P+ 
Sbjct: 248 VPVPEPEPEPEPEPEPEPEPEPVPEPEPEPEPEPEPVPVPEPEPVPEPEPEPEPEPEPEP 307

Query: 192 KPPPPPEPKPEPPKEPE-KPKEKPPPPPQPQPMPQPPP 302
           +P P PEP+PEP  EPE +P+ +P P P+P+P+P+P P
Sbjct: 308 EPVPEPEPEPEPVPEPEPEPEPEPEPEPEPEPVPEPEP 345

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 44/94 (46%), Positives = 58/94 (61%), Gaps = 6/94 (6%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEK-PKEQEKPKPKKPKEPEKPKEPE---KPKEKPPP 203
           EP P P+P+ EPE   EPV   EPE  P+ + +P+P+   EPE   EPE   +P  +P P
Sbjct: 266 EPEPVPEPEPEPEPEPEPVPVPEPEPVPEPEPEPEPEPEPEPEPVPEPEPEPEPVPEPEP 325

Query: 204 PPEPKPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
            PEP+PEP  EPE  P+ +P P P P P+P+P P
Sbjct: 326 EPEPEPEPEPEPEPVPEPEPEPVPVPVPVPEPVP 359

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/94 (43%), Positives = 57/94 (60%), Gaps = 2/94 (2%)
 Frame = +3

Query: 27  IEILEPPPPPKPKEPEKPKEPV-KPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPP 200
           + + EP P P+P  PE   EPV +P     P    +P+P+   EPE   EPE +P+ +P 
Sbjct: 112 VPVPEPEPEPEPV-PEHVPEPVPEPVPVPVPVPVPEPEPEPEPEPEPVPEPEPEPEPEPV 170

Query: 201 PPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P PEP+PEP  EPE P+ +P P P+P P+P+P P
Sbjct: 171 PVPEPEPEPVPEPE-PEPEPEPEPEPVPVPEPEP 203

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 43/100 (43%), Positives = 55/100 (55%), Gaps = 12/100 (12%)
 Frame = +3

Query: 39  EPPPPPKPKEPEKPKEPVKPKEPE-----KPKEQEKPKPKKPKEPEKPKEPEK------- 182
           EP P P+P EPE   EPV   EPE     +P+ + +P+P+   EPE   EPE        
Sbjct: 294 EPEPEPEP-EPEPEPEPVPEPEPEPEPVPEPEPEPEPEPEPEPEPEPVPEPEPEPVPVPV 352

Query: 183 PKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P  +P P P P PEP  EPE P+  P P P P+P+P+P P
Sbjct: 353 PVPEPVPVPVPVPEPEPEPE-PEPVPVPVPVPEPVPEPEP 391

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 41/95 (43%), Positives = 55/95 (57%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39  EPPPPPKPKE-PEKPKEPVKPKEP---EKPKEQEKPKPKKPKEPEKPKEPEK---PKEKP 197
           EP P P P+  PE   EPV    P    +P+ + +P+P+   EPE   EPE    P+ +P
Sbjct: 118 EPEPEPVPEHVPEPVPEPVPVPVPVPVPEPEPEPEPEPEPVPEPEPEPEPEPVPVPEPEP 177

Query: 198 PPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P PEP+PEP  EPE P+  P P P+P+P+P P P
Sbjct: 178 EPVPEPEPEPEPEPE-PEPVPVPEPEPEPVPVPEP 211

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/101 (40%), Positives = 57/101 (56%), Gaps = 9/101 (8%)
 Frame = +3

Query: 27  IEILEPPPPPKPKEPEKPKE---PVKPKEPE-KPKEQEKPKPKKPKEPEKPKEPEK---- 182
           + + EP P P P     P     PV   EPE +P+ + +P+P+   EPE   EPE     
Sbjct: 226 VPVPEPVPVPVPVPVPVPVPVPVPVPEPEPEPEPEPEPEPEPEPVPEPEPEPEPEPEPVP 285

Query: 183 -PKEKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
            P+ +P P PEP+PEP  EPE P+  P P P+P+P+P+P P
Sbjct: 286 VPEPEPVPEPEPEPEPEPEPE-PEPVPEPEPEPEPVPEPEP 325

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 41/88 (46%), Positives = 51/88 (57%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P P EPE   EP    EPE P+   +P+P+   EPE    PE P+  P P PEP+P
Sbjct: 245 PVPVPVP-EPEPEPEPEPEPEPE-PEPVPEPEPEPEPEPEPVPVPE-PEPVPEPEPEPEP 301

Query: 222 EPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
           EP  EPE  P+ +P P P P+P P+P P
Sbjct: 302 EPEPEPEPVPEPEPEPEPVPEPEPEPEP 329

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 41/95 (43%), Positives = 55/95 (57%), Gaps = 7/95 (7%)
 Frame = +3

Query: 39  EPPPPPKPK---EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPP 206
           EP P P+P+   EPE   EP    EPE P  + +P+P+   EPE   EPE +P+ +P P 
Sbjct: 282 EPVPVPEPEPVPEPEPEPEPEPEPEPE-PVPEPEPEPEPVPEPEPEPEPEPEPEPEPEPV 340

Query: 207 PEPKPEP---PKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP+PEP   P    +P   P P P+P+P P+P P
Sbjct: 341 PEPEPEPVPVPVPVPEPVPVPVPVPEPEPEPEPEP 375

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 42/95 (44%), Positives = 53/95 (55%), Gaps = 3/95 (3%)
 Frame = +3

Query: 27  IEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP 206
           + + EP P P+P EPE   EP    EPE P    +P+P+   EPE   EPE P+ +P P 
Sbjct: 142 VPVPEPEPEPEP-EPEPVPEPEPEPEPE-PVPVPEPEPEPVPEPEPEPEPE-PEPEPVPV 198

Query: 207 PEPKPEPPKEPEK---PKEKPPPPPQPQPMPQPPP 302
           PEP+PEP   PE    P   P P P P P+P+P P
Sbjct: 199 PEPEPEPVPVPEPVPVPVPVPVPVPVPVPVPEPVP 233

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 41/88 (46%), Positives = 49/88 (55%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEK-PKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPK 218
           P P P P EPE   EPV    PE  P+    P P    EPE   EPE P+  P P PEP+
Sbjct: 109 PEPVPVP-EPEPEPEPVPEHVPEPVPEPVPVPVPVPVPEPEPEPEPE-PEPVPEPEPEPE 166

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP   PE P+ +P P P+P+P P+P P
Sbjct: 167 PEPVPVPE-PEPEPVPEPEPEPEPEPEP 193

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 41/91 (45%), Positives = 52/91 (57%), Gaps = 3/91 (3%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPE 212
           EP P P+P+ EPE   EPV   EPE P     P P+    P    EPE +P+ +P P P 
Sbjct: 322 EPEPEPEPEPEPEPEPEPVPEPEPE-PVPVPVPVPEPVPVPVPVPEPEPEPEPEPVPVPV 380

Query: 213 PKPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
           P PEP  EPE  P+ +P P P+P+P+P P P
Sbjct: 381 PVPEPVPEPEPVPEPEPEPEPEPEPVPVPVP 411

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 41/88 (46%), Positives = 49/88 (55%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPPPEPKP 221
           P P P+P EPE   EP    EPE P+ + +P P    EPE   EPE P+ +P P PEP P
Sbjct: 141 PVPVPEP-EPEPEPEPEPVPEPE-PEPEPEPVPVPEPEPEPVPEPE-PEPEPEPEPEPVP 197

Query: 222 EPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
            P  EPE  P  +P P P P P+P P P
Sbjct: 198 VPEPEPEPVPVPEPVPVPVPVPVPVPVP 225

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 39/92 (42%), Positives = 50/92 (54%), Gaps = 5/92 (5%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEK-----PKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP 206
           P P P+P  PE   EPV   EPE      P+   +P P+    P     PE P+ +P P 
Sbjct: 97  PVPVPEPV-PEHVPEPVPVPEPEPEPEPVPEHVPEPVPEPVPVPVPVPVPE-PEPEPEPE 154

Query: 207 PEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           PEP PEP  EPE P+  P P P+P+P+P+P P
Sbjct: 155 PEPVPEPEPEPE-PEPVPVPEPEPEPVPEPEP 185

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 35/93 (37%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = +3

Query: 27  IEILEPPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEKPKEKPPPP 206
           + + EP P P P    +P     P+    P+ + +P+P     PE   EP  P   P P 
Sbjct: 86  VPVPEPVPVPVPVPVPEPVPEHVPEPVPVPEPEPEPEPVPEHVPEPVPEPV-PVPVPVPV 144

Query: 207 PEPKPEPPKEPEK-PKEKPPPPPQPQPMPQPPP 302
           PEP+PEP  EPE  P+ +P P P+P P+P+P P
Sbjct: 145 PEPEPEPEPEPEPVPEPEPEPEPEPVPVPEPEP 177

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 44/128 (34%), Positives = 55/128 (42%), Gaps = 40/128 (31%)
 Frame = +3

Query: 39  EPPPPPKPK-EPEKPKEPVKPKEPEK---------------------------------- 113
           EP P P+P+ EPE   EPV   EPE                                   
Sbjct: 178 EPVPEPEPEPEPEPEPEPVPVPEPEPEPVPVPEPVPVPVPVPVPVPVPVPVPEPVPVPVP 237

Query: 114 -PKEQEKPKPKKPKEPEKPKEPE-KPKEKPPPPPEPKPEPPKEPEK---PKEKPPPPPQP 278
            P     P P    EPE   EPE +P+ +P P PEP+PEP  EPE    P+ +P P P+P
Sbjct: 238 VPVPVPVPVPVPVPEPEPEPEPEPEPEPEPEPVPEPEPEPEPEPEPVPVPEPEPVPEPEP 297

Query: 279 QPMPQPPP 302
           +P P+P P
Sbjct: 298 EPEPEPEP 305

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 35/88 (39%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +3

Query: 42  PPPPPKPKEPEKPKEPVKPKEPEKPKEQEKPKPKKPKEPEKPKEPEK-PKEKPPPPPEPK 218
           P P P P+    P     P     P    +P+P+   EPE   EPE  P+ +P P PEP+
Sbjct: 223 PVPVPVPEPVPVPVPVPVPVPVPVPVPVPEPEPEPEPEPEPEPEPEPVPEPEPEPEPEPE 282

Query: 219 PEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
           P P  EPE P  +P P P+P+P P+P P
Sbjct: 283 PVPVPEPE-PVPEPEPEPEPEPEPEPEP 309

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 39/98 (39%), Positives = 49/98 (50%), Gaps = 6/98 (6%)
 Frame = +3

Query: 27  IEILEPPPPPKPKEPEKPKEPVKPKEPEK-PKEQEKPKPKKPKEPEKPKEPEK-----PK 188
           + + EP P P P  PE    PV    PE  P+   +P P    EPE    PE      P+
Sbjct: 76  VPVPEPVPVPVPV-PEPVPVPVPVPVPEPVPEHVPEPVPVPEPEPEPEPVPEHVPEPVPE 134

Query: 189 EKPPPPPEPKPEPPKEPEKPKEKPPPPPQPQPMPQPPP 302
             P P P P PEP  EPE P+ +P P P+P+P P+P P
Sbjct: 135 PVPVPVPVPVPEPEPEPE-PEPEPVPEPEPEPEPEPVP 171

 Score