BB933742 ( RCC06259 )

[UP]


[1][TOP]
>UniRef100_Q39835 Extensin n=1 Tax=Glycine max RepID=Q39835_SOYBN
          Length = 432

 Score =  281 bits (718), Expect = 4e-74
 Identities = 142/247 (57%), Positives = 157/247 (63%), Gaps = 43/247 (17%)
 Frame = -3

Query: 612 SLMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPV------------SPPPKV 469
           S MAS T T+ + ++SLTLPS   A++Y+YSSPPPPK  PP             SPPP  
Sbjct: 3   SPMASLTLTIALTIISLTLPSQTLADNYIYSSPPPPKHSPPPPYYYHSPPPPKHSPPPPY 62

Query: 468 Y-----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPV 304
           Y     PP +SPPP  Y    PPPK  PP  PPY+Y SPPPP +SPP  PY+Y SPPPP 
Sbjct: 63  YYHSPPPPKHSPPPPYYYHSPPPPKHSPP--PPYYYHSPPPPKHSPPP-PYYYHSPPPPK 119

Query: 303 YSPPPPY---------H-------YSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSP 181
           +SPPPPY         H       Y SPPPP   P  PY Y SPPPP+H   P  YYHSP
Sbjct: 120 HSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSP 179

Query: 180 PPPK----KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY---SPPPPYH 22
           PPPK     PYYYHSPPPP +SPPPPY+Y SPPPPPKKPY Y SPPPPVY   SPPPPY 
Sbjct: 180 PPPKHSPPPPYYYHSPPPPKHSPPPPYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYK 239

Query: 21  YTSPPPP 1
           Y SPPPP
Sbjct: 240 YPSPPPP 246

 Score =  231 bits (589), Expect = 4e-59
 Identities = 123/221 (55%), Positives = 130/221 (58%), Gaps = 44/221 (19%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y Y SPPPPK  PP   PP  Y    PP +SPPP  Y    PPPK  PP  PPY+Y SPP
Sbjct: 110 YYYHSPPPPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP--PPYYYHSPP 164

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPY---------H-------YSSPPPPPKKPYKYSS 232
           PP +SPP  PY+Y SPPPP +SPPPPY         H       Y SPPPPPKKPYKY S
Sbjct: 165 PPKHSPPP-PYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYKSPPPPPKKPYKYPS 223

Query: 231 PPPPEH-HVSPKPYYHSPPPPKKPYYYHSPPPPVY-------------SPPPPYHYSSPP 94
           PPPP + + SP P Y  P PP  PY Y SPPPPVY             SPPPPY Y SPP
Sbjct: 224 PPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPP 283

Query: 93  PPPKK-------PYYYHSPPPPVY---SPPPPYHYTSPPPP 1
           PPP K        Y Y SPPPPVY   SPPPPY Y SPPPP
Sbjct: 284 PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP 324

 Score =  230 bits (587), Expect = 6e-59
 Identities = 123/206 (59%), Positives = 126/206 (61%), Gaps = 29/206 (14%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY----PPVSPPYHYSSPP 364
           Y Y SPPPP  YP   PPP  YP   SPPP VY   SPPP VY    PP  PPY Y SPP
Sbjct: 229 YKYKSPPPPYKYPSPPPPPYKYP---SPPPPVYKYKSPPPPVYKYKSPP--PPYKYPSPP 283

Query: 363 PPVY---SPPKKPYHYSSPPPPVY---SPPPPYHYSSPPPPPKK-------PYKYSSPPP 223
           PP Y   SPP   Y Y SPPPPVY   SPPPPY Y SPPPPP K        YKY SPPP
Sbjct: 284 PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 343

Query: 222 PEH-HVSPKPYYHSPPPPKKPYYYHSPPPPVY---SPPPPYHYSSPPPPPKK-------P 76
           P + + SP P Y  P PP  PY Y SPPPPVY   SPPPPY Y SPPPPP K        
Sbjct: 344 PVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPV 403

Query: 75  YYYHSPPPPVYSPPPP-YHYTSPPPP 1
           Y Y SPPPPV+SPPPP Y Y SPPPP
Sbjct: 404 YKYKSPPPPVHSPPPPHYIYASPPPP 429

 Score =  228 bits (581), Expect = 3e-58
 Identities = 122/225 (54%), Positives = 130/225 (57%), Gaps = 48/225 (21%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y Y SPPPPK  PP   PP  Y    PP +SPPP  Y    PPPK  PP  PPY+Y SPP
Sbjct: 126 YYYHSPPPPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP--PPYYYHSPP 180

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEH-HVSPKPYYH 187
           PP +SPP  PY+Y SPPPP +SPPPPY+Y SPPPPPKKPYKY SPPPP + + SP P Y 
Sbjct: 181 PPKHSPPP-PYYYHSPPPPKHSPPPPYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYK 239

Query: 186 SPPPPKKPYYYHSPPPPVY-------------SPPPPYHYSSPPPPPKK----------- 79
            P PP  PY Y SPPPPVY             SPPPPY Y SPPPPP K           
Sbjct: 240 YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKY 299

Query: 78  ---------------PYYYHSPPPPVY---SPPPP-YHYTSPPPP 1
                          PY Y SPPPP Y   SPPPP Y Y SPPPP
Sbjct: 300 KSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 344

 Score =  189 bits (479), Expect = 2e-46
 Identities = 108/191 (56%), Positives = 111/191 (58%), Gaps = 20/191 (10%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY----PPVSPPYHYSSPP 364
           Y Y SPPPP  YP   PPP  YP   SPPP VY   SPPP VY    PP  PPY Y SPP
Sbjct: 268 YKYKSPPPPYKYPSPPPPPYKYP---SPPPPVYKYKSPPPPVYKYKSPP--PPYKYPSPP 322

Query: 363 PPVY---SPPKKPYHYSSPPPPVY---SPPPPYHYSSPPPPPKK-------PYKYSSPPP 223
           PP Y   SPP   Y Y SPPPPVY   SPPPPY Y SPPPPP K        YKY SPPP
Sbjct: 323 PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 382

Query: 222 PEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY---SPPPPYHYSSPPPPPKKPYYYHSPPP 52
           P         Y SPPPP  PY Y SPPPPVY   SPPPP H  SPPP    P+Y ++   
Sbjct: 383 PYK-------YPSPPPP--PYKYPSPPPPVYKYKSPPPPVH--SPPP----PHYIYA--- 424

Query: 51  PVYSPPPPYHY 19
              SPPPPYHY
Sbjct: 425 ---SPPPPYHY 432

[2][TOP]
>UniRef100_Q7DMV8 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q7DMV8_PHAVU
          Length = 230

 Score =  276 bits (706), Expect = 1e-72
 Identities = 134/219 (61%), Positives = 150/219 (68%), Gaps = 23/219 (10%)
 Frame = -3

Query: 588 TLLVALVSLTLPSLISANSYLYSS-PPPPKVY-------PPVSPPPKVY-----PPVYSP 448
           TL + L+SL  PS   A++Y+YSS PPPPK Y       P  SPPP  Y     PP +SP
Sbjct: 13  TLALTLISL-FPSQTLADNYIYSSPPPPPKPYYYQSPPPPKHSPPPPYYYHSPPPPKHSP 71

Query: 447 PPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSP 268
           PP  Y    PPPK  PP  PPY+Y SPPPP +SPP  PY+Y SPPPP +SPPPPY+Y SP
Sbjct: 72  PPPYYYHSPPPPKHSPP--PPYYYHSPPPPKHSPP-PPYYYHSPPPPKHSPPPPYYYHSP 128

Query: 267 PPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPK----KPYYYHSPPPPVYSPPPPYH 109
           PPP   P  PY Y SPPPP+H   P  YYHSPPPPK     PYYYHSPPPP +SPPPPY+
Sbjct: 129 PPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYY 188

Query: 108 YSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           Y SPPPP   P  PYYYHSPPPP +SPPPPY+Y SPPPP
Sbjct: 189 YHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP 227

 Score =  184 bits (468), Expect = 4e-45
 Identities = 89/146 (60%), Positives = 97/146 (66%), Gaps = 11/146 (7%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y Y SPPPPK  PP   PP  Y    PP +SPPP  Y    PPPK  PP  PPY+Y SPP
Sbjct: 91  YYYHSPPPPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP--PPYYYHSPP 145

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPY 193
           PP +SPP  PY+Y SPPPP +SPPPPY+Y SPPPP   P  PY Y SPPPP+H   P  Y
Sbjct: 146 PPKHSPPP-PYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYY 204

Query: 192 YHSPPPPKK----PYYYHSPPPPVYS 127
           YHSPPPPK     PYYYHSPPPP +S
Sbjct: 205 YHSPPPPKHSPPPPYYYHSPPPPKHS 230

[3][TOP]
>UniRef100_Q09083 Hydroxyproline-rich glycoprotein n=1 Tax=Phaseolus vulgaris
           RepID=Q09083_PHAVU
          Length = 580

 Score =  276 bits (706), Expect = 1e-72
 Identities = 134/219 (61%), Positives = 150/219 (68%), Gaps = 23/219 (10%)
 Frame = -3

Query: 588 TLLVALVSLTLPSLISANSYLYSS-PPPPKVY-------PPVSPPPKVY-----PPVYSP 448
           TL + L+SL  PS   A++Y+YSS PPPPK Y       P  SPPP  Y     PP +SP
Sbjct: 12  TLALTLISL-FPSQTLADNYIYSSPPPPPKPYYYQSPPPPKHSPPPPYYYHSPPPPKHSP 70

Query: 447 PPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSP 268
           PP  Y    PPPK  PP  PPY+Y SPPPP +SPP  PY+Y SPPPP +SPPPPY+Y SP
Sbjct: 71  PPPYYYHSPPPPKHSPP--PPYYYHSPPPPKHSPP-PPYYYHSPPPPKHSPPPPYYYHSP 127

Query: 267 PPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPK----KPYYYHSPPPPVYSPPPPYH 109
           PPP   P  PY Y SPPPP+H   P  YYHSPPPPK     PYYYHSPPPP +SPPPPY+
Sbjct: 128 PPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYY 187

Query: 108 YSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           Y SPPPP   P  PYYYHSPPPP +SPPPPY+Y SPPPP
Sbjct: 188 YHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP 226

 Score =  258 bits (659), Expect = 3e-67
 Identities = 123/191 (64%), Positives = 132/191 (69%), Gaps = 14/191 (7%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y Y SPPPPK  PP   PP  Y    PP +SPPP  Y    PPPK  PP  PPY+Y SPP
Sbjct: 122 YYYHSPPPPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP--PPYYYHSPP 176

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPY 193
           PP +SPP  PY+Y SPPPP +SPPPPY+Y SPPPP   P  PY Y SPPPP+H   P  Y
Sbjct: 177 PPKHSPPP-PYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYY 235

Query: 192 YHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY---SPP 34
           YHSPPPPK     PYYYHSPPPP +SPPPPY+Y SPPPP K PY Y SPPPPVY   SPP
Sbjct: 236 YHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPP-KNPYKYSSPPPPVYKYKSPP 294

Query: 33  PPYHYTSPPPP 1
           PPY Y SPPPP
Sbjct: 295 PPYKYPSPPPP 305

 Score =  254 bits (648), Expect = 5e-66
 Identities = 124/207 (59%), Positives = 134/207 (64%), Gaps = 30/207 (14%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y Y SPPPPK  PP   PP  Y    PP +SPPP  Y    PPPK  PP  PPY+Y SPP
Sbjct: 74  YYYHSPPPPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP--PPYYYHSPP 128

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPY---------H-------YSSPPPP---PKKPYK 241
           PP +SPP  PY+Y SPPPP +SPPPPY         H       Y SPPPP   P  PY 
Sbjct: 129 PPKHSPPP-PYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYY 187

Query: 240 YSSPPPPEHHVSPKPYYHSPPPPK----KPYYYHSPPPPVYSPPPPYHYSSPPPP---PK 82
           Y SPPPP+H   P  YYHSPPPPK     PYYYHSPPPP +SPPPPY+Y SPPPP   P 
Sbjct: 188 YHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP 247

Query: 81  KPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            PYYYHSPPPP +SPPPPY+Y SPPPP
Sbjct: 248 PPYYYHSPPPPKHSPPPPYYYHSPPPP 274

 Score =  233 bits (594), Expect = 9e-60
 Identities = 122/207 (58%), Positives = 129/207 (62%), Gaps = 30/207 (14%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y Y SPPPPK  PP   PP  Y    PP +SPPP  Y    PPPK  PP  PPY+Y SPP
Sbjct: 138 YYYHSPPPPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP--PPYYYHSPP 192

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPY 193
           PP +SPP  PY+Y SPPPP +SPPPPY+Y SPPPP   P  PY Y SPPPP+H   P  Y
Sbjct: 193 PPKHSPPP-PYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYY 251

Query: 192 YH----------------SPPPPKKPYYYHSPPPPVY---SPPPPYHYSSPPPPPKKPYY 70
           YH                SPPPPK PY Y SPPPPVY   SPPPPY Y SPPPP   PY 
Sbjct: 252 YHSPPPPKHSPPPPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPP---PYK 308

Query: 69  YHSPPPPVY---SPPPP-YHYTSPPPP 1
           Y SPPPPVY   SPPPP Y Y SPPPP
Sbjct: 309 YSSPPPPVYKYKSPPPPVYKYKSPPPP 335

 Score =  228 bits (581), Expect = 3e-58
 Identities = 125/221 (56%), Positives = 130/221 (58%), Gaps = 44/221 (19%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVSPPPKVYP----PVY---SPPPKVYPPVSPPPKV-YP-PVSPPYH 379
            Y Y+SPPPP  YP   PPP  YP    PVY   SPPP VY   SPPP   YP P  PPY 
Sbjct: 357  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYK 416

Query: 378  YSSPPPPVY---SPPKKPYHYSSPPPPVY---SPPPPYHYSSPPPPPKK-------PYKY 238
            Y SPPPPVY   SPP   Y Y SPPPPVY   SPPPPY Y SPPPPP K        YKY
Sbjct: 417  YPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKY 476

Query: 237  SSPPPPEH-HVSPKPYYHSPPPPKKPYYYHSPPPPVY-------------SPPPPYHYSS 100
             SPPPP + + SP P Y  P PP  PY Y SPPPPVY             SPPPPY Y S
Sbjct: 477  KSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPS 536

Query: 99   PPPP-------PKKPYYYHSPPPPVYSPPPP-YHYTSPPPP 1
            PPPP       P   Y Y+SPPPPV+SPPPP Y Y SPPPP
Sbjct: 537  PPPPVYKYKSPPPPVYKYNSPPPPVHSPPPPHYIYASPPPP 577

 Score =  225 bits (573), Expect = 3e-57
 Identities = 125/219 (57%), Positives = 131/219 (59%), Gaps = 42/219 (19%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y Y SPPPPK  PP   PP  Y    PP +SPPP  Y    PPPK  PP  PPY+Y SPP
Sbjct: 202 YYYHSPPPPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP--PPYYYHSPP 256

Query: 363 PPVYSPP-----------KKPYHYSSPPPPVY---SPPPPYHYSSPPPPPKK-------P 247
           PP +SPP           K PY YSSPPPPVY   SPPPPY Y SPPPPP K        
Sbjct: 257 PPKHSPPPPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPV 316

Query: 246 YKYSSPPPPEH-HVSPKP---YYHSPPPPKKPYYYHSPPPPVY---SPPPPYHYSSPPPP 88
           YKY SPPPP + + SP P    Y+SPPPP   Y Y SPPPPVY   SPPPPY Y SPPPP
Sbjct: 317 YKYKSPPPPVYKYKSPPPPVYKYNSPPPPV--YKYKSPPPPVYKYNSPPPPYKYPSPPPP 374

Query: 87  PKK-------PYYYHSPPPPVY---SPPPPYHYTSPPPP 1
           P K        Y Y SPPPPVY   SPPPPY Y SPPPP
Sbjct: 375 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP 413

 Score =  224 bits (570), Expect = 6e-57
 Identities = 120/211 (56%), Positives = 127/211 (60%), Gaps = 34/211 (16%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y Y SPPPPK  PP   PP  Y    PP +SPPP  Y    PPPK  PP  PPY+Y SPP
Sbjct: 170 YYYHSPPPPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP--PPYYYHSPP 224

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPY---------H------YSSPPPPPKKPYKYSSP 229
           PP +SPP  PY+Y SPPPP +SPPPPY         H      Y   PPPPK PYKYSSP
Sbjct: 225 PPKHSPPP-PYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKNPYKYSSP 283

Query: 228 PPPEH-HVSPKPYYHSPPPPKKPYYYHSPPPPVY---SPPPP-YHYSSPPP-------PP 85
           PPP + + SP P Y  P PP  PY Y SPPPPVY   SPPPP Y Y SPPP       PP
Sbjct: 284 PPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPP 343

Query: 84  KKPYYYHSPPPPVY---SPPPPYHYTSPPPP 1
              Y Y SPPPPVY   SPPPPY Y SPPPP
Sbjct: 344 PPVYKYKSPPPPVYKYNSPPPPYKYPSPPPP 374

 Score =  221 bits (563), Expect = 4e-56
 Identities = 127/236 (53%), Positives = 129/236 (54%), Gaps = 59/236 (25%)
 Frame = -3

Query: 531 YLYSSPPPPK-VYPPVSPPPKVY-----PPVY---SPPPKVYPPVSPPPKVYPPVSPP-- 385
           Y Y SPPPPK  Y   SPPP VY     PP Y   SPPP  Y   SPPP VY   SPP  
Sbjct: 266 YYYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPP 325

Query: 384 -YHYSSPPPPVY---SPPKKPYHYSSPPPPVY---SPPPPYHYSSPPPPPKK-------P 247
            Y Y SPPPPVY   SPP   Y Y SPPPPVY   SPPPPY Y SPPPPP K        
Sbjct: 326 VYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPV 385

Query: 246 YKYSSPPPPEH-HVSPKPYYHSPPPPKKPYYYHSPPPPVY-------------------- 130
           YKY SPPPP + + SP P Y  P PP  PY Y SPPPPVY                    
Sbjct: 386 YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVY 445

Query: 129 ---SPPPPYHYSSPPPPPKK-------PYYYHSPPPPVY---SPPPPYHYTSPPPP 1
              SPPPPY Y SPPPPP K        Y Y SPPPPVY   SPPPPY Y SPPPP
Sbjct: 446 KYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP 501

 Score =  218 bits (554), Expect = 4e-55
 Identities = 126/218 (57%), Positives = 129/218 (59%), Gaps = 41/218 (18%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPV-----SPPPKVYPPVYS-PPPKVYPPVSPPPKV-YP-PVSPPYHY 376
           Y Y SPPPPK  PP      SPPP   P  YS PPP VY   SPPP   YP P  PPY Y
Sbjct: 250 YYYHSPPPPKHSPPPPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKY 309

Query: 375 SSPPPPVY---SPPKKPYHYSSPPPPVY---SPPPP-YHYSSPPPPPKKPYKYSSPPPPE 217
           SSPPPPVY   SPP   Y Y SPPPPVY   SPPPP Y Y SPPPP    YKY+SPPPP 
Sbjct: 310 SSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPV---YKYNSPPPPY 366

Query: 216 HHVSPKP---YYHSPPPPKKPYYYHSPPPPVY---SPPPPYHYSSPPPPPKK-------P 76
            + SP P    Y SPPPP   Y Y SPPPPVY   SPPPPY Y SPPPPP K        
Sbjct: 367 KYPSPPPPPYKYPSPPPPV--YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPV 424

Query: 75  YYYHSPPPPVY-------------SPPPPYHYTSPPPP 1
           Y Y+SPPPPVY             SPPPPY Y SPPPP
Sbjct: 425 YKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP 462

 Score =  198 bits (503), Expect = 3e-49
 Identities = 116/200 (58%), Positives = 119/200 (59%), Gaps = 29/200 (14%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYP----PVY---SPPPKVYPPVSPPPKVY----PPVSPP 385
           Y Y SPPPP  YP   PPP  YP    PVY   SPPP VY   SPPP VY    PP  PP
Sbjct: 396 YKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPP--PP 453

Query: 384 YHYSSPPPPVY---SPPKKPYHYSSPPPPVY---SPPPPYHYSSPPPPPKKPYKYSSPPP 223
           Y Y SPPPP Y   SPP   Y Y SPPPPVY   SPPPPY Y SPPPPP   YKYSSPPP
Sbjct: 454 YKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPP---YKYSSPPP 510

Query: 222 PEH-HVSPKP---YYHSPPPPKKPYYYHSPPPPVY---SPPPP-YHYSSPPPPPKKP--- 76
           P + + SP P    Y SPPPP   Y Y SPPPPVY   SPPPP Y Y+SPPPP   P   
Sbjct: 511 PVYKYKSPPPPVYKYKSPPPP---YKYPSPPPPVYKYKSPPPPVYKYNSPPPPVHSPPPP 567

Query: 75  -YYYHSPPPPVYSPPPPYHY 19
            Y Y SP       PPPYHY
Sbjct: 568 HYIYASP-------PPPYHY 580

[4][TOP]
>UniRef100_Q9M6R7 Extensin n=1 Tax=Pisum sativum RepID=Q9M6R7_PEA
          Length = 327

 Score =  265 bits (676), Expect = 3e-69
 Identities = 145/230 (63%), Positives = 155/230 (67%), Gaps = 26/230 (11%)
 Frame = -3

Query: 612 SLMASTTFTLLVALVSLTLPSLISANSYLYSSPPPP-KVYPPVSPPPKVYPPVYSPPPKV 436
           S M S T T+ + ++SLTLPS   AN+YLYSSPPPP K Y   SPPP V+ P   PPP  
Sbjct: 3   SQMTSITLTIALTILSLTLPS--QANNYLYSSPPPPPKPYYYQSPPPPVHSP---PPPYH 57

Query: 435 YPPVSPPPKVYPPVSPPYHYSSPPPP------VYSPPKKPYHYSSPPPPVYSPPPPYHYS 274
           Y   SPPP V+ P  PPYHYSSPPPP        SPP   Y Y SPPPPV+SPPPPYHYS
Sbjct: 58  YS--SPPPPVHSP-PPPYHYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPVHSPPPPYHYS 114

Query: 273 SPPPPPKKPYKYSSPPPPEH-HVSPKP---YYHSPPPP-KKPYYYHSPPPPVY---SPPP 118
           SPPPPPKK YKYSSPPPP + + SP P    Y SPPPP KKPY Y SPPPPVY   SPPP
Sbjct: 115 SPPPPPKKSYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYKSPPP 174

Query: 117 P-YHYSSP---------PPPPKKPYYYHSPPPPVY-SPPPPYHYTSPPPP 1
           P Y Y SP         PPPPKK Y Y SPPPPVY SPPPPY Y SPPPP
Sbjct: 175 PVYKYKSPPPPVYKYQSPPPPKKSYKYPSPPPPVYKSPPPPYKYQSPPPP 224

 Score =  229 bits (583), Expect = 2e-58
 Identities = 128/216 (59%), Positives = 133/216 (61%), Gaps = 39/216 (18%)
 Frame = -3

Query: 531 YLYSSPPPP--KVYPPVSPPPKVY------PPVY---SPPPKVYPPV---SPPPKVYPPV 394
           Y YSSPPPP  K Y   SPPP VY      PPVY   SPPP V  P    SPPP VY   
Sbjct: 111 YHYSSPPPPPKKSYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYK 170

Query: 393 SPP---YHYSSPPPPVYS-----PPKKPYHYSSPPPPVY-SPPPPYHYSSPPPPPKK--- 250
           SPP   Y Y SPPPPVY      PPKK Y Y SPPPPVY SPPPPY Y SPPPPP K   
Sbjct: 171 SPPPPVYKYKSPPPPVYKYQSPPPPKKSYKYPSPPPPVYKSPPPPYKYQSPPPPPYKYSS 230

Query: 249 ----PYKYSSPPPPEHHVSP----KPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPP 94
                YKY+SPPPP  H+SP    KP+   PPP   P Y +  PPPVYSPPP Y Y SPP
Sbjct: 231 PPPPVYKYNSPPPPYKHISPPTPGKPFKFPPPPT--PIYKYKSPPPVYSPPPVYKYKSPP 288

Query: 93  PP---PKKPYY-YHSPPPPVYSPPPP-YHYTSPPPP 1
           PP   P  P+Y Y SPPPPVYSPPPP Y Y SPPPP
Sbjct: 289 PPVYSPPPPHYVYSSPPPPVYSPPPPHYIYASPPPP 324

 Score =  149 bits (375), Expect = 2e-34
 Identities = 99/215 (46%), Positives = 102/215 (47%), Gaps = 72/215 (33%)
 Frame = -3

Query: 534 SYLYSSPPPPKVYPPVSPPPKVY-------------------PPVY---SPPPKVYPPVS 421
           SY YSSPPPP VY   SPPP VY                   PPVY   SPPP VY   S
Sbjct: 123 SYKYSSPPPP-VYKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYKSPPPPVYKYKS 181

Query: 420 PPPKVYPPVSPP-----YHYSSPPPPVY----------SPPKKPYHYSSPPPPVY---SP 295
           PPP VY   SPP     Y Y SPPPPVY          SPP  PY YSSPPPPVY   SP
Sbjct: 182 PPPPVYKYQSPPPPKKSYKYPSPPPPVYKSPPPPYKYQSPPPPPYKYSSPPPPVYKYNSP 241

Query: 294 PPPYHYSSPP---------PPPKKPYKYSSPPP---------------------PEHHV- 208
           PPPY + SPP         PPP   YKY SPPP                     P H+V 
Sbjct: 242 PPPYKHISPPTPGKPFKFPPPPTPIYKYKSPPPVYSPPPVYKYKSPPPPVYSPPPPHYVY 301

Query: 207 -SPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHY 106
            SP P  +SPPPP   Y Y SP       PPPYHY
Sbjct: 302 SSPPPPVYSPPPPH--YIYASP-------PPPYHY 327

[5][TOP]
>UniRef100_B9NAX9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NAX9_POPTR
          Length = 312

 Score =  264 bits (675), Expect = 4e-69
 Identities = 127/204 (62%), Positives = 137/204 (67%), Gaps = 14/204 (6%)
 Frame = -3

Query: 570 VSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVY 403
           + L   S+++   Y Y SPPPP   PP   PP  Y    PP  SPPP  +    PPPK  
Sbjct: 19  ICLVATSVVAYEPYYYKSPPPPSQSPP---PPYHYSSPPPPKKSPPPPYHYTSPPPPKKS 75

Query: 402 PPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSS 232
           PP  PPYHYSSPPPP  SPP  PYHYSSPPPP  SPPPPYHYSSPPPP   P  PY YSS
Sbjct: 76  PP--PPYHYSSPPPPKKSPP-PPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSS 132

Query: 231 PPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPY 73
           PPPP+    P  +Y SPPPPKK    PY+Y SPPPP  SPPPPYHYSSPPPP   P  PY
Sbjct: 133 PPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPY 192

Query: 72  YYHSPPPPVYSPPPPYHYTSPPPP 1
           +Y SPPPP  SPPPPYHY+SPPPP
Sbjct: 193 HYTSPPPPKKSPPPPYHYSSPPPP 216

 Score =  263 bits (671), Expect = 1e-68
 Identities = 126/191 (65%), Positives = 133/191 (69%), Gaps = 14/191 (7%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y YSSPPPPK  PP   PP  Y    PP  SPPP  +    PPPK  PP  PPYHYSSPP
Sbjct: 128 YHYSSPPPPKKSPP---PPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPP--PPYHYSSPP 182

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPY 193
           PP  SPP  PYHY+SPPPP  SPPPPYHYSSPPPP   P  PY Y+SPPPP+    P  +
Sbjct: 183 PPKKSPPP-PYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYH 241

Query: 192 YHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSPP 34
           Y SPPPPKK    PY+Y SPPPP  SPPPPYHYSSPPPP   P  PY+Y SPPPP  SPP
Sbjct: 242 YSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPP 301

Query: 33  PPYHYTSPPPP 1
           PPYHYTSPPPP
Sbjct: 302 PPYHYTSPPPP 312

 Score =  248 bits (634), Expect = 2e-64
 Identities = 133/228 (58%), Positives = 139/228 (60%), Gaps = 43/228 (18%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPP-----VSPPP--KVYPPVYS----PPPKVYPPVS---- 421
           PS      Y YSSPPPPK  PP      SPPP  K  PP Y     PPPK  PP      
Sbjct: 40  PSQSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYS 99

Query: 420 --PPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPP---------VY-------SP 295
             PPPK  PP  PPYHYSSPPPP  SPP  PYHYSSPPPP                  SP
Sbjct: 100 SPPPPKKSPP--PPYHYSSPPPPKKSPPP-PYHYSSPPPPKKSPPPPYHYSSPPPPKKSP 156

Query: 294 PPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPP 136
           PPPYHYSSPPPP   P  PY YSSPPPP+    P  +Y SPPPPKK    PY+Y SPPPP
Sbjct: 157 PPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPP 216

Query: 135 VYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             SPPPPYHY+SPPPP   P  PY+Y SPPPP  SPPPPYHY+SPPPP
Sbjct: 217 KKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPP 264

 Score =  248 bits (632), Expect = 4e-64
 Identities = 126/207 (60%), Positives = 133/207 (64%), Gaps = 30/207 (14%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y YSSPPPPK  PP   PP  Y    PP  SPPP  +    PPPK  PP  PPYHYSSPP
Sbjct: 96  YHYSSPPPPKKSPP---PPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPP--PPYHYSSPP 150

Query: 363 PPVYSPPKKPYHYSSPPPP---------VY-------SPPPPYHYSSPPPP---PKKPYK 241
           PP  SPP  PYHYSSPPPP                  SPPPPYHY+SPPPP   P  PY 
Sbjct: 151 PPKKSPPP-PYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYH 209

Query: 240 YSSPPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PK 82
           YSSPPPP+    P  +Y SPPPPKK    PY+Y SPPPP  SPPPPYHYSSPPPP   P 
Sbjct: 210 YSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPP 269

Query: 81  KPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            PY+Y SPPPP  SPPPPYHY+SPPPP
Sbjct: 270 PPYHYSSPPPPKKSPPPPYHYSSPPPP 296

[6][TOP]
>UniRef100_Q9M564 CRANTZ hydroxyproline-rich glycoprotein n=1 Tax=Manihot esculenta
           RepID=Q9M564_MANES
          Length = 232

 Score =  257 bits (657), Expect = 5e-67
 Identities = 127/204 (62%), Positives = 132/204 (64%), Gaps = 27/204 (13%)
 Frame = -3

Query: 531 YLYSSPPPP--KVYPPV----------SPPPKVY-----PPVYSPPPKVYPPVSPPPKVY 403
           Y Y SPPPP     PP           SPPP  Y     PPV SPPP  Y    PPP   
Sbjct: 18  YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKS 77

Query: 402 PPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSS 232
           PP  PPY+Y SPPPPV SPP  PY+Y SPPPPV SPPPPY+Y SPPPP   P  PY Y S
Sbjct: 78  PP--PPYYYHSPPPPVKSPP-PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHS 134

Query: 231 PPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPY 73
           PPPP     P  YYHSPPPP K    PYYYHSPPPPV SPPPPY+Y SPPPP   P  PY
Sbjct: 135 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 194

Query: 72  YYHSPPPPVYSPPPPYHYTSPPPP 1
           YYHSPPPPV SPPPPY+Y SPPPP
Sbjct: 195 YYHSPPPPVKSPPPPYYYHSPPPP 218

 Score =  253 bits (646), Expect = 9e-66
 Identities = 121/186 (65%), Positives = 127/186 (68%), Gaps = 10/186 (5%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
           L +SP PP  Y   SPPP    P  SPPP  Y    PPP   PP  PPY+Y SPPPPV S
Sbjct: 8   LKTSPSPPPPYYYKSPPP----PSPSPPPPYYYKSPPPPSPSPP--PPYYYHSPPPPVKS 61

Query: 348 PPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPP 178
           PP  PY+Y SPPPPV SPPPPY+Y SPPPP   P  PY Y SPPPP     P  YYHSPP
Sbjct: 62  PPP-PYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 120

Query: 177 PPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHY 19
           PP K    PYYYHSPPPPV SPPPPY+Y SPPPP   P  PYYYHSPPPPV SPPPPY+Y
Sbjct: 121 PPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYY 180

Query: 18  TSPPPP 1
            SPPPP
Sbjct: 181 HSPPPP 186

 Score =  252 bits (644), Expect = 2e-65
 Identities = 124/199 (62%), Positives = 131/199 (65%), Gaps = 15/199 (7%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y Y SPPPP    P  PPP  Y    PPV SPPP  Y    PPP   PP  P
Sbjct: 26  PSPSPPPPYYYKSPPPPS---PSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPP--P 80

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPE 217
           PY+Y SPPPPV SPP  PY+Y SPPPPV SPPPPY+Y SPPPP   P  PY Y SPPPP 
Sbjct: 81  PYYYHSPPPPVKSPPP-PYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV 139

Query: 216 HHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSP 58
               P  YYHSPPPP K    PYYYHSPPPPV SPPPPY+Y SPPPP   P  PYYYHSP
Sbjct: 140 KSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSP 199

Query: 57  PPPVYSPPPPYH-YTSPPP 4
           PPPV SPPPPY+ ++ PPP
Sbjct: 200 PPPVKSPPPPYYYHSPPPP 218

 Score =  183 bits (464), Expect = 1e-44
 Identities = 106/192 (55%), Positives = 111/192 (57%), Gaps = 39/192 (20%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPV------------SPPPKVY-----PPVYSPPPKVY-- 433
           PS      Y Y SPPPP   PP             SPPP  Y     PPV SPPP  Y  
Sbjct: 42  PSPSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYH 101

Query: 432 ---PPV-SPPPKVY-----PPVS---PPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPP 289
              PPV SPPP  Y     PPV    PPY+Y SPPPPV SPP  PY+Y SPPPPV SPPP
Sbjct: 102 SPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPP-PYYYHSPPPPVKSPPP 160

Query: 288 PYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK---PYYYH-SPPPPVY 130
           PY+Y SPPPP   P  PY Y SPPPP     P  YYHSPPPP K   P YY+ SPPPPV 
Sbjct: 161 PYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK 220

Query: 129 SPPPP-YHYSSP 97
           SPPPP Y Y+SP
Sbjct: 221 SPPPPVYIYASP 232

[7][TOP]
>UniRef100_Q9ZW80 Putative extensin n=1 Tax=Arabidopsis thaliana RepID=Q9ZW80_ARATH
          Length = 212

 Score =  253 bits (646), Expect = 9e-66
 Identities = 129/205 (62%), Positives = 139/205 (67%), Gaps = 11/205 (5%)
 Frame = -3

Query: 582 LVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY 403
           +VA+++L + S ++   Y YSSPPPP  Y   SPP    PPV SPPP  Y   SPPP V 
Sbjct: 14  VVAMLALLVGSAMATEPYYYSSPPPPYEYK--SPP----PPVKSPPPP-YEYKSPPPPVK 66

Query: 402 PPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSS 232
            P  PPY+Y SPPPPV SPP  PY YSSPPPPV SPPPPY+Y SPPPP   P  PY Y S
Sbjct: 67  SP-PPPYYYHSPPPPVKSPP-PPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHS 124

Query: 231 PPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPY 73
           PPPP     P  YYHSPPPP K    PYYYHSPPPPV SPPPPY+Y SPPPP   P  PY
Sbjct: 125 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 184

Query: 72  YYHSPPPPVYSPPPP-YHYTSPPPP 1
            Y SPPPPV SPPPP Y Y SPPPP
Sbjct: 185 LYSSPPPPVKSPPPPVYIYASPPPP 209

 Score =  159 bits (401), Expect = 2e-37
 Identities = 87/149 (58%), Positives = 91/149 (61%), Gaps = 7/149 (4%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y+YSSPPPP   PP   PP  Y    PPV SPPP  Y    PPP   PP  PPY+Y SPP
Sbjct: 88  YVYSSPPPPVKSPP---PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPP--PPYYYHSPP 142

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHS 184
           PPV SPP  PY+Y SPPPPV SPPPPY+Y SPPPP K      SPPPP         Y S
Sbjct: 143 PPVKSPP-PPYYYHSPPPPVKSPPPPYYYHSPPPPVK------SPPPPY-------LYSS 188

Query: 183 PPPPKKPYYYHSPPPPVY---SPPPPYHY 106
           PPPP K     SPPPPVY   SPPPP HY
Sbjct: 189 PPPPVK-----SPPPPVYIYASPPPPTHY 212

[8][TOP]
>UniRef100_Q40768 Extensin n=1 Tax=Prunus dulcis RepID=Q40768_PRUDU
          Length = 278

 Score =  249 bits (636), Expect = 1e-64
 Identities = 149/271 (54%), Positives = 157/271 (57%), Gaps = 67/271 (24%)
 Frame = -3

Query: 612 SLMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVS----PPPKVYPPV-YSP 448
           S + S   TLLVA+VSL+LPS  SAN Y YSSPPPP V PP      PPP   PPV YSP
Sbjct: 7   SSVTSLVVTLLVAIVSLSLPSETSAN-YPYSSPPPP-VSPPYHYKSPPPPSPTPPVHYSP 64

Query: 447 PPKVYPPVSPPPKV-YPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPP-PYHYS 274
           P   Y   SPPP V Y P   PYHY SPPPPVYSPPK PYHY SPPPP  SPP  PYHY 
Sbjct: 65  PKHPYHYKSPPPPVHYSPPKHPYHYKSPPPPVYSPPKHPYHYKSPPPPSPSPPKHPYHYK 124

Query: 273 SPPPP----PKKPYKYSSPPPPE--------HHVSPKP----------YYHSPPPP---K 169
           SPPPP    PK PY Y SPPPP         H+ SP P          +Y SPPPP   K
Sbjct: 125 SPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPPK 184

Query: 168 KPYYYHSPPPP------VYSPPP-PYHYSSPPPP--PKKPYYYHSPPPP-------VYSP 37
           KPY+Y SPPPP      VYSPP  PYHY SPPPP  PKKPY+Y SPPPP       VYSP
Sbjct: 185 KPYHYKSPPPPPSPTPPVYSPPKHPYHYKSPPPPSPPKKPYHYKSPPPPTPVYKPPVYSP 244

Query: 36  PPP-----------------YHYT--SPPPP 1
           PPP                 + Y   SPPPP
Sbjct: 245 PPPPKKPYKPPTPPVHTAPPHPYIYSSPPPP 275

 Score =  135 bits (339), Expect = 4e-30
 Identities = 73/136 (53%), Positives = 76/136 (55%), Gaps = 10/136 (7%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVY------PPVSPPPKVYPPVSPPYHYSS 370
           Y Y SPPPP   PP  P     PP  SPP K Y      PP SP P VY P   PYHY S
Sbjct: 155 YHYKSPPPPSPSPPKHPYHYKSPPPPSPPKKPYHYKSPPPPPSPTPPVYSPPKHPYHYKS 214

Query: 369 PPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYS----SPPPPPKKPYKYSSPPPPEHHVSP 202
           PPPP  SPPKKPYHY SPPPP         Y     SPPPPPKKPYK   P PP H   P
Sbjct: 215 PPPP--SPPKKPYHYKSPPPPTP------VYKPPVYSPPPPPKKPYK--PPTPPVHTAPP 264

Query: 201 KPYYHSPPPPKKPYYY 154
            PY +S PPP  P++Y
Sbjct: 265 HPYIYSSPPP--PHHY 278

[9][TOP]
>UniRef100_B9IAD8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IAD8_POPTR
          Length = 379

 Score =  234 bits (597), Expect = 4e-60
 Identities = 124/217 (57%), Positives = 132/217 (60%), Gaps = 23/217 (10%)
 Frame = -3

Query: 585 LLVALVSLTLPS---LISANSYLYSSPPPPKVY---PPVSP-PPKVYPPVYSPPPKVYPP 427
           L VALV L + S    +S ++Y+YSSPPPP VY   PP SP PP  Y     PPP  +PP
Sbjct: 17  LAVALVILFVSSNVGSVSGDAYVYSSPPPPYVYKSPPPPSPSPPPPYEYKSPPPPSPHPP 76

Query: 426 VS------PPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPP 265
            +      PPP   PP  PPY Y SPPPP  SPP  PY Y SPPPP  SPPPPY Y SPP
Sbjct: 77  PTYVYKSPPPPSPSPP--PPYIYKSPPPPSPSPP-PPYEYKSPPPPSSSPPPPYIYKSPP 133

Query: 264 PP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPK----KPYYYHSPPPPVYSPPPPYHY 106
           PP   P  PY Y SPPPP     P   Y SPPPP      PYYY SPPPP  SPPPPY Y
Sbjct: 134 PPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVY 193

Query: 105 SSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
            SPPPP   P  PYYY SP PP  SPPPPY+Y SPPP
Sbjct: 194 KSPPPPSSSPPPPYYYKSPSPPSSSPPPPYYYKSPPP 230

 Score =  233 bits (595), Expect = 7e-60
 Identities = 119/200 (59%), Positives = 123/200 (61%), Gaps = 15/200 (7%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y Y SPPPP   PP   PP +Y    PP  SPPP       PPP   PP  P
Sbjct: 103 PSPSPPPPYEYKSPPPPSSSPP---PPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPP--P 157

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPE 217
           PY Y SPPPP  SPP  PY+Y SPPPP  SPPPPY Y SPPPP   P  PY Y SP PP 
Sbjct: 158 PYIYKSPPPPSPSPPP-PYYYKSPPPPSPSPPPPYVYKSPPPPSSSPPPPYYYKSPSPPS 216

Query: 216 HHVSPKPYYH-SPPP----PKKPYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHS 61
               P PYY+ SPPP    P  PYYY SPPPP  SPPPPYHY SPPPP   P  PYYY S
Sbjct: 217 SS-PPPPYYYKSPPPLSPSPPPPYYYKSPPPPDPSPPPPYHYKSPPPPSPSPPPPYYYRS 275

Query: 60  PPPPVYSPPPPYHYTSPPPP 1
           PPPP  SPPPPYHY+SPPPP
Sbjct: 276 PPPPSSSPPPPYHYSSPPPP 295

 Score =  232 bits (591), Expect = 2e-59
 Identities = 118/214 (55%), Positives = 125/214 (58%), Gaps = 29/214 (13%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y+Y SPPPP    P  PPP VY    PP  SPPP       PPP   PP  P
Sbjct: 119 PSSSPPPPYIYKSPPPPS---PSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPP--P 173

Query: 387 PYHYSSPPPP--------VY-------SPPKKPYHYSSPPPPVYSPPPPYHYSSPP---P 262
           PY+Y SPPPP        VY       S P  PY+Y SP PP  SPPPPY+Y SPP   P
Sbjct: 174 PYYYKSPPPPSPSPPPPYVYKSPPPPSSSPPPPYYYKSPSPPSSSPPPPYYYKSPPPLSP 233

Query: 261 PPKKPYKYSSPPPPEHHVSPKPYYHSPPPPK----KPYYYHSPPPPVYSPPPPYHYSSPP 94
            P  PY Y SPPPP+    P  +Y SPPPP      PYYY SPPPP  SPPPPYHYSSPP
Sbjct: 234 SPPPPYYYKSPPPPDPSPPPPYHYKSPPPPSPSPPPPYYYRSPPPPSSSPPPPYHYSSPP 293

Query: 93  PP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           PP   P  PYYY SPPPP  SPPPPY+Y SPPPP
Sbjct: 294 PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 327

 Score =  224 bits (571), Expect = 4e-57
 Identities = 122/217 (56%), Positives = 125/217 (57%), Gaps = 38/217 (17%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVY------PPVSPPPKV 406
           PS      Y Y SPPPP    P  PPP VY    PP  SPPP  Y      P  SPPP  
Sbjct: 167 PSPSPPPPYYYKSPPPPS---PSPPPPYVYKSPPPPSSSPPPPYYYKSPSPPSSSPPPPY 223

Query: 405 Y----PPVSP----PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP--- 259
           Y    PP+SP    PY+Y SPPPP  SPP  PYHY SPPPP  SPPPPY+Y SPPPP   
Sbjct: 224 YYKSPPPLSPSPPPPYYYKSPPPPDPSPPP-PYHYKSPPPPSPSPPPPYYYRSPPPPSSS 282

Query: 258 PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPP 91
           P  PY YSSPPPP     P  YY SPPPP      PYYY SPPPP  SPPPPY Y SPPP
Sbjct: 283 PPPPYHYSSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPP 342

Query: 90  P---PKKPYYYHSPPPP-------VY---SPPPPYHY 19
           P   P  PYYYHSPPP        VY   SPPPP HY
Sbjct: 343 PSPSPPPPYYYHSPPPAMKSPPLSVYIYASPPPPIHY 379

 Score =  224 bits (570), Expect = 6e-57
 Identities = 117/215 (54%), Positives = 124/215 (57%), Gaps = 30/215 (13%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y+Y SPPPP    P  PPP +Y    PP  SPPP  Y    PPP   PP  P
Sbjct: 135 PSPSPPPPYVYKSPPPPS---PSPPPPYIYKSPPPPSPSPPPPYYYKSPPPPSPSPP--P 189

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPP---PPKKPYKYSSPPPPE 217
           PY Y SPPPP  SPP  PY+Y SP PP  SPPPPY+Y SPPP    P  PY Y SPPPP+
Sbjct: 190 PYVYKSPPPPSSSPPP-PYYYKSPSPPSSSPPPPYYYKSPPPLSPSPPPPYYYKSPPPPD 248

Query: 216 HHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYY--- 67
               P  +Y SPPPP      PYYY SPPPP  SPPPPYHYSSPPPP   P  PYYY   
Sbjct: 249 PSPPPPYHYKSPPPPSPSPPPPYYYRSPPPPSSSPPPPYHYSSPPPPSPSPPPPYYYKSP 308

Query: 66  ------------H-SPPPPVYSPPPPYHYTSPPPP 1
                       + SPPPP  SPPPPY Y SPPPP
Sbjct: 309 PPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPP 343

[10][TOP]
>UniRef100_Q43687 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q43687_VIGUN
          Length = 242

 Score =  233 bits (594), Expect = 9e-60
 Identities = 117/219 (53%), Positives = 131/219 (59%), Gaps = 16/219 (7%)
 Frame = -3

Query: 609 LMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYP 430
           L       L + L+S  + S ++A++Y +S PPPP       PPP + PP   PP K   
Sbjct: 13  LRPQMAIALAIVLLSFNVAS-VAADAYTHSPPPPPPYVYSSPPPPSLSPP---PPYKYKD 68

Query: 429 P-----VSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPP 265
           P       PPP   PP  PPY+Y SPPPP  SPP  PY+Y SPPPP  SPPPPY+Y SPP
Sbjct: 69  PHYEYKSPPPPSPSPP--PPYYYKSPPPPSPSPPP-PYYYKSPPPPSPSPPPPYYYKSPP 125

Query: 264 PP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP-----YYYHSPPPPVYSPPPPYH 109
           PP   P  PY Y SPPPP     P  YY SPPPP        YYY SPPPP  SPPPPY+
Sbjct: 126 PPRPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPSYYYKSPPPPSPSPPPPYY 185

Query: 108 YSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           Y SPPPP   P  PYYY SPPPP  SPPPPY+Y SPPPP
Sbjct: 186 YKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 224

 Score =  223 bits (567), Expect = 1e-56
 Identities = 113/199 (56%), Positives = 121/199 (60%), Gaps = 23/199 (11%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY-----------PPVYSPPPKVYPPVSPPPKVYPPVSPP 385
           Y+YSSPPPP + PP   PP  Y           PP  SPPP  Y    PPP   PP  PP
Sbjct: 48  YVYSSPPPPSLSPP---PPYKYKDPHYEYKSPPPPSPSPPPPYYYKSPPPPSPSPP--PP 102

Query: 384 YHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEH 214
           Y+Y SPPPP  SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP  
Sbjct: 103 YYYKSPPPPSPSPPP-PYYYKSPPPPRPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSP 161

Query: 213 HVSPKPYYH-SPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSP 58
              P  YY+ SPPPP      PYYY SPPPP  SPPPPY+Y SPPPP   P  PYYY SP
Sbjct: 162 SPPPPSYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP 221

Query: 57  PPPVYSPPPPYH-YTSPPP 4
           PPP Y    PY+ Y SPPP
Sbjct: 222 PPPPYEHKDPYYQYKSPPP 240

 Score =  167 bits (424), Expect = 5e-40
 Identities = 91/168 (54%), Positives = 97/168 (57%), Gaps = 13/168 (7%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP+  PP  P
Sbjct: 79  PSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPRPSPP--P 133

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPP-YHYSSPPPP---PKKPYKYSSPPPP 220
           PY+Y SPPPP  SPP  PY+Y SPPPP  SPPPP Y+Y SPPPP   P  PY Y SPPPP
Sbjct: 134 PYYYKSPPPPSPSPPP-PYYYKSPPPPSPSPPPPSYYYKSPPPPSPSPPPPYYYKSPPPP 192

Query: 219 EHHVSPKPYYHSPPPPKK---PYYYH-SPPPPVYSPPPPYH-YSSPPP 91
                P  YY SPPPP     P YY+ SPPPP Y    PY+ Y SPPP
Sbjct: 193 SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPPYEHKDPYYQYKSPPP 240

[11][TOP]
>UniRef100_Q09085 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q09085_PHAVU
          Length = 368

 Score =  233 bits (593), Expect = 1e-59
 Identities = 120/234 (51%), Positives = 127/234 (54%), Gaps = 49/234 (20%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPK------------------VYPPV----------SPPPKVY-- 466
           P    +  Y Y SPPPP                    YPP           SPPP  Y  
Sbjct: 118 PYYYKSPPYYYKSPPPPSPSPSPYYYKSPPPPHKDPYYPPYYYKSPPPPSPSPPPPYYYK 177

Query: 465 ---PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSP 295
              PP  SPPP  Y    PPP   PP  PPY+Y SPPPP  SPP  PY+Y SPPPP  SP
Sbjct: 178 SPPPPSPSPPPPYYYKSPPPPDPSPP--PPYYYKSPPPPSPSPP-PPYYYKSPPPPSPSP 234

Query: 294 PPPYHYSSPPPP---------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPK----KPYYY 154
           PPPY+Y SPPPP         P  PY Y SPPPP+    P  YY SPPPP      PYYY
Sbjct: 235 PPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYY 294

Query: 153 HSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            SPPPP  SPPPPY+Y SPPPP   P  PYYY SPPPP  SPPPPY+Y SPPPP
Sbjct: 295 KSPPPPSPSPPPPYYYKSPPPPSPDPPTPYYYKSPPPPSPSPPPPYYYVSPPPP 348

 Score =  230 bits (586), Expect = 8e-59
 Identities = 114/195 (58%), Positives = 120/195 (61%), Gaps = 18/195 (9%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY--PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPP 358
           Y Y+SPPPP  Y     PP  Y  PP  SP P  Y   SPPP    P  PPY+Y SPPPP
Sbjct: 110 YYYNSPPPPYYY---KSPPYYYKSPPPPSPSPSPYYYKSPPPPHKDPYYPPYYYKSPPPP 166

Query: 357 VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYH 187
             SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP     P  YY 
Sbjct: 167 SPSPP-PPYYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYK 225

Query: 186 SPPPPK----KPYYYHSP------PPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPV 46
           SPPPP      PYYY SP      PPP  SPPPPY+Y SPPPP   P  PYYY SPPPP 
Sbjct: 226 SPPPPSPSPPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPS 285

Query: 45  YSPPPPYHYTSPPPP 1
            SPPPPY+Y SPPPP
Sbjct: 286 PSPPPPYYYKSPPPP 300

 Score =  207 bits (528), Expect = 4e-52
 Identities = 106/192 (55%), Positives = 111/192 (57%), Gaps = 20/192 (10%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP   PP  P
Sbjct: 182 PSPSPPPPYYYKSPPPPD---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP--P 236

Query: 387 PYHYSSPPPPVYSPPKKP-----YHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSS 232
           PY+Y SPPPP  SPP  P     Y+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y S
Sbjct: 237 PYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKS 296

Query: 231 PPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPPPKKP---- 76
           PPPP     P  YY SPPPP      PYYY SPPPP  SPPPPY+Y SPPPP K P    
Sbjct: 297 PPPPSPSPPPPYYYKSPPPPSPDPPTPYYYKSPPPPSPSPPPPYYYVSPPPPTKSPPPPA 356

Query: 75  YYYHSPPPPVYS 40
           Y Y SPPPP Y+
Sbjct: 357 YSYASPPPPTYN 368

 Score =  178 bits (451), Expect = 4e-43
 Identities = 100/190 (52%), Positives = 110/190 (57%), Gaps = 6/190 (3%)
 Frame = -3

Query: 552 SLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPP--KVYPPVSPPPKVYPPVSPPYH 379
           +L S + Y       P  Y P   P       +SP P  K Y   SPPP  Y   SPPY+
Sbjct: 70  ALKSKDKYEVVLKAKPFAYAP-KKPYDCEKHKHSPTPYHKPYYYNSPPPPYYYK-SPPYY 127

Query: 378 YSSPPPPVYSPPKKPYHYSSPPPPVYSPP-PPYHYSSPPPPPKKPYKYSSPPPPEHHVSP 202
           Y SPPPP  SP   PY+Y SPPPP   P  PPY+Y SPPPP        SPPPP ++ SP
Sbjct: 128 YKSPPPP--SPSPSPYYYKSPPPPHKDPYYPPYYYKSPPPPSP------SPPPPYYYKSP 179

Query: 201 KPYYHSPPPPKKPYYYHSPPPPVYSPPPPYH-YSSPPPPPK--KPYYYHSPPPPVYSPPP 31
            P   SPPPP   YYY SPPPP  SPPPPY+  S PPP P    PYYY SPPPP  SPPP
Sbjct: 180 PPPSPSPPPP---YYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 236

Query: 30  PYHYTSPPPP 1
           PY+Y SPPPP
Sbjct: 237 PYYYKSPPPP 246

[12][TOP]
>UniRef100_Q9FS16 Extensin-3 n=1 Tax=Arabidopsis thaliana RepID=EXTN3_ARATH
          Length = 427

 Score =  233 bits (593), Expect = 1e-59
 Identities = 142/235 (60%), Positives = 146/235 (62%), Gaps = 33/235 (14%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVY--PPVY-SPPP-- 442
           MAS   TLLV  +SLT  S  +AN Y YSSPPPP  +   +PP K Y  PPVY SPPP  
Sbjct: 1   MASLVATLLVLTISLTFVSQSTAN-YFYSSPPPPVKH--YTPPVKHYSPPPVYHSPPPPK 57

Query: 441 KVYPPVSPPPKVY----PPV--SPP-----YHYSSPPPPV--YSPP---------KKPYH 328
           K Y   SPPP V     PPV  SPP     Y Y SPPPPV  YSPP         KK Y 
Sbjct: 58  KHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYV 117

Query: 327 YSSPPPPV--YSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYY 154
           Y SPPPPV  YSPPP YH    PPPPKK Y Y SPPPP  H SP P YHSPPPPKK Y Y
Sbjct: 118 YKSPPPPVKHYSPPPVYH---SPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVY 174

Query: 153 HSPPPPV--YSPPPPYHYSSPPPPPKKPYYYHSPPPPV--YSPPPPYHYTSPPPP 1
            SPPPPV  YSPPP YH    PPPPKK Y Y SPPPPV  YSPPP YH  SPPPP
Sbjct: 175 KSPPPPVKHYSPPPVYH---SPPPPKKHYVYKSPPPPVKHYSPPPVYH--SPPPP 224

 Score =  219 bits (557), Expect = 2e-55
 Identities = 122/203 (60%), Positives = 128/203 (63%), Gaps = 26/203 (12%)
 Frame = -3

Query: 531 YLYSSPPPPKVY---PPV---SPPPKVY-------PPV--YSPPPKVYPPVSPPPK---V 406
           Y+Y SPPPP  +   PPV    PPPK +       PPV  YSPPP  + P  PPPK   V
Sbjct: 116 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP--PPPKKHYV 173

Query: 405 YPPVSPPYHYSSPPPPVYSPP--KKPYHYSSPPPPV--YSPPPPYHYSSPPPPPKKPYKY 238
           Y    PP  + SPPP  +SPP  KK Y Y SPPPPV  YSPPP YH    PPPPKK Y Y
Sbjct: 174 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---SPPPPKKHYVY 230

Query: 237 SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV--YSPPPPYHYSSPPPPPKKPYYYH 64
            SPPPP  H SP P YHSPPPPKK Y Y SPPPPV  YSPPP YH    PPPPKK Y Y 
Sbjct: 231 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---SPPPPKKHYVYK 287

Query: 63  SPPPPV--YSPPPPYHYTSPPPP 1
           SPPPPV  YSPPP YH  SPPPP
Sbjct: 288 SPPPPVKHYSPPPVYH--SPPPP 308

 Score =  219 bits (557), Expect = 2e-55
 Identities = 122/203 (60%), Positives = 128/203 (63%), Gaps = 26/203 (12%)
 Frame = -3

Query: 531 YLYSSPPPPKVY---PPV---SPPPKVY-------PPV--YSPPPKVYPPVSPPPK---V 406
           Y+Y SPPPP  +   PPV    PPPK +       PPV  YSPPP  + P  PPPK   V
Sbjct: 144 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP--PPPKKHYV 201

Query: 405 YPPVSPPYHYSSPPPPVYSPP--KKPYHYSSPPPPV--YSPPPPYHYSSPPPPPKKPYKY 238
           Y    PP  + SPPP  +SPP  KK Y Y SPPPPV  YSPPP YH    PPPPKK Y Y
Sbjct: 202 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---SPPPPKKHYVY 258

Query: 237 SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV--YSPPPPYHYSSPPPPPKKPYYYH 64
            SPPPP  H SP P YHSPPPPKK Y Y SPPPPV  YSPPP YH    PPPPKK Y Y 
Sbjct: 259 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---SPPPPKKHYVYK 315

Query: 63  SPPPPV--YSPPPPYHYTSPPPP 1
           SPPPPV  YSPPP YH  SPPPP
Sbjct: 316 SPPPPVKHYSPPPVYH--SPPPP 336

 Score =  219 bits (557), Expect = 2e-55
 Identities = 122/203 (60%), Positives = 128/203 (63%), Gaps = 26/203 (12%)
 Frame = -3

Query: 531 YLYSSPPPPKVY---PPV---SPPPKVY-------PPV--YSPPPKVYPPVSPPPK---V 406
           Y+Y SPPPP  +   PPV    PPPK +       PPV  YSPPP  + P  PPPK   V
Sbjct: 172 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP--PPPKKHYV 229

Query: 405 YPPVSPPYHYSSPPPPVYSPP--KKPYHYSSPPPPV--YSPPPPYHYSSPPPPPKKPYKY 238
           Y    PP  + SPPP  +SPP  KK Y Y SPPPPV  YSPPP YH    PPPPKK Y Y
Sbjct: 230 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---SPPPPKKHYVY 286

Query: 237 SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV--YSPPPPYHYSSPPPPPKKPYYYH 64
            SPPPP  H SP P YHSPPPPKK Y Y SPPPPV  YSPPP YH    PPPPKK Y Y 
Sbjct: 287 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---SPPPPKKHYVYK 343

Query: 63  SPPPPV--YSPPPPYHYTSPPPP 1
           SPPPPV  YSPPP YH  SPPPP
Sbjct: 344 SPPPPVKHYSPPPVYH--SPPPP 364

 Score =  219 bits (557), Expect = 2e-55
 Identities = 122/203 (60%), Positives = 128/203 (63%), Gaps = 26/203 (12%)
 Frame = -3

Query: 531 YLYSSPPPPKVY---PPV---SPPPKVY-------PPV--YSPPPKVYPPVSPPPK---V 406
           Y+Y SPPPP  +   PPV    PPPK +       PPV  YSPPP  + P  PPPK   V
Sbjct: 200 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP--PPPKKHYV 257

Query: 405 YPPVSPPYHYSSPPPPVYSPP--KKPYHYSSPPPPV--YSPPPPYHYSSPPPPPKKPYKY 238
           Y    PP  + SPPP  +SPP  KK Y Y SPPPPV  YSPPP YH    PPPPKK Y Y
Sbjct: 258 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---SPPPPKKHYVY 314

Query: 237 SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV--YSPPPPYHYSSPPPPPKKPYYYH 64
            SPPPP  H SP P YHSPPPPKK Y Y SPPPPV  YSPPP YH    PPPPKK Y Y 
Sbjct: 315 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---SPPPPKKHYVYK 371

Query: 63  SPPPPV--YSPPPPYHYTSPPPP 1
           SPPPPV  YSPPP YH  SPPPP
Sbjct: 372 SPPPPVKHYSPPPVYH--SPPPP 392

 Score =  213 bits (543), Expect = 8e-54
 Identities = 120/205 (58%), Positives = 127/205 (61%), Gaps = 28/205 (13%)
 Frame = -3

Query: 531 YLYSSPPPPKVY---PPV---SPPPKVY-------PPV--YSPPPKVYPPVSPPPK---V 406
           Y+Y SPPPP  +   PPV    PPPK +       PPV  YSPPP  + P  PPPK   V
Sbjct: 228 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP--PPPKKHYV 285

Query: 405 YPPVSPPYHYSSPPPPVYSPP--KKPYHYSSPPPPV--YSPPPPYHYSSPPPPPKKPYKY 238
           Y    PP  + SPPP  +SPP  KK Y Y SPPPPV  YSPPP YH    PPPPKK Y Y
Sbjct: 286 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---SPPPPKKHYVY 342

Query: 237 SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV--YSPPPPYHYSSPPPPPKKPYYYH 64
            SPPPP  H SP P YHSPPPPKK Y Y SPPPPV  YSPPP YH    PPPPK+ Y Y 
Sbjct: 343 KSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---SPPPPKEKYVYK 399

Query: 63  SPPPPV---YSPP-PPYHYTSPPPP 1
           SPPPP    YSPP  PY Y SPPPP
Sbjct: 400 SPPPPPVHHYSPPHHPYLYKSPPPP 424

 Score =  181 bits (460), Expect = 3e-44
 Identities = 104/193 (53%), Positives = 112/193 (58%), Gaps = 22/193 (11%)
 Frame = -3

Query: 531 YLYSSPPPPKVY---PPV---SPPPKVY-------PPV--YSPPPKVYPPVSPPPK---V 406
           Y+Y SPPPP  +   PPV    PPPK +       PPV  YSPPP  + P  PPPK   V
Sbjct: 256 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP--PPPKKHYV 313

Query: 405 YPPVSPPYHYSSPPPPVYSPP--KKPYHYSSPPPPV--YSPPPPYHYSSPPPPPKKPYKY 238
           Y    PP  + SPPP  +SPP  KK Y Y SPPPPV  YSPPP YH    PPPPKK Y Y
Sbjct: 314 YKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYH---SPPPPKKHYVY 370

Query: 237 SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSP 58
            SPPPP  H SP P YHSPPPPK+ Y Y SPP     PPP +HYS    PP  PY Y   
Sbjct: 371 KSPPPPVKHYSPPPVYHSPPPPKEKYVYKSPP-----PPPVHHYS----PPHHPYLYK-- 419

Query: 57  PPPVYSPPPPYHY 19
                SPPPPYHY
Sbjct: 420 -----SPPPPYHY 427

[13][TOP]
>UniRef100_Q41707 Extensin class 1 protein n=1 Tax=Vigna unguiculata
           RepID=Q41707_VIGUN
          Length = 489

 Score =  232 bits (591), Expect = 2e-59
 Identities = 119/200 (59%), Positives = 123/200 (61%), Gaps = 15/200 (7%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y Y SPPPP    P  PPP VY    PP  SPPP  Y    PPP   PP  P
Sbjct: 132 PSPSPPPPYYYKSPPPPS---PSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPP--P 186

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPE 217
           PY+Y SPPPP  SPP  PY+Y SPPPP  SPPPPY Y SPPPP   P  PY Y SPPPP 
Sbjct: 187 PYYYKSPPPPSPSPPP-PYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPS 245

Query: 216 HHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYH-S 61
               P  YY SPPPP      PYYY SPPPP  SPPPPY+Y SPPPP   P  PYYY  S
Sbjct: 246 PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYY-KS 304

Query: 60  PPPPVYSPPPPYHYTSPPPP 1
           PPPP  SPPPPY+Y SPPPP
Sbjct: 305 PPPPSPSPPPPYYYKSPPPP 324

 Score =  232 bits (591), Expect = 2e-59
 Identities = 119/200 (59%), Positives = 123/200 (61%), Gaps = 15/200 (7%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y Y SPPPP    P  PPP VY    PP  SPPP  Y    PPP   PP  P
Sbjct: 196 PSPSPPPPYYYKSPPPPS---PSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPP--P 250

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPE 217
           PY+Y SPPPP  SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP 
Sbjct: 251 PYYYKSPPPPSPSPPP-PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 309

Query: 216 HHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYH-S 61
               P  YY SPPPP      PYYY SPPPP  SPPPPY Y SPPPP   P  PYYY  S
Sbjct: 310 PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYY-KS 368

Query: 60  PPPPVYSPPPPYHYTSPPPP 1
           PPPP  SPPPPY+Y SPPPP
Sbjct: 369 PPPPSPSPPPPYYYKSPPPP 388

 Score =  231 bits (588), Expect = 5e-59
 Identities = 118/200 (59%), Positives = 123/200 (61%), Gaps = 15/200 (7%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y+Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP   PP  P
Sbjct: 148 PSPSPPPPYVYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP--P 202

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPE 217
           PY+Y SPPPP  SPP  PY Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP 
Sbjct: 203 PYYYKSPPPPSPSPPP-PYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 261

Query: 216 HHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYH-S 61
               P  YY SPPPP      PYYY SPPPP  SPPPPY+Y SPPPP   P  PYYY  S
Sbjct: 262 PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYY-KS 320

Query: 60  PPPPVYSPPPPYHYTSPPPP 1
           PPPP  SPPPPY+Y SPPPP
Sbjct: 321 PPPPSPSPPPPYYYKSPPPP 340

 Score =  230 bits (587), Expect = 6e-59
 Identities = 125/224 (55%), Positives = 132/224 (58%), Gaps = 37/224 (16%)
 Frame = -3

Query: 561 TLPSLISANSYLYSSPPPPKVYPPVSPPPKV--YPPVY--SPPPKVYPPVSPPPKVY--- 403
           T P   +A  Y Y SPPPP   PP  PPP V  YPP Y  SPPP    P  PPP VY   
Sbjct: 42  TPPYYYNAPPYYYKSPPPPSPSPP--PPPYVHKYPPYYYKSPPPP--SPSPPPPYVYKSP 97

Query: 402 PPVSP----PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPY 244
           PP SP    PY+Y SPPPP  SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY
Sbjct: 98  PPPSPSPPPPYYYKSPPPPSPSPPP-PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPY 156

Query: 243 KYSSPPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---P 85
            Y SPPPP     P  YY SPPPP      PYYY SPPPP  SPPPPY+Y SPPPP   P
Sbjct: 157 VYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSP 216

Query: 84  KKPY---------------YYH-SPPPPVYSPPPPYHYTSPPPP 1
             PY               YY+ SPPPP  SPPPPY+Y SPPPP
Sbjct: 217 PPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 260

 Score =  230 bits (586), Expect = 8e-59
 Identities = 118/200 (59%), Positives = 122/200 (61%), Gaps = 15/200 (7%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP   PP  P
Sbjct: 244 PSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP--P 298

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPE 217
           PY+Y SPPPP  SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP 
Sbjct: 299 PYYYKSPPPPSPSPPP-PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPS 357

Query: 216 HHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYH-S 61
               P  YY SPPPP      PYYY SPPPP  SPPPPY+Y SPPPP   P  PYYY  S
Sbjct: 358 PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYY-KS 416

Query: 60  PPPPVYSPPPPYHYTSPPPP 1
           PPPP  SPPPPY Y SPPPP
Sbjct: 417 PPPPSPSPPPPYVYKSPPPP 436

 Score =  229 bits (585), Expect = 1e-58
 Identities = 117/200 (58%), Positives = 123/200 (61%), Gaps = 15/200 (7%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y+Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP   PP  P
Sbjct: 212 PSPSPPPPYVYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP--P 266

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPE 217
           PY+Y SPPPP  SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP 
Sbjct: 267 PYYYKSPPPPSPSPPP-PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 325

Query: 216 HHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYH-S 61
               P  YY SPPPP      PY Y SPPPP  SPPPPY+Y SPPPP   P  PYYY  S
Sbjct: 326 PSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYY-KS 384

Query: 60  PPPPVYSPPPPYHYTSPPPP 1
           PPPP  SPPPPY+Y SPPPP
Sbjct: 385 PPPPSPSPPPPYYYKSPPPP 404

 Score =  228 bits (581), Expect = 3e-58
 Identities = 118/200 (59%), Positives = 121/200 (60%), Gaps = 15/200 (7%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP   PP  P
Sbjct: 276 PSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP--P 330

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPE 217
           PY+Y SPPPP  SPP  PY Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP 
Sbjct: 331 PYYYKSPPPPSPSPPP-PYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 389

Query: 216 HHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYH-S 61
               P  YY SPPPP      PYYY SPPPP  SPPPPY Y SPPPP   P  PYYY  S
Sbjct: 390 PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYY-KS 448

Query: 60  PPPPVYSPPPPYHYTSPPPP 1
           PPPP  SPPPPY+Y SPPPP
Sbjct: 449 PPPPSPSPPPPYYYKSPPPP 468

 Score =  228 bits (580), Expect = 4e-58
 Identities = 117/200 (58%), Positives = 122/200 (61%), Gaps = 15/200 (7%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y+Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP   PP  P
Sbjct: 84  PSPSPPPPYVYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP--P 138

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPE 217
           PY+Y SPPPP  SPP  PY Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP 
Sbjct: 139 PYYYKSPPPPSPSPPP-PYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 197

Query: 216 HHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYH-S 61
               P  YY SPPPP      PY Y SPPPP  SPPPPY+Y SPPPP   P  PYYY  S
Sbjct: 198 PSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYY-KS 256

Query: 60  PPPPVYSPPPPYHYTSPPPP 1
           PPPP  SPPPPY+Y SPPPP
Sbjct: 257 PPPPSPSPPPPYYYKSPPPP 276

 Score =  222 bits (565), Expect = 2e-56
 Identities = 112/208 (53%), Positives = 123/208 (59%), Gaps = 13/208 (6%)
 Frame = -3

Query: 585 LLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVY---SPPPKVYPPVSPP 415
           L++A     +   ++A+ Y      P   YP  +PP     P Y   SPPP   P  SPP
Sbjct: 9   LILAFAICLMAITVAADDYKPYYGQPWNNYPKQTPPYYYNAPPYYYKSPPP---PSPSPP 65

Query: 414 PKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPY 244
           P  Y    PPY+Y SPPPP  SPP  PY Y SPPPP  SPPPPY+Y SPPPP   P  PY
Sbjct: 66  PPPYVHKYPPYYYKSPPPPSPSPP-PPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPY 124

Query: 243 KYSSPPPPEHHVSPKPYYHSPPPPK----KPYYYHSPPPPVYSPPPPYHYSSPPPP---P 85
            Y SPPPP     P  YY SPPPP      PY Y SPPPP  SPPPPY+Y SPPPP   P
Sbjct: 125 YYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSP 184

Query: 84  KKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             PYYY SPPPP  SPPPPY+Y SPPPP
Sbjct: 185 PPPYYYKSPPPPSPSPPPPYYYKSPPPP 212

 Score =  222 bits (565), Expect = 2e-56
 Identities = 117/203 (57%), Positives = 121/203 (59%), Gaps = 18/203 (8%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP   PP  P
Sbjct: 292 PSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP--P 346

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPE 217
           PY Y SPPPP  SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP 
Sbjct: 347 PYVYKSPPPPSPSPPP-PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS 405

Query: 216 HHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYH-S 61
               P  YY SPPPP      PY Y SPPPP  SPPPPY+Y SPPPP   P  PYYY  S
Sbjct: 406 PSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYY-KS 464

Query: 60  PPPPVYSPPPPYH---YTSPPPP 1
           PPPP  SPPPPY+   Y SPPPP
Sbjct: 465 PPPPSPSPPPPYYPYLYNSPPPP 487

 Score =  162 bits (410), Expect = 2e-38
 Identities = 84/156 (53%), Positives = 88/156 (56%), Gaps = 14/156 (8%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y+Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP   PP  P
Sbjct: 340 PSPSPPPPYVYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP--P 394

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPE 217
           PY+Y SPPPP  SPP  PY+Y SPPPP  SPPPPY Y SPPPP   P  PY Y SPPPP 
Sbjct: 395 PYYYKSPPPPSPSPPP-PYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPS 453

Query: 216 HHVSPKPYYHSPPPPKK-------PYYYHSPPPPVY 130
               P  YY SPPPP         PY Y+SPPPP Y
Sbjct: 454 PSPPPPYYYKSPPPPSPSPPPPYYPYLYNSPPPPAY 489

[14][TOP]
>UniRef100_O65760 Extensin (Fragment) n=1 Tax=Cicer arietinum RepID=O65760_CICAR
          Length = 192

 Score =  229 bits (585), Expect = 1e-58
 Identities = 114/192 (59%), Positives = 120/192 (62%), Gaps = 15/192 (7%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP   PP  PPY+Y SPP
Sbjct: 4   YYYHSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP--PPYYYHSPP 58

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPY 193
           PP  SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP        Y
Sbjct: 59  PPSPSPP-PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYHYQSPPPPSPTPRTPYY 117

Query: 192 YHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPPPKKP---YYYHSPPPPVYSPP 34
           Y SPPPP      PY+Y SPPPP+ SPPPPYHY+SPPPP   P   Y Y SPPPPV SPP
Sbjct: 118 YKSPPPPTSSPPPPYHYVSPPPPIKSPPPPYHYTSPPPPSPSPAPTYIYKSPPPPVKSPP 177

Query: 33  PP-YHYTSPPPP 1
           PP Y Y SPPPP
Sbjct: 178 PPVYIYASPPPP 189

 Score =  219 bits (558), Expect = 1e-55
 Identities = 108/181 (59%), Positives = 114/181 (62%), Gaps = 10/181 (5%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKP 334
           PPP  Y   SPPP    P  SPPP  Y    PPP   PP  PPY+Y SPPPP  SPP  P
Sbjct: 1   PPPYYYH--SPPP----PSPSPPPPYYYKSPPPPSPSPP--PPYYYKSPPPPSPSPPP-P 51

Query: 333 YHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPP---- 175
           Y+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP     P  +Y SPPP    
Sbjct: 52  YYYHSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYHYQSPPPPSPT 111

Query: 174 PKKPYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
           P+ PYYY SPPPP  SPPPPYHY SPPPP   P  PY+Y SPPPP  SP P Y Y SPPP
Sbjct: 112 PRTPYYYKSPPPPTSSPPPPYHYVSPPPPIKSPPPPYHYTSPPPPSPSPAPTYIYKSPPP 171

Query: 3   P 1
           P
Sbjct: 172 P 172

 Score =  149 bits (377), Expect = 1e-34
 Identities = 86/163 (52%), Positives = 90/163 (55%), Gaps = 21/163 (12%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVY----PPVSP-PPKVY 403
           PS      Y Y SPPPP    P  PPP  Y    PP  SPPP  Y    PP SP PP  Y
Sbjct: 44  PSPSPPPPYYYHSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPY 100

Query: 402 -----PPVSP----PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKK 250
                PP SP    PY+Y SPPPP  SPP  PYHY SPPPP+ SPPPPYHY+SPPPP   
Sbjct: 101 HYQSPPPPSPTPRTPYYYKSPPPPTSSPP-PPYHYVSPPPPIKSPPPPYHYTSPPPPSPS 159

Query: 249 P---YKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY 130
           P   Y Y SPPPP           SPPPP   Y Y SPPPP+Y
Sbjct: 160 PAPTYIYKSPPPP---------VKSPPPP--VYIYASPPPPIY 191

[15][TOP]
>UniRef100_Q01943 Extensin (Class I) (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q01943_SOLLC
          Length = 181

 Score =  229 bits (583), Expect = 2e-58
 Identities = 114/185 (61%), Positives = 119/185 (64%), Gaps = 12/185 (6%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP  Y   SPPP    P  SPPP  Y    PPP   PP  PPY+Y SPPPP  SPP 
Sbjct: 2   SPPPPYYYK--SPPP----PSPSPPPPYYYKSPPPPSPSPP--PPYYYKSPPPPSPSPPP 53

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
            PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP     P  YY SPPPPK
Sbjct: 54  -PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYSSPPPPK 112

Query: 168 K----PYYYHSPPPPVYSPPPPYHYSSPPPP-----PKKPYYYHSPPPPVYSPPPPYHYT 16
           K    PYYY SPPPP  SPPPPY+Y SPPPP     P  PYYY S PPP  SPPPPY+Y 
Sbjct: 113 KSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP--PYYYKSSPPPSPSPPPPYYYK 170

Query: 15  SPPPP 1
           SPPPP
Sbjct: 171 SPPPP 175

 Score =  213 bits (542), Expect = 1e-53
 Identities = 108/181 (59%), Positives = 113/181 (62%), Gaps = 14/181 (7%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP   PP  PPY+Y SPP
Sbjct: 7   YYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP--PPYYYKSPP 61

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPY 193
           PP  SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY YSSPPPP+    P  Y
Sbjct: 62  PPSPSPPP-PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYSSPPPPKKSPPPPYY 120

Query: 192 YHSPPPPKK----PYYYHSPPPPVYSPPPPYH-YSSPPPPPK--KPYYYHSPPPPVYSPP 34
           Y SPPPP      PYYY SPPPP  SPPPPY+  SSPPP P    PYYY SPPPP  SPP
Sbjct: 121 YKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSSPPPSPSPPPPYYYKSPPPPSPSPP 180

Query: 33  P 31
           P
Sbjct: 181 P 181

[16][TOP]
>UniRef100_UPI00019859A1 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019859A1
          Length = 377

 Score =  228 bits (580), Expect = 4e-58
 Identities = 148/298 (49%), Positives = 154/298 (51%), Gaps = 96/298 (32%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVY--------PPVYS 451
           MAS   TLLV  +SL+LPS  SAN Y YSSPPPP  Y    PPP VY        PPVYS
Sbjct: 10  MASLIATLLVVTISLSLPSETSAN-YHYSSPPPPYYYKSPPPPPPVYKYKSPPPPPPVYS 68

Query: 450 PP-------------PKVY--------PPV--------------SPPPKVY-PPVSPPYH 379
           PP             P VY        PPV               PPP VY PP  PPY 
Sbjct: 69  PPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYK 128

Query: 378 YSSPPPP--VYSPPKKP-YHYSSPPPP--VYSPP--PPYHYSSPPPPP------------ 256
           Y SPPPP  VYSPP  P Y Y SPPPP  VYSPP  PPY Y SPPPPP            
Sbjct: 129 YKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPH 188

Query: 255 KKPYKYSSPPPPEHHV------------SPKPY-YHSPPPPKKPYYYHSPPPP--VYSPP 121
           KKPYKY SPPPP +++            SP PY Y SPPPP   Y Y SPPPP  V+SPP
Sbjct: 189 KKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPPPPPPVYKYKSPPPPPPVHSPP 248

Query: 120 PP---YHYSSPPPPP-----------KKPYYYHSPPPPVY---S-PPPPYHYTSPPPP 1
           PP   Y Y SPPPPP             PY Y SPPPP Y   S PPPP  Y SPPPP
Sbjct: 249 PPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPP 306

 Score =  104 bits (259), Expect = 7e-21
 Identities = 71/175 (40%), Positives = 74/175 (42%), Gaps = 68/175 (38%)
 Frame = -3

Query: 558 LPSLISANSYLYSSPPPPKVYPPVSPPPKVY--------PPVYSPPPKV----YPPVSPP 415
           LPS  SA+ Y Y SPPP K   P  PPP VY        PPV+SPPP      Y    PP
Sbjct: 204 LPSGTSADEYEYKSPPPYKYKSP-PPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPP 262

Query: 414 PKVY-----PPVSPPYHYSSPPPPVY-----------------------SPPKKP--YHY 325
           P VY     PP SPPY Y SPPPP Y                       SPP  P  Y Y
Sbjct: 263 PPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKY 322

Query: 324 SSPPPPVYS----PPPPYHYSSPPPPPK----------------------KPYKY 238
            SPPPPVY     PPPPY Y SPPPPP                        P+ Y
Sbjct: 323 KSPPPPVYKYKSPPPPPYMYKSPPPPPPVYKYKSPPPPPPKYYYSSPPPPPPHHY 377

[17][TOP]
>UniRef100_Q09082 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q09082_SOLLC
          Length = 388

 Score =  226 bits (575), Expect = 2e-57
 Identities = 115/193 (59%), Positives = 121/193 (62%), Gaps = 16/193 (8%)
 Frame = -3

Query: 531 YLYSSPPPPK-VYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPP- 358
           Y+Y SPPPP   Y   SPPP        P PK Y   SPPP      SP Y Y SPPPP 
Sbjct: 190 YVYKSPPPPSPKYVYKSPPP--------PSPK-YVYKSPPPP-----SPKYVYKSPPPPS 235

Query: 357 ---VY-SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPK 199
              VY SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP     P 
Sbjct: 236 PKYVYKSPPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 295

Query: 198 PYYHSPPPPK----KPYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYS 40
            YY SPPPP      PYYY  PPPP  SPPPPY+Y SPPPP   P  PYYYHSPPPPV S
Sbjct: 296 YYYKSPPPPSPSPPPPYYYKCPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPVNS 355

Query: 39  PPPPYHYTSPPPP 1
           PPPPY+Y+SPPPP
Sbjct: 356 PPPPYYYSSPPPP 368

 Score =  217 bits (553), Expect = 5e-55
 Identities = 110/184 (59%), Positives = 115/184 (62%), Gaps = 13/184 (7%)
 Frame = -3

Query: 531 YLYSSPPPPKV-YPPVSPPPKVYPPVYS--PPPKVYPPVSPPPKVYPPVSPPYHYSSPPP 361
           Y+Y SPPPP   Y   SPPP     VY   PPP  Y    PPP   PP  PPY+Y SPPP
Sbjct: 214 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPPYYYKSPPPPSPSPP--PPYYYKSPPP 271

Query: 360 PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYY 190
           P  SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y  PPPP     P  YY
Sbjct: 272 PSPSPPP-PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKCPPPPSPSPPPPYYY 330

Query: 189 HSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY---SPPP 31
            SPPPP      PYYYHSPPPPV SPPPPY+YSSPPPP K      SPPPPVY   SPPP
Sbjct: 331 KSPPPPSPSPPPPYYYHSPPPPVNSPPPPYYYSSPPPPVK------SPPPPVYIYGSPPP 384

Query: 30  PYHY 19
           P HY
Sbjct: 385 PVHY 388

 Score =  192 bits (488), Expect = 2e-47
 Identities = 117/211 (55%), Positives = 119/211 (56%), Gaps = 34/211 (16%)
 Frame = -3

Query: 531 YLYSSPPPPKV-YPPVSPPPKVYPPVYSPPPKVYPPV---SPPP-------KVYPPVSPP 385
           Y+Y SPPPP   Y   SPPP     VY  PP   P     SPPP       K  PP SP 
Sbjct: 70  YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPK 129

Query: 384 YHYSSPPPP----VYS---PPKKPYHYSSPPPP----VY-SPPPP---YHYSSPPPPPKK 250
           Y Y SPPPP    VY    PP   Y Y SPPPP    VY SPPPP   Y Y SPPPP  K
Sbjct: 130 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPK 189

Query: 249 PYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPP----VY-SPPPP---YHYSSPP 94
            Y Y SPPPP    SPK  Y SPPPP   Y Y SPPPP    VY SPPPP   Y Y SPP
Sbjct: 190 -YVYKSPPPP----SPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPP 244

Query: 93  PPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           PPP   YYY SPPPP  SPPPPY+Y SPPPP
Sbjct: 245 PPP---YYYKSPPPPSPSPPPPYYYKSPPPP 272

 Score =  191 bits (486), Expect = 3e-47
 Identities = 117/222 (52%), Positives = 120/222 (54%), Gaps = 45/222 (20%)
 Frame = -3

Query: 531 YLYSSPPPPKV-YPPVSPPPKVYPPVYSPPPKVYPPV---SPPP-------KVYPPVSPP 385
           Y+Y SPPPP   Y   SPPP     VY  PP   P     SPPP       K  PP SP 
Sbjct: 106 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPK 165

Query: 384 YHYSSPPPP----VYS---PPKKPYHYSSPPPP----VY-SPPPP---YHYSSPPPPPKK 250
           Y Y SPPPP    VY    PP   Y Y SPPPP    VY SPPPP   Y Y SPPPP  K
Sbjct: 166 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPK 225

Query: 249 PYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPP---------VY-------SPPP 118
            Y Y SPPPP    SPK  Y SPPPP  PYYY SPPPP                  SPPP
Sbjct: 226 -YVYKSPPPP----SPKYVYKSPPPP--PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 278

Query: 117 PYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           PY+Y SPPPP   P  PYYY SPPPP  SPPPPY+Y  PPPP
Sbjct: 279 PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKCPPPP 320

 Score =  183 bits (464), Expect = 1e-44
 Identities = 126/267 (47%), Positives = 129/267 (48%), Gaps = 90/267 (33%)
 Frame = -3

Query: 531 YLYSSPPPP------KVYPPVSP-----------PPKVY--PP------VY-SPPP---- 442
           Y+Y SPPPP      K  PP SP           P  VY  PP      VY SPPP    
Sbjct: 22  YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPK 81

Query: 441 ---KVYPPVSP-----------PPKVY---PPVSPPYHYSSPPPP----VYS---PPKKP 334
              K  PP SP           P  VY   PP SP Y Y SPPPP    VY    PP   
Sbjct: 82  YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPK 141

Query: 333 YHYSSPPPP----VY-SPPPP---YHYSSP-----------PPPPKKPYKYSSPPPPEHH 211
           Y Y SPPPP    VY SPPPP   Y Y SP           PPPP   Y Y SPPPP   
Sbjct: 142 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPK 201

Query: 210 V--------SPKPYYHSPPPPKKPYYYHSPPPP----VYS--PPPPYHYSSPPPP---PK 82
                    SPK  Y SPPPP   Y Y SPPPP    VY   PPPPY+Y SPPPP   P 
Sbjct: 202 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPPYYYKSPPPPSPSPP 261

Query: 81  KPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            PYYY SPPPP  SPPPPY+Y SPPPP
Sbjct: 262 PPYYYKSPPPPSPSPPPPYYYKSPPPP 288

 Score =  167 bits (424), Expect = 5e-40
 Identities = 113/212 (53%), Positives = 113/212 (53%), Gaps = 41/212 (19%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVYPPV---SPPP-------KVYPPVSPPYHYSSPP 364
           P P  Y   SPPP     VY  PP   P     SPPP       K  PP SP Y Y SPP
Sbjct: 5   PTPTPYYYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPP 64

Query: 363 PP----VYS---PPKKPYHYSSPPPP----VY-SPPPP---YHYSSPPPPPKKPYKYSSP 229
           PP    VY    PP   Y Y SPPPP    VY SPPPP   Y Y SPPPP  K Y Y SP
Sbjct: 65  PPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPK-YVYKSP 123

Query: 228 PPPEHHVSPKPYYHSPPPPKKPYYYHSPPPP----VY-SPPPP---YHYSSPPPPPKKPY 73
           PPP    SPK  Y SPPPP   Y Y SPPPP    VY SPPPP   Y Y SPPPP  K Y
Sbjct: 124 PPP----SPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPK-Y 178

Query: 72  YYHSPPPP----VY-SPPPP---YHYTSPPPP 1
            Y SPPPP    VY SPPPP   Y Y SPPPP
Sbjct: 179 VYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP 210

 Score =  152 bits (384), Expect = 2e-35
 Identities = 84/157 (53%), Positives = 88/157 (56%), Gaps = 7/157 (4%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP   PP  P
Sbjct: 256 PSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP--P 310

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHV 208
           PY+Y  PPPP  SPP  PY+Y SPPPP  SPPPPY+Y SPPPP       +SPPPP    
Sbjct: 311 PYYYKCPPPPSPSPP-PPYYYKSPPPPSPSPPPPYYYHSPPPP------VNSPPPPY--- 360

Query: 207 SPKPYYHSPPPPKKPYYYHSPPPPVY---SPPPPYHY 106
               YY SPPPP K     SPPPPVY   SPPPP HY
Sbjct: 361 ----YYSSPPPPVK-----SPPPPVYIYGSPPPPVHY 388

 Score =  151 bits (381), Expect = 5e-35
 Identities = 98/171 (57%), Positives = 99/171 (57%), Gaps = 27/171 (15%)
 Frame = -3

Query: 432 PPVSPPPKVY---PPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPP----VY-SPPPP--- 286
           P  +P P  Y   PP SP Y Y SPPPP    PK  Y Y SPPPP    VY SPPPP   
Sbjct: 3   PKPTPTPYYYKSPPPPSPKYVYKSPPPP---SPK--YVYKSPPPPSPKYVYKSPPPPSPK 57

Query: 285 YHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPP----VY-SPP 121
           Y Y SPPPP  K Y Y SPPPP    SPK  Y SPPPP   Y Y SPPPP    VY SPP
Sbjct: 58  YVYKSPPPPSPK-YVYKSPPPP----SPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPP 112

Query: 120 PP---YHYSSPPPPPKKPYYYHSPPPP----VY-SPPPP---YHYTSPPPP 1
           PP   Y Y SPPPP  K Y Y SPPPP    VY SPPPP   Y Y SPPPP
Sbjct: 113 PPSPKYVYKSPPPPSPK-YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP 162

[18][TOP]
>UniRef100_Q9SK35 Putative uncharacterized protein At2g24980 n=1 Tax=Arabidopsis
           thaliana RepID=Q9SK35_ARATH
          Length = 559

 Score =  223 bits (569), Expect = 8e-57
 Identities = 126/241 (52%), Positives = 131/241 (54%), Gaps = 64/241 (26%)
 Frame = -3

Query: 531 YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
           Y+YSSPPPP      KVY    PPP VY    PP YSP PKVY    PPP VY    PP 
Sbjct: 227 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 286

Query: 393 ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                        PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 287 YSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 346

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
             PPPY YSSPPPP            P  PY YSSPPPP +  SPK YY SPPP   PY 
Sbjct: 347 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP---PYV 403

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY---------SPPPPYHYTSPPP 4
           Y+SPPPP YSP P  +Y SPPP    PY Y SPPPP Y         SPPPPY Y+SPPP
Sbjct: 404 YNSPPPPYYSPSPKVYYKSPPP----PYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPP 459

Query: 3   P 1
           P
Sbjct: 460 P 460

 Score =  221 bits (562), Expect = 5e-56
 Identities = 129/262 (49%), Positives = 135/262 (51%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531 YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
           Y+YSSPPPP      KVY    PPP VY    PP YSP PKVY    PPP VY    PPY
Sbjct: 177 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 236

Query: 381 H-------YSSPPPP-VYSPPKKPYH----------------YSSPPPPVY--------- 301
           +       Y SPPPP VYS P  PY+                YSSPPPP Y         
Sbjct: 237 YSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 296

Query: 300 SPPPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           SPPPPY YSSPPPP            P  PY YSSPPPP +  SPK YY SPPP   PY 
Sbjct: 297 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP---PYV 353

Query: 156 YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
           Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y+SPPPP Y 
Sbjct: 354 YSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPPPPYYS 413

Query: 42  --------SPPPPYHYTSPPPP 1
                   SPPPPY Y+SPPPP
Sbjct: 414 PSPKVYYKSPPPPYVYSSPPPP 435

 Score =  218 bits (554), Expect = 4e-55
 Identities = 129/262 (49%), Positives = 132/262 (50%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
           Y+YSSPPPP   P         PPP VY    PP YSP PKV     PPP VY    PP 
Sbjct: 102 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPY 161

Query: 393 ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                        PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 162 YSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 221

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
             PPPY YSSPPPP            P  PY YSSPPPP +  SPK YY SPPP   PY 
Sbjct: 222 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP---PYV 278

Query: 156 YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
           Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 279 YSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYS 338

Query: 42  --------SPPPPYHYTSPPPP 1
                   SPPPPY Y+SPPPP
Sbjct: 339 PSPKVYYKSPPPPYVYSSPPPP 360

 Score =  213 bits (543), Expect = 8e-54
 Identities = 120/232 (51%), Positives = 124/232 (53%), Gaps = 55/232 (23%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
            Y+YSSPPPP      KVY    PPP VY    PP YSP PKVY    PPP VY    PP 
Sbjct: 327  YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 386

Query: 393  ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                         PPY Y+SPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 387  YSPSPKVYYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 446

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P   Y YSSPPPP +  SPK YY SPPP    Y 
Sbjct: 447  SPPPPYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPP---SYV 503

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            Y SPPPP YSP P  +Y SPPP    PY Y SPPPP YSP P   Y SPPPP
Sbjct: 504  YSSPPPPYYSPSPKVYYKSPPP----PYVYSSPPPPYYSPSPKVTYKSPPPP 551

 Score =  213 bits (541), Expect = 1e-53
 Identities = 115/208 (55%), Positives = 122/208 (58%), Gaps = 32/208 (15%)
 Frame = -3

Query: 531 YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
           Y+YSSPPPP      KVY    PPP VY    PP YSP PKVY    PPP VY    PPY
Sbjct: 277 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 336

Query: 381 H-------YSSPPPP-VYSPPKKPYHYSSPPPPVY--SPPPPYHYSSPPPP--------- 259
           +       Y SPPPP VYS P  PY+  SP P VY  SPPPPY YSSPPPP         
Sbjct: 337 YSPSPKVYYKSPPPPYVYSSPPPPYY--SPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVY 394

Query: 258 ---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP 88
              P  PY Y+SPPPP +  SPK YY SPPP   PY Y SPPPP YSP P  +Y SPPP 
Sbjct: 395 YKSPPPPYVYNSPPPPYYSPSPKVYYKSPPP---PYVYSSPPPPYYSPSPKVYYKSPPP- 450

Query: 87  PKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
              PY Y SPPPP YSP P  +Y SPPP
Sbjct: 451 ---PYVYSSPPPPYYSPSPKVYYKSPPP 475

 Score =  212 bits (540), Expect = 2e-53
 Identities = 123/239 (51%), Positives = 129/239 (53%), Gaps = 62/239 (25%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
            Y+YSSPPPP      KVY    PPP VY    PP YSP PKVY    PPP VY    PPY
Sbjct: 302  YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 361

Query: 381  H-------YSSPPPP-VYSPPKKPYHYSSPPPPVY--SPPPPYHYSSPPPP--------- 259
            +       Y SPPPP VYS P  PY+  SP P VY  SPPPPY Y+SPPPP         
Sbjct: 362  YSPSPKVYYKSPPPPYVYSSPPPPYY--SPSPKVYYKSPPPPYVYNSPPPPYYSPSPKVY 419

Query: 258  ---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY---------SPPPP 115
               P  PY YSSPPPP +  SPK YY SPPP   PY Y SPPPP Y         SPPP 
Sbjct: 420  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP---PYVYSSPPPPYYSPSPKVYYKSPPPS 476

Query: 114  YHYSSPPPP------------PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
            Y YSSPPPP            P   Y Y SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 477  YVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 535

 Score =  198 bits (504), Expect = 3e-49
 Identities = 116/236 (49%), Positives = 128/236 (54%), Gaps = 45/236 (19%)
 Frame = -3

Query: 573 LVSLTLPSLISAN--SYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYP 400
           +V + + S I+A   SY YSSP  P      SP  +   P Y+P PK Y   SPPP+ Y 
Sbjct: 7   IVYVVVLSAIAATVTSYPYSSPQTPSYN---SPSYEHKGPKYAPHPKPYVKSSPPPQYYT 63

Query: 399 PVSPPYHYSSPPPP-VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP------------ 259
           P SP  +Y SPPPP VYS P  PY+  SP     SPPPPY YSSPPPP            
Sbjct: 64  P-SPKVNYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKS 122

Query: 258 PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY---------SPPPPYHY 106
           P  PY YSSPPPP +  SPK  Y SPPP   PY Y+SPPPP Y         SPPPPY Y
Sbjct: 123 PPPPYVYSSPPPPYYSPSPKVDYKSPPP---PYVYNSPPPPYYSPSPKVDYKSPPPPYVY 179

Query: 105 SSPPPP------------PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
           SSPPPP            P  PY Y SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 180 SSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 235

 Score =  170 bits (430), Expect = 1e-40
 Identities = 93/173 (53%), Positives = 98/173 (56%), Gaps = 19/173 (10%)
 Frame = -3

Query: 531 YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
           Y+Y+SPPPP      KVY    PPP VY    PP YSP PKVY    PPP VY    PPY
Sbjct: 402 YVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 461

Query: 381 H-------YSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPP 223
           +       Y SPPP         Y YSSPPPP YSP P  +Y SPPP     Y YSSPPP
Sbjct: 462 YSPSPKVYYKSPPP--------SYVYSSPPPPYYSPSPKVYYKSPPP----SYVYSSPPP 509

Query: 222 PEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP--PKKPYY 70
           P +  SPK YY SPPP   PY Y SPPPP YSP P   Y SPPPP   K PYY
Sbjct: 510 PYYSPSPKVYYKSPPP---PYVYSSPPPPYYSPSPKVTYKSPPPPYVYKTPYY 559

 Score =  129 bits (323), Expect = 3e-28
 Identities = 73/137 (53%), Positives = 77/137 (56%), Gaps = 4/137 (2%)
 Frame = -3

Query: 555 PSLISANSYLYS-SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYH 379
           P   S +  +Y  SPPPP VY   SPP    PP YSP PKVY    PP  VY    PPY 
Sbjct: 434 PPYYSPSPKVYYKSPPPPYVYS--SPP----PPYYSPSPKVYYKSPPPSYVYSSPPPPY- 486

Query: 378 YSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPK 199
           YS  P   Y  P   Y YSSPPPP YSP P  +Y SPPP    PY YSSPPPP +  SPK
Sbjct: 487 YSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPP----PYVYSSPPPPYYSPSPK 542

Query: 198 PYYHSPPPP---KKPYY 157
             Y SPPPP   K PYY
Sbjct: 543 VTYKSPPPPYVYKTPYY 559

[19][TOP]
>UniRef100_Q43682 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q43682_VIGUN
          Length = 280

 Score =  223 bits (569), Expect = 8e-57
 Identities = 114/195 (58%), Positives = 116/195 (59%), Gaps = 10/195 (5%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y+Y SPPPP    P  PPP VY    PP  SPPP       PPP   PP  P
Sbjct: 2   PSPSPPPPYVYKSPPPPS---PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPP--P 56

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPE 217
           PY Y SPPPP  SPP  PY Y SPPPP  SPPPPY Y SPPPP   P  PY Y SPPPP 
Sbjct: 57  PYVYKSPPPPSPSPPP-PYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS 115

Query: 216 HHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPV 46
               P PY +  PPP  PY Y SPPPP  SPPPPY Y SPPPP   P  PY Y SPPPP 
Sbjct: 116 PS-PPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS 174

Query: 45  YSPPPPYHYTSPPPP 1
            SPPPPY Y SPPPP
Sbjct: 175 PSPPPPYIYKSPPPP 189

 Score =  219 bits (557), Expect = 2e-55
 Identities = 121/210 (57%), Positives = 122/210 (58%), Gaps = 25/210 (11%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPP----KVYPPVSP---PPK 409
           PS      Y+Y SPPPP    P  PPP VY    PP  SPPP    K  PP SP   PP 
Sbjct: 66  PSPSPPPPYVYKSPPPPS---PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPY 122

Query: 408 VY--PPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPY 244
           VY  PP  PPY Y SPPPP  SPP  PY Y SPPPP  SPPPPY Y SPPPP   P  PY
Sbjct: 123 VYKSPPPPPPYVYKSPPPPSPSPPP-PYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPY 181

Query: 243 KYSSPPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---- 88
            Y SPPPP     P   Y SPPPP      PY Y SPPPP  SPPPPY Y SPPPP    
Sbjct: 182 IYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSP 241

Query: 87  -PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            P  PY Y SPPPP  SPPPPY Y SPPPP
Sbjct: 242 PP--PYVYKSPPPPSPSPPPPYVYKSPPPP 269

 Score =  215 bits (547), Expect = 3e-54
 Identities = 117/210 (55%), Positives = 118/210 (56%), Gaps = 25/210 (11%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y+Y SPPPP    P  PPP VY    PP  SPPP       PPP   PP  P
Sbjct: 50  PSPSPPPPYVYKSPPPPS---PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPP--P 104

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPP---VY--------SPPPPYHYSSPPPP---PKK 250
           PY Y SPPPP  SPP  PY Y SPPPP   VY        SPPPPY Y SPPPP   P  
Sbjct: 105 PYVYKSPPPPSPSPPP-PYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPP 163

Query: 249 PYKYSSPPPPEHHVSPKPYYHSPPPPK----KPYYYHSPPPPVYSPPPPYHYSSPPPP-- 88
           PY Y SPPPP     P   Y SPPPP      PY Y SPPPP  SPPPPY Y SPPPP  
Sbjct: 164 PYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSP 223

Query: 87  -PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            P  PY Y SPPPP  SPPPPY Y SPPPP
Sbjct: 224 SPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 253

 Score =  199 bits (505), Expect = 2e-49
 Identities = 101/163 (61%), Positives = 102/163 (62%), Gaps = 8/163 (4%)
 Frame = -3

Query: 465 PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPP 286
           PP  SPPP       PPP   PP  PPY Y SPPPP  SPP  PY Y SPPPP  SPPPP
Sbjct: 1   PPSPSPPPPYVYKSPPPPSPSPP--PPYVYKSPPPPSPSPPP-PYVYKSPPPPSPSPPPP 57

Query: 285 YHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYH-SPPPPK----KPYYYHSPPPPVY 130
           Y Y SPPPP   P  PY Y SPPPP     P PY + SPPPP      PY Y SPPPP  
Sbjct: 58  YVYKSPPPPSPSPPPPYVYKSPPPPSPS-PPPPYVYKSPPPPSPSPPPPYVYKSPPPPSP 116

Query: 129 SPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           SPPPPY Y SPPPPP  PY Y SPPPP  SPPPPY Y SPPPP
Sbjct: 117 SPPPPYVYKSPPPPP--PYVYKSPPPPSPSPPPPYVYKSPPPP 157

[20][TOP]
>UniRef100_Q9C668 Putative uncharacterized protein F28B23.10 n=1 Tax=Arabidopsis
           thaliana RepID=Q9C668_ARATH
          Length = 478

 Score =  222 bits (566), Expect = 2e-56
 Identities = 125/214 (58%), Positives = 129/214 (60%), Gaps = 37/214 (17%)
 Frame = -3

Query: 531 YLYSSPPPPK-VYPPVSPPPKVY----PPVY-----SPPPKVYPPVSPPPKVYP-PVSPP 385
           Y+YSSPPPP  VY    PPP VY    PP Y      PPP VY    PPP VY  P  PP
Sbjct: 195 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 254

Query: 384 YHYSSPPPPVY---SPPKKPYHYSSPPPPVY----SPPPPYHYSSPPPPPKKPYKYSSPP 226
           Y YSSPPPP Y   SPP  PY YSSPPPP Y     PPPPY YSSPPPPP   Y Y SPP
Sbjct: 255 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP---YVYKSPP 311

Query: 225 PPEHHVS---PKPY-YHSPPPPKKPYYYHSPPPPVY----SPPPPYHYSSPPP------- 91
           PP +  S   P PY Y SPPPP  PY Y+SPPPP Y     PPPPY YSSPPP       
Sbjct: 312 PPPYVYSSPPPPPYVYKSPPPP--PYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKS 369

Query: 90  PPKKPYYYHSPPPPVY----SPPPPYHYTSPPPP 1
           PP  PY Y SPPPP Y     PPPPY Y+SPPPP
Sbjct: 370 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 403

 Score =  220 bits (560), Expect = 8e-56
 Identities = 123/214 (57%), Positives = 128/214 (59%), Gaps = 37/214 (17%)
 Frame = -3

Query: 531 YLYSSPPPPK-VYPPVSPPPKVY----PPVY-----SPPPKVYPPVSPPPKVYP-PVSPP 385
           Y+YSSPPPP  +Y    PPP VY    PP Y      PPP VY    PPP VY  P  PP
Sbjct: 75  YVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPP 134

Query: 384 YHYSSPPPPVY---SPPKKPYHYSSPPPPVY----SPPPPYHYSSPPPPPKKPYKYSSPP 226
           Y Y+SPPPP Y   SPP  PY YSSPPPP Y     PPPPY YSSPPPPP   Y Y SPP
Sbjct: 135 YVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP---YVYKSPP 191

Query: 225 PPEHHVS---PKPY-YHSPPPPKKPYYYHSPPPPVY----SPPPPYHYSSPPP------- 91
           PP +  S   P PY Y SPPPP  PY Y SPPPP Y     PPPPY YSSPPP       
Sbjct: 192 PPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKS 249

Query: 90  PPKKPYYYHSPPPPVY----SPPPPYHYTSPPPP 1
           PP  PY Y SPPPP Y     PPPPY Y+SPPPP
Sbjct: 250 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 283

 Score =  216 bits (551), Expect = 9e-55
 Identities = 125/214 (58%), Positives = 129/214 (60%), Gaps = 37/214 (17%)
 Frame = -3

Query: 531 YLYSSPPPPK-VYPPVSPPPKVY----PPVY-----SPPPKVYPPVSPPPKVYP-PVSPP 385
           Y+YSSPPPP  VY    PPP VY    PP Y      PPP VY    PPP VY  P  PP
Sbjct: 235 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 294

Query: 384 YHYSSPPPPVY---SPPKKPYHYSSPPPPVY----SPPPPYHYSSPPPPP-------KKP 247
           Y YSSPPPP Y   SPP  PY YSSPPPP Y     PPPPY Y+SPPPPP         P
Sbjct: 295 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPP 354

Query: 246 YKYSSPPP-PEHHVSPKP---YYHSPPPPKKPYYYHSPPPP--VYS--PPPPYHYSSPPP 91
           Y YSSPPP P  + SP P    Y SPPPP  PY Y SPPPP  VYS  PPPPY Y SPPP
Sbjct: 355 YVYSSPPPSPYVYKSPPPPPYVYSSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 412

Query: 90  PPKKPYYYHSPPPPVY----SPPPPYHYTSPPPP 1
           P   PY Y SPPPP Y     PPPPY Y+SPPPP
Sbjct: 413 P---PYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 443

 Score =  216 bits (549), Expect = 2e-54
 Identities = 126/214 (58%), Positives = 129/214 (60%), Gaps = 37/214 (17%)
 Frame = -3

Query: 531 YLYSSPPPPK-VYPPVSPPPKVY----PPVY-----SPPPKVYPPVSPPPKVYP-PVSPP 385
           Y+YSSPPPP  VY    PPP VY    PP Y      PPP VY    PPP VY  P  PP
Sbjct: 255 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 314

Query: 384 YHYSSPPPPVY---SPPKKPYHYSSPPPPVY----SPPPPYHYSSPPP-------PPKKP 247
           Y YSSPPPP Y   SPP  PY Y+SPPPP Y     PPPPY YSSPPP       PP  P
Sbjct: 315 YVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPP 374

Query: 246 YKYSSPPPPEHHVS---PKPY-YHSPPPPKKPYYYHSPPPP--VYS--PPPPYHYSSPPP 91
           Y YSSPPPP +      P PY Y SPPPP  PY Y SPPPP  VYS  PPPPY Y SPPP
Sbjct: 375 YVYSSPPPPPYVYKSPPPPPYVYSSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 432

Query: 90  PPKKPYYYHSPPPPVY---SP-PPPYHYTSPPPP 1
           P   PY Y SPPPP Y   SP PPPY Y SPPPP
Sbjct: 433 P---PYVYSSPPPPPYVYKSPSPPPYVYKSPPPP 463

 Score =  213 bits (541), Expect = 1e-53
 Identities = 122/226 (53%), Positives = 134/226 (59%), Gaps = 30/226 (13%)
 Frame = -3

Query: 588 TLLVALVSLTLPSLISANSYLYSSPPPPK-VYPPVSPPPKVY--PPVYSPPPKVYPPVSP 418
           +LL+ +++L   S  ++  Y YS P PP  VY    PP  +Y  PP   PPP VY    P
Sbjct: 9   SLLMLVIALYSVSAHTSAQYTYSPPSPPSYVY---KPPTHIYSSPP---PPPYVYSSPPP 62

Query: 417 PPKVYP-PVSPPYHYSSPPPPVY---SPPKKPYHYSSPPPPVY----SPPPPYHYSSPPP 262
           PP +Y  P  PPY YSSPPPP Y   SPP  PY YSSPPPP Y     PPPPY YSSPPP
Sbjct: 63  PPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP 122

Query: 261 PPKKPYKYSSPPPPEHHVS---PKPY-YHSPPPPKKPYYYHSPPPPVY----SPPPPYHY 106
           PP   Y Y SPPPP +  +   P PY Y SPPPP  PY Y SPPPP Y     PPPPY Y
Sbjct: 123 PP---YVYKSPPPPPYVYNSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 177

Query: 105 SSPPP-------PPKKPYYYHSPPPPVY----SPPPPYHYTSPPPP 1
           SSPPP       PP  PY Y SPPPP Y     PPPPY Y+SPPPP
Sbjct: 178 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 223

 Score =  202 bits (514), Expect = 2e-50
 Identities = 119/210 (56%), Positives = 123/210 (58%), Gaps = 33/210 (15%)
 Frame = -3

Query: 531 YLYSSPPPPK-VYPPVSPPPKVY----PPVY-----SPPPKVYPPVSPPPKVYP-PVSPP 385
           Y+YSSPPPP  VY    PPP VY    PP Y      PPP VY    PPP VY  P  PP
Sbjct: 275 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 334

Query: 384 YHYSSPPPPVY---SPPKKPYHYSSPPPPVY----SPPPPYHYSSPPPPP-------KKP 247
           Y Y+SPPPP Y   SPP  PY YSSPPP  Y     PPPPY YSSPPPPP         P
Sbjct: 335 YVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 394

Query: 246 YKYSSPPPPEHHVS---PKPY-YHSPPPPKKPYYYHSPPPP--VYS--PPPPYHYSSPPP 91
           Y YSSPPPP +      P PY Y SPPPP  PY Y SPPPP  VYS  PPPPY Y SP P
Sbjct: 395 YVYSSPPPPPYVYKSPPPPPYVYSSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPSP 452

Query: 90  PPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           P   PY Y SPPPP   P   Y Y+SPPPP
Sbjct: 453 P---PYVYKSPPPP---PSYSYSYSSPPPP 476

 Score =  198 bits (503), Expect = 3e-49
 Identities = 112/189 (59%), Positives = 115/189 (60%), Gaps = 26/189 (13%)
 Frame = -3

Query: 531 YLYSSPPPPK-VYPPVSPPPKVY----PPVY-----SPPPKVYPPVSPPPKVYP-PVSPP 385
           Y+YSSPPPP  VY    PPP VY    PP Y      PPP VY    PPP VY  P  PP
Sbjct: 295 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPP 354

Query: 384 YHYSSPPPPVY---SPPKKPYHYSSPPPPVY----SPPPPYHYSSPPPPPKKPYKYSSPP 226
           Y YSSPPP  Y   SPP  PY YSSPPPP Y     PPPPY YSSPPPPP   Y Y SPP
Sbjct: 355 YVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP---YVYKSPP 411

Query: 225 PPEHHVS---PKPY-YHSPPPPKKPYYYHSPPPPVY---SP-PPPYHYSSPPPPPKKPYY 70
           PP +  S   P PY Y SPPPP  PY Y SPPPP Y   SP PPPY Y SPPPPP   Y 
Sbjct: 412 PPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYS 469

Query: 69  YHSPPPPVY 43
           Y SPPPP+Y
Sbjct: 470 YSSPPPPIY 478

[21][TOP]
>UniRef100_Q9FG07 Gb|AAD23015.1 n=2 Tax=Arabidopsis thaliana RepID=Q9FG07_ARATH
          Length = 434

 Score =  222 bits (565), Expect = 2e-56
 Identities = 132/262 (50%), Positives = 136/262 (51%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531 YLYSSPPPP------KVYPPVSPPPKVY---PPVY-SPPPKVYPPVSPPPKVY----PPV 394
           Y+YSSPPPP      KVY    PPP VY   PP+Y SP PKVY    PPP VY    PP 
Sbjct: 102 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPPYVYSSPPPPY 161

Query: 393 ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                        PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 162 YSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 221

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
             PPPY YSSPPPP            P  PY YSSPPPP +  SPK YY SPPP   PY 
Sbjct: 222 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP---PYV 278

Query: 156 YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
           Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 279 YSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYS 338

Query: 42  --------SPPPPYHYTSPPPP 1
                   SPPPPY Y+SPPPP
Sbjct: 339 PSPNVYYKSPPPPYVYSSPPPP 360

 Score =  222 bits (565), Expect = 2e-56
 Identities = 127/253 (50%), Positives = 131/253 (51%), Gaps = 76/253 (30%)
 Frame = -3

Query: 531 YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
           Y+YSSPPPP      KVY    PPP VY    PP YSP PKVY    PPP VY    PPY
Sbjct: 152 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 211

Query: 381 H-------YSSPPPP-VYSPPKKPYH----------------YSSPPPPVY--------- 301
           +       Y SPPPP VYS P  PY+                YSSPPPP Y         
Sbjct: 212 YSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 271

Query: 300 SPPPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           SPPPPY YSSPPPP            P  PY YSSPPPP +  SPK YY SPPP   PY 
Sbjct: 272 SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP---PYV 328

Query: 156 YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVYS 40
           Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP YS
Sbjct: 329 YSSPPPPYYSPSPNVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYS 388

Query: 39  PPPPYHYTSPPPP 1
           P P  HY SPPPP
Sbjct: 389 PSPKVHYKSPPPP 401

 Score =  215 bits (548), Expect = 2e-54
 Identities = 117/209 (55%), Positives = 122/209 (58%), Gaps = 32/209 (15%)
 Frame = -3

Query: 531 YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
           Y+YSSPPPP      KVY    PPP VY    PP YSP PKVY    PPP VY    PPY
Sbjct: 227 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 286

Query: 381 H-------YSSPPPP-VYSPPKKPYHYSSPPPPVY--SPPPPYHYSSPPPP--------- 259
           +       Y SPPPP VYS P  PY+  SP P VY  SPPPPY YSSPPPP         
Sbjct: 287 YSPSPKVYYKSPPPPYVYSSPPPPYY--SPSPKVYYKSPPPPYVYSSPPPPYYSPSPNVY 344

Query: 258 ---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP 88
              P  PY YSSPPPP +  SPK +Y SPPP   PY Y SPPPP YSP P  HY SPPP 
Sbjct: 345 YKSPPPPYVYSSPPPPYYSPSPKVHYKSPPP---PYVYSSPPPPYYSPSPKVHYKSPPP- 400

Query: 87  PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PY Y SPPPP YSP P   Y SPPPP
Sbjct: 401 ---PYVYSSPPPPYYSPSPKVTYKSPPPP 426

 Score =  197 bits (502), Expect = 4e-49
 Identities = 121/264 (45%), Positives = 133/264 (50%), Gaps = 69/264 (26%)
 Frame = -3

Query: 585 LLVALVSLTLPSLISAN--SYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPP 412
           L+  +V + + S I+A   SY YSSP  P      SP  +   P Y+P PK Y   SPPP
Sbjct: 3   LMNCMVYVVVLSAIAATVTSYPYSSPHTPAYD---SPSYEHKGPKYAPHPKPYVYSSPPP 59

Query: 411 KVYPPVS--------PPYHYSSPPPPVYSPPKKPYHYSSPPPPVYS-PPPPY-------H 280
             Y P          PPY Y+SPPPP YSP  K Y+ S PPP VYS PPPPY       +
Sbjct: 60  PYYTPSPKVNYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVY 119

Query: 279 YSSPPPP---------------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
           Y SPPPP                     P  PY YSSPPPP +  SPK YY SPPP   P
Sbjct: 120 YKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP---P 176

Query: 162 YYYHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPV 46
           Y Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP 
Sbjct: 177 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 236

Query: 45  Y---------SPPPPYHYTSPPPP 1
           Y         SPPPPY Y+SPPPP
Sbjct: 237 YSPSPKVYYKSPPPPYVYSSPPPP 260

 Score =  143 bits (361), Expect = 1e-32
 Identities = 79/145 (54%), Positives = 81/145 (55%), Gaps = 20/145 (13%)
 Frame = -3

Query: 531 YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
           Y+YSSPPPP      KVY    PPP VY    PP YSP P VY    PPP VY    PPY
Sbjct: 302 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPPPPY 361

Query: 381 -------HYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPP 223
                  HY SPPP        PY YSSPPPP YSP P  HY SPPP    PY YSSPPP
Sbjct: 362 YSPSPKVHYKSPPP--------PYVYSSPPPPYYSPSPKVHYKSPPP----PYVYSSPPP 409

Query: 222 PEHHVSPKPYYHSPPPP---KKPYY 157
           P +  SPK  Y SPPPP   K PYY
Sbjct: 410 PYYSPSPKVTYKSPPPPYVYKTPYY 434

[22][TOP]
>UniRef100_Q9C669 Putative uncharacterized protein F28B23.9 n=1 Tax=Arabidopsis
           thaliana RepID=Q9C669_ARATH
          Length = 443

 Score =  222 bits (565), Expect = 2e-56
 Identities = 121/202 (59%), Positives = 127/202 (62%), Gaps = 25/202 (12%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPP---VYS---PPPKVYPPVSPPPKVY-PPVSPPYHYS 373
           Y+Y+SPPP  VY   SPPP VY P   +YS   PPP VY    PPP VY  P  PPY YS
Sbjct: 40  YVYNSPPP-YVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYS 98

Query: 372 SPPPPVY---SPPKKPYHYSSPPPPVY----SPPPPYHYSSPPPPPKKPYKYSSPPPPEH 214
           SPPPP Y   SPP  PY YSSPPPP Y     PPPPY YSSPPPPP   Y YSSPPPP +
Sbjct: 99  SPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP---YVYSSPPPPPY 155

Query: 213 HVS---PKPYYHSPPPPKKPYYYHSPPPPVY----SPPPPYHYSSPPPPPKKPYYYHSPP 55
                 P PY +SPPPP  PY Y SPPPP Y     PPPPY Y SPPPP   PY Y SPP
Sbjct: 156 VYKSPPPPPYVYSPPPPP-PYVYQSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPP 211

Query: 54  PPVY----SPPPPYHYTSPPPP 1
           PP Y     PPPPY Y+SPPPP
Sbjct: 212 PPPYVYKSPPPPPYVYSSPPPP 233

 Score =  221 bits (563), Expect = 4e-56
 Identities = 125/222 (56%), Positives = 129/222 (58%), Gaps = 37/222 (16%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPK-VYPPVSPPPKVY--PPVYSPPPKVYPPVSPPPKVY-PPVSP 388
           P +     Y+YSSPPPP  VY    PPP VY  PP   PPP VY    PPP VY  P  P
Sbjct: 57  PYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPP---PPPYVYSSPPPPPYVYKSPPPP 113

Query: 387 PYHYSSPPPPVY---SPPKKPYHYSSPPPPVY----SPPPPYHYSSPP-------PPPKK 250
           PY YSSPPPP Y   SPP  PY YSSPPPP Y     PPPPY Y SPP       PPP  
Sbjct: 114 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPP 173

Query: 249 PYKYSSPPPPEHHVS---PKPY-YHSPPPPKKPYYYHSPPPPVY----SPPPPYHYSSPP 94
           PY Y SPPPP +  S   P PY Y SPPPP  PY Y SPPPP Y     PPPPY YSSPP
Sbjct: 174 PYVYQSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVYSSPP 231

Query: 93  P-------PPKKPYYYHSPPPPVY----SPPPPYHYTSPPPP 1
           P       PP  PY Y SPPPP Y     PPPPY Y+SPPPP
Sbjct: 232 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 273

 Score =  219 bits (559), Expect = 1e-55
 Identities = 123/207 (59%), Positives = 126/207 (60%), Gaps = 30/207 (14%)
 Frame = -3

Query: 531 YLYSSPPPPK-VYPPVSPPPKVY--PPVYSPPPKVYPPVSPPPKVYP-PVSPPYHYSSPP 364
           Y+YSSPPPP  VY    PPP VY  PP   PPP VY    PPP VY  P  PPY YSSPP
Sbjct: 95  YVYSSPPPPPYVYKSPPPPPYVYSSPP---PPPYVYKSPPPPPYVYSSPPPPPYVYSSPP 151

Query: 363 PPVY---SPPKKPYHYSSPPPPVY----SPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVS 205
           PP Y   SPP  PY YS PPPP Y     PPPPY YSSPPPPP   Y Y SPPPP +  S
Sbjct: 152 PPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPP---YVYKSPPPPPYVYS 208

Query: 204 ---PKPY-YHSPPPPKKPYYYHSPPPPVY----SPPPPYHYSSPPP-------PPKKPYY 70
              P PY Y SPPPP  PY Y SPPPP Y     PPPPY YSSPPP       PP  PY 
Sbjct: 209 SPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 266

Query: 69  YHSPPPPVY----SPPPPYHYTSPPPP 1
           Y SPPPP Y     PPPPY Y+SPPPP
Sbjct: 267 YSSPPPPPYVYKSPPPPPYVYSSPPPP 293

 Score =  205 bits (521), Expect = 3e-51
 Identities = 124/232 (53%), Positives = 134/232 (57%), Gaps = 30/232 (12%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPP 427
           MAS  +  L+ +V L L S+++  S  YS  P P  Y P+  PP VY    SPPP VY  
Sbjct: 1   MASPNWPSLLMVV-LALYSMVAYTSAQYSPTPTP--YSPL--PPYVYN---SPPPYVYNS 52

Query: 426 VSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVY----SPPPPYHYSSPPP- 262
            SPPP VY P  PPY YSSPPPP       PY YSSPPPP Y     PPPPY YSSPPP 
Sbjct: 53  PSPPPYVYKP--PPYIYSSPPPP-------PYVYSSPPPPPYVYNSPPPPPYVYSSPPPP 103

Query: 261 ------PPKKPYKYSSPPPPEH-HVSPKP---YYHSPPPPKKPYYYHSPPPPVY----SP 124
                 PP  PY YSSPPPP + + SP P    Y SPPPP  PY Y SPPPP Y     P
Sbjct: 104 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP--PYVYSSPPPPPYVYKSPP 161

Query: 123 PPPYHYSSPPP-------PPKKPYYYHSPPPPVY----SPPPPYHYTSPPPP 1
           PPPY YS PPP       PP  PY Y SPPPP Y     PPPPY Y+SPPPP
Sbjct: 162 PPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 213

 Score =  186 bits (472), Expect = 1e-45
 Identities = 115/225 (51%), Positives = 122/225 (54%), Gaps = 48/225 (21%)
 Frame = -3

Query: 531 YLYSSPPPPK-VYPPVSPPPKVY----PPVY-----SPPPKVYPPVSPPPKVYP-PVSPP 385
           Y+YSSPPPP  VY    PPP VY    PP Y      PPP VY    PPP VY  P  PP
Sbjct: 225 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 284

Query: 384 YHYSSPPPPVY---SPPKKPYHYSSPPPPVY----SPPPPYHYSSPPPPPKKPYKYSSPP 226
           Y YSSPPPP Y   SPP  PY YSSPPPP Y     PPPPY Y+SPPPPP   Y Y SPP
Sbjct: 285 YVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPP---YVYKSPP 341

Query: 225 PPEHHVS-----------PKPYYHSPPP-------PKKPYYYHSPPPPVYS--------- 127
           PP +  S           P PY + PPP       P  PY Y  PPP VYS         
Sbjct: 342 PPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYSPPPAPYVY-KPPPYVYSYSPPPAPYV 400

Query: 126 -PPPPYHYS-SPPPPPKKPYYYHSPPPPVY-SPPPPYHYTSPPPP 1
             PPPY YS SPPP P    Y + PPP VY SP PP +Y+SP PP
Sbjct: 401 YKPPPYVYSYSPPPAP----YVYKPPPYVYSSPSPPPYYSSPSPP 441

 Score =  139 bits (350), Expect = 2e-31
 Identities = 89/202 (44%), Positives = 93/202 (46%), Gaps = 61/202 (30%)
 Frame = -3

Query: 531 YLYSSPPPPK-VYPPVSPPPKVY--PPVYSPPPKVYPPVSPPPKVYP-PVSPPYHYSSPP 364
           Y+YSSPPPP  VY    PPP VY  PP   PPP VY    PPP VY  P  PPY YSSPP
Sbjct: 245 YVYSSPPPPPYVYKSPPPPPYVYSSPP---PPPYVYKSPPPPPYVYSSPPPPPYVYSSPP 301

Query: 363 PPVY---SPPKKPYHYSSPPPPVY----SPPPPYHYSSPPPPP----------------- 256
           PP Y   SPP  PY Y SPPPP Y     PPPPY Y SPPPPP                 
Sbjct: 302 PPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPP 361

Query: 255 -----------------------KKPYKYSSPPPPEHHV-SPKPYYHSPPPPKKPYYYHS 148
                                    PY YS  PPP  +V  P PY +S  PP  PY Y  
Sbjct: 362 PYVYKPPPYVYNYSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSYSPPPAPYVYKP 421

Query: 147 PP--------PPVY-SPPPPYH 109
           PP        PP Y SP PP +
Sbjct: 422 PPYVYSSPSPPPYYSSPSPPLY 443

 Score = 81.6 bits (200), Expect = 5e-14
 Identities = 54/112 (48%), Positives = 56/112 (50%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           P +     Y+Y   PPP VY   SPPP  Y  VY PPP VY   SPPP  Y    PPY Y
Sbjct: 355 PYVYKPPPYVYK--PPPYVY-NYSPPPAPY--VYKPPPYVY-SYSPPPAPYVYKPPPYVY 408

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPP 220
           S      YSPP  PY Y          PPPY YSSP PPP     YSSP PP
Sbjct: 409 S------YSPPPAPYVYK---------PPPYVYSSPSPPP----YYSSPSPP 441

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 34/68 (50%), Positives = 38/68 (55%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           P +     Y+YS  PPP  Y    PPP VY   YSPPP  Y    PPP VY   SPP +Y
Sbjct: 380 PYVYKPPPYVYSYSPPPAPY-VYKPPPYVYS--YSPPPAPY-VYKPPPYVYSSPSPPPYY 435

Query: 375 SSPPPPVY 352
           SSP PP+Y
Sbjct: 436 SSPSPPLY 443

[23][TOP]
>UniRef100_UPI0001739340 ATHRGP1 (HYDROXYPROLINE-RICH GLYCOPROTEIN); structural constituent of
            cell wall n=1 Tax=Arabidopsis thaliana
            RepID=UPI0001739340
          Length = 699

 Score =  221 bits (562), Expect = 5e-56
 Identities = 127/253 (50%), Positives = 129/253 (50%), Gaps = 76/253 (30%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
            Y+YSSPPPP   P         PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 281  YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPY 340

Query: 405  YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
            Y P          PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 341  YSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 400

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P  PY YSSPPPP +  SPK YY SPPP   PY 
Sbjct: 401  SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP---PYV 457

Query: 156  YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVYS 40
            Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP YS
Sbjct: 458  YSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYS 517

Query: 39   PPPPYHYTSPPPP 1
            P P  HY SPPPP
Sbjct: 518  PSPKVHYKSPPPP 530

 Score =  219 bits (557), Expect = 2e-55
 Identities = 128/250 (51%), Positives = 134/250 (53%), Gaps = 65/250 (26%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVY-----PPVSPPPKVY----PPVY---SPPPKVYPPVSPPP 412
            P+   +    Y SPPPP VY     P  SP PKVY    PP Y   SPPP  Y   SP P
Sbjct: 364  PTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY---SPSP 420

Query: 411  KVY---PPVSPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVY---------SPP 292
            KVY   PP  PPY YSSPPPP YSP        P  PY YSSPPPP Y         SPP
Sbjct: 421  KVYYKSPP--PPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPP 478

Query: 291  PPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHS 148
            PPY YSSPPPP            P  PY YSSPPPP +  SPK +Y SPPP   PY Y+S
Sbjct: 479  PPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPP---PYVYNS 535

Query: 147  PPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVYSPPP 31
            PPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP YSP P
Sbjct: 536  PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 595

Query: 30   PYHYTSPPPP 1
              +Y SPPPP
Sbjct: 596  KVYYKSPPPP 605

 Score =  215 bits (547), Expect = 3e-54
 Identities = 128/262 (48%), Positives = 131/262 (50%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
           Y+YSSPPPP   P         PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 181 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 240

Query: 405 YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
           Y P          PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 241 YSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 300

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
             PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 301 SPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPP---PYV 357

Query: 156 YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
           Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 358 YSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYS 417

Query: 42  --------SPPPPYHYTSPPPP 1
                   SPPPPY Y+SPPPP
Sbjct: 418 PSPKVYYKSPPPPYVYSSPPPP 439

 Score =  214 bits (546), Expect = 3e-54
 Identities = 128/262 (48%), Positives = 131/262 (50%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
           Y+YSSPPPP   P         PPP VY    PP YSP PKV     PPP VY    PP 
Sbjct: 81  YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPY 140

Query: 393 ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                        PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 141 YSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYK 200

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
             PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 201 SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP---PYV 257

Query: 156 YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
           Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 258 YSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYS 317

Query: 42  --------SPPPPYHYTSPPPP 1
                   SPPPPY Y+SPPPP
Sbjct: 318 PSPKVDYKSPPPPYVYSSPPPP 339

 Score =  206 bits (525), Expect = 9e-52
 Identities = 116/225 (51%), Positives = 124/225 (55%), Gaps = 48/225 (21%)
 Frame = -3

Query: 531  YLYSSPPP------PKVYPPVSPPPKVY----PPVYSPPPKVY-----PPV---SPPPKV 406
            Y+YSSPPP      PKVY    PPP VY    PP YSP PKV+     PP    SPPP  
Sbjct: 456  YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 515

Query: 405  YPP--------VSPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSPPPPYHYS 274
            Y P          PPY Y+SPPPP YSP        P  PY YSSPPPP YSP P  +Y 
Sbjct: 516  YSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 575

Query: 273  SPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP----------KKPYYYH----SPPPP 136
            SPPP    PY YSSPPPP +  SPK YY SPPPP          K P + H     PPPP
Sbjct: 576  SPPP----PYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPP 631

Query: 135  VYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             YSP P   Y SPPP    PY Y+SPPPP YSP P  +Y SPPPP
Sbjct: 632  CYSPSPKVVYKSPPP----PYVYNSPPPPYYSPSPKVYYKSPPPP 672

 Score =  199 bits (506), Expect = 2e-49
 Identities = 119/262 (45%), Positives = 132/262 (50%), Gaps = 59/262 (22%)
 Frame = -3

Query: 609 LMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYP 430
           L+++    ++  +V+   P   ++   LYSSP P   Y   +PP    P V S PP  Y 
Sbjct: 13  LISALGVIIMATMVAAYEPETYASPPPLYSSPLPEVEYK--TPP---LPYVDSSPPPTYT 67

Query: 429 PVSPPPKVYPPVSPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
           P   P   Y    PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 68  PA--PEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 125

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
             PPPY Y+SPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 126 SPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPP---PYV 182

Query: 156 YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
           Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 183 YSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 242

Query: 42  --------SPPPPYHYTSPPPP 1
                   SPPPPY Y+SPPPP
Sbjct: 243 PSPKVDYKSPPPPYVYSSPPPP 264

 Score =  183 bits (465), Expect = 9e-45
 Identities = 103/201 (51%), Positives = 109/201 (54%), Gaps = 30/201 (14%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
            Y+YSSPPPP      KV+    PPP VY    PP YSP PKVY    PPP VY    PP 
Sbjct: 506  YVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 565

Query: 393  ------------SPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKK 250
                         PPY YSSPPPP YSP  K Y Y SPPPP YSP P  +Y SPP P   
Sbjct: 566  YSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVY-YKSPPPPYYSPSPKVYYKSPPHP--- 621

Query: 249  PYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP----PK 82
                  PPPP +  SPK  Y SPPP   PY Y+SPPPP YSP P  +Y SPPPP    P 
Sbjct: 622  HVCVCPPPPPCYSPSPKVVYKSPPP---PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPS 678

Query: 81   KPYYYHSPPPPVYSPPPPYHY 19
                Y SPPPP YSP P   Y
Sbjct: 679  PKVEYKSPPPPSYSPSPKTEY 699

 Score =  101 bits (251), Expect = 6e-20
 Identities = 57/126 (45%), Positives = 64/126 (50%), Gaps = 4/126 (3%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           P   S +  +Y   PPP  Y   SP PKVY   Y  PP  +  V PPP   PP      Y
Sbjct: 588 PPYYSPSPKVYYKSPPPPYY---SPSPKVY---YKSPPHPHVCVCPPP---PPC-----Y 633

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP----PKKPYKYSSPPPPEHHV 208
           S  P  VY  P  PY Y+SPPPP YSP P  +Y SPPPP    P    +Y SPPPP +  
Sbjct: 634 SPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 693

Query: 207 SPKPYY 190
           SPK  Y
Sbjct: 694 SPKTEY 699

[24][TOP]
>UniRef100_Q9M1H0 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9M1H0_ARATH
          Length = 951

 Score =  221 bits (562), Expect = 5e-56
 Identities = 117/211 (55%), Positives = 122/211 (57%), Gaps = 34/211 (16%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
            Y+YSSPPPP      KVY    PPP VY    PP YSP PKVY    PPP VY    PPY
Sbjct: 475  YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 534

Query: 381  H-------YSSPPPPVYSP--------PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKP 247
            +       Y SPPPP YSP        P  PY YSSPPPP YSP P  +Y SPPP    P
Sbjct: 535  YSPSPKVYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP----P 590

Query: 246  YKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYY 67
            Y YSSPPPP H  SPK  Y SPPP   PY Y SPPPP YSP P  +Y SPPP    PY Y
Sbjct: 591  YVYSSPPPPYHSPSPKVQYKSPPP---PYVYSSPPPPYYSPSPKVYYKSPPP----PYVY 643

Query: 66   HSPPPPVY---------SPPPPYHYTSPPPP 1
             SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 644  SSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 674

 Score =  220 bits (561), Expect = 6e-56
 Identities = 128/253 (50%), Positives = 131/253 (51%), Gaps = 76/253 (30%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
            Y+YSSPPPP   P         PPP VY    PP YSP PKV     PPP VY    PP 
Sbjct: 325  YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPT 384

Query: 393  ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                         PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 385  YSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYK 444

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P  PY YSSPPPP +  SPK YY SPPP   PY 
Sbjct: 445  SPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP---PYV 501

Query: 156  YHSPPPPVY---------SPPPPYHYSSPPPP---PKKPYYYHSPPPPVY---------S 40
            Y SPPPP Y         SPPPPY YSSPPPP   P    YY SPPPP Y         S
Sbjct: 502  YSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKS 561

Query: 39   PPPPYHYTSPPPP 1
            PPPPY Y+SPPPP
Sbjct: 562  PPPPYVYSSPPPP 574

 Score =  217 bits (552), Expect = 7e-55
 Identities = 128/262 (48%), Positives = 131/262 (50%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
           Y+YSSPPPP   P         PPP VY    PP YSP PKV     PPP VY    PP 
Sbjct: 100 YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPT 159

Query: 393 ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                        PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 160 YSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYK 219

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
             PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 220 SPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPP---PYV 276

Query: 156 YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
           Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 277 YSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYS 336

Query: 42  --------SPPPPYHYTSPPPP 1
                   SPPPPY Y+SPPPP
Sbjct: 337 PSPKVEYKSPPPPYVYSSPPPP 358

 Score =  216 bits (551), Expect = 9e-55
 Identities = 129/262 (49%), Positives = 132/262 (50%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
            Y+YSSPPPP      KV     PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 250  YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPY 309

Query: 405  YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
            Y P          PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 310  YSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYK 369

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 370  SPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPP---PYV 426

Query: 156  YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
            Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 427  YSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYS 486

Query: 42   --------SPPPPYHYTSPPPP 1
                    SPPPPY Y+SPPPP
Sbjct: 487  PSPKVYYKSPPPPYVYSSPPPP 508

 Score =  216 bits (551), Expect = 9e-55
 Identities = 123/233 (52%), Positives = 126/233 (54%), Gaps = 56/233 (24%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVS--- 391
            Y+YSSPPPP      KVY    PPP VY    PP YSP PKV+   SPPP  Y P     
Sbjct: 717  YVYSSPPPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYK-SPPPPYYAPTPKVH 775

Query: 390  -----PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKK 250
                 PPY YSSPPPP YSP        P  PY YSSPPPP YSP P   Y SPPP    
Sbjct: 776  YKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPP---- 831

Query: 249  PYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY---------SPPPPYHYSSP 97
            PY YSSPPPP +  SPK  Y SPPP   PY Y SPPPP Y         SPPPPY YSSP
Sbjct: 832  PYVYSSPPPPYYSPSPKVDYKSPPP---PYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSP 888

Query: 96   PPP------------PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
            PPP            P  PY Y SPPPP Y         SPPPPY Y SPPPP
Sbjct: 889  PPPYYSPSPVVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYKSPPPP 941

 Score =  216 bits (549), Expect = 2e-54
 Identities = 118/221 (53%), Positives = 122/221 (55%), Gaps = 45/221 (20%)
 Frame = -3

Query: 528  LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPY-------HYSS 370
            +Y SPPPP VY   SPPP    P YSP PKVY    PPP VY    PPY       HY S
Sbjct: 709  VYKSPPPPYVYS--SPPP----PHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKS 762

Query: 369  PPPPVYSP--------PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEH 214
            PPPP Y+P        P  PY YSSPPPP YSP P  HY SPPP    PY YSSPPPP +
Sbjct: 763  PPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPP----PYVYSSPPPPYY 818

Query: 213  HVSPKPYYHSPPPPKKPYYYHSPPPPVY---------SPPPPYHYSSPPPP--------- 88
              SPK  Y SPPP   PY Y SPPPP Y         SPPPPY YSSPPPP         
Sbjct: 819  SPSPKVEYKSPPP---PYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVD 875

Query: 87   ---PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
               P  PY Y SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 876  YKSPPPPYVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPPPP 916

 Score =  213 bits (543), Expect = 8e-54
 Identities = 113/221 (51%), Positives = 116/221 (52%), Gaps = 44/221 (19%)
 Frame = -3

Query: 531  YLYSSPPP------PKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
            Y+YSSPPP      PKV     PPP VY    PP YSP PKVY    PPP VY    PPY
Sbjct: 591  YVYSSPPPPYHSPSPKVQYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 650

Query: 381  HYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP------------------- 259
             YS  P   Y  P  PY YSSPPPP YSP P  +Y SPP P                   
Sbjct: 651  -YSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVV 709

Query: 258  ---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP 88
               P  PY YSSPPPP +  SPK YY SPPP   PY Y SPPPP YSP P  HY SPPPP
Sbjct: 710  YKSPPPPYVYSSPPPPHYSPSPKVYYKSPPP---PYVYSSPPPPYYSPSPKVHYKSPPPP 766

Query: 87   ------------PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                        P  PY Y SPPPP YSP P  HY SPPPP
Sbjct: 767  YYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 807

 Score =  213 bits (543), Expect = 8e-54
 Identities = 130/272 (47%), Positives = 135/272 (49%), Gaps = 87/272 (31%)
 Frame = -3

Query: 555  PSLISANSYLYS-SPPPPKVY-----PPVSPPPKVY--------------PPVYSPPPKV 436
            P   S +  +Y  SPPPP VY     P  SP PKVY              PP YSP PKV
Sbjct: 623  PPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKV 682

Query: 435  Y---PP-----VSPPPK---------VYPPVSPPYHYSSPPPPVYSP--------PKKPY 331
            Y   PP     V PPP          VY    PPY YSSPPPP YSP        P  PY
Sbjct: 683  YYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPSPKVYYKSPPPPY 742

Query: 330  HYSSPPPPVYSPPPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYH 187
             YSSPPPP YSP P  HY SPPPP            P  PY YSSPPPP +  SPK +Y 
Sbjct: 743  VYSSPPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYK 802

Query: 186  SPPPPKKPYYYHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYY 70
            SPPP   PY Y SPPPP Y         SPPPPY YSSPPPP            P  PY 
Sbjct: 803  SPPP---PYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 859

Query: 69   YHSPPPPVY---------SPPPPYHYTSPPPP 1
            Y SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 860  YSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 891

 Score =  211 bits (538), Expect = 3e-53
 Identities = 123/255 (48%), Positives = 129/255 (50%), Gaps = 78/255 (30%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
            Y+YSSPPPP      KVY    PPP VY    PP YSP PKVY    PPP VY    PPY
Sbjct: 616  YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 675

Query: 381  H-------YSS----------PPPPVYSP--------PKKPYHYSSPPPPVYSPPPPYHY 277
            +       Y S          PPPP YSP        P  PY YSSPPPP YSP P  +Y
Sbjct: 676  YSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPSPKVYY 735

Query: 276  SSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPP-------------PKKPYYYHSPPPP 136
             SPPP    PY YSSPPPP +  SPK +Y SPPP             P  PY Y SPPPP
Sbjct: 736  KSPPP----PYVYSSPPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSPPPP 791

Query: 135  VY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY-------- 43
             Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y        
Sbjct: 792  YYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDY 851

Query: 42   -SPPPPYHYTSPPPP 1
             SPPPPY Y+SPPPP
Sbjct: 852  KSPPPPYVYSSPPPP 866

 Score =  206 bits (523), Expect = 2e-51
 Identities = 127/275 (46%), Positives = 131/275 (47%), Gaps = 98/275 (35%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
            Y+YSSPPPP   P         PPP VY    PP YSP PKV     PPP VY    PP 
Sbjct: 375  YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPY 434

Query: 393  ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                         PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 435  YSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYK 494

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPP----- 172
              PPPY YSSPPPP            P  PY YSSPPPP +  SPK YY SPPPP     
Sbjct: 495  SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPS 554

Query: 171  --------KKPYYYHSPPPPVYSPPPPYHY---------SSPPPP------------PKK 79
                      PY Y SPPPP YSP P  +Y         SSPPPP            P  
Sbjct: 555  PKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSPKVQYKSPPP 614

Query: 78   PYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
            PY Y SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 615  PYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 649

 Score =  204 bits (518), Expect = 6e-51
 Identities = 129/287 (44%), Positives = 132/287 (45%), Gaps = 110/287 (38%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
            Y+YSSPPPP   P         PPP VY    PP YSP PKV     PPP VY    PP 
Sbjct: 150  YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPY 209

Query: 393  ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                         PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 210  YSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYK 269

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPPP   Y 
Sbjct: 270  SPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP---YV 326

Query: 156  YHSPPPP-----------------VY-----------------SPPPPYHYSSPPPP--- 88
            Y SPPPP                 VY                 SPPPPY YSSPPPP   
Sbjct: 327  YSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYS 386

Query: 87   ---------PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
                     P  PY Y SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 387  PSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPP 433

 Score =  202 bits (514), Expect = 2e-50
 Identities = 123/262 (46%), Positives = 135/262 (51%), Gaps = 67/262 (25%)
 Frame = -3

Query: 585 LLVALVSLTLPSLISA-NSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPK 409
           L+ AL  + + ++++A + Y  SSPPP  +Y   SP PK+    Y  PP  Y   SPPP 
Sbjct: 7   LICALGVVIMATMVAAYDPYTDSSPPP--LYS--SPLPKIE---YKTPPLPYIDSSPPPT 59

Query: 408 VYPPVS-------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
             P          PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 60  YSPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYK 119

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
             PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 120 SPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPP---PYV 176

Query: 156 YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
           Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 177 YSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYS 236

Query: 42  --------SPPPPYHYTSPPPP 1
                   SPPPPY Y+SPPPP
Sbjct: 237 PSPKVDYKSPPPPYVYSSPPPP 258

 Score =  162 bits (409), Expect = 3e-38
 Identities = 96/195 (49%), Positives = 99/195 (50%), Gaps = 55/195 (28%)
 Frame = -3

Query: 525  YSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV-- 394
            Y SPPPP      KV+    PPP VY    PP YSP PKV+    PPP VY    PP   
Sbjct: 760  YKSPPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYS 819

Query: 393  ----------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP--------- 295
                       PPY YSSPPPP YSP        P  PY YSSPPPP YSP         
Sbjct: 820  PSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 879

Query: 294  PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYH 151
            PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPPP   Y Y 
Sbjct: 880  PPPYVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP---YVYK 936

Query: 150  SPPPPVYSPPPPYHY 106
            SPPPP YSP P   Y
Sbjct: 937  SPPPPSYSPSPKTEY 951

 Score =  110 bits (274), Expect = 1e-22
 Identities = 70/149 (46%), Positives = 72/149 (48%), Gaps = 43/149 (28%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
            Y+YSSPPPP      KV     PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 808  YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 867

Query: 405  YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
            Y P          PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 868  YSPSPKVDYKSPPPPYVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPPPPYYSPSPKVEYK 927

Query: 294  --PPPYHYSSPPPPPKKPYKYSSPPPPEH 214
              PPPY Y SPPPP      YS  P  E+
Sbjct: 928  SPPPPYVYKSPPPP-----SYSPSPKTEY 951

[25][TOP]
>UniRef100_Q9M1G9 Extensin-2 n=1 Tax=Arabidopsis thaliana RepID=EXTN2_ARATH
          Length = 743

 Score =  221 bits (562), Expect = 5e-56
 Identities = 127/253 (50%), Positives = 129/253 (50%), Gaps = 76/253 (30%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
            Y+YSSPPPP   P         PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 325  YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPY 384

Query: 405  YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
            Y P          PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 385  YSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 444

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P  PY YSSPPPP +  SPK YY SPPP   PY 
Sbjct: 445  SPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP---PYV 501

Query: 156  YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVYS 40
            Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP YS
Sbjct: 502  YSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYS 561

Query: 39   PPPPYHYTSPPPP 1
            P P  HY SPPPP
Sbjct: 562  PSPKVHYKSPPPP 574

 Score =  219 bits (557), Expect = 2e-55
 Identities = 128/250 (51%), Positives = 134/250 (53%), Gaps = 65/250 (26%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVY-----PPVSPPPKVY----PPVY---SPPPKVYPPVSPPP 412
            P+   +    Y SPPPP VY     P  SP PKVY    PP Y   SPPP  Y   SP P
Sbjct: 408  PTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY---SPSP 464

Query: 411  KVY---PPVSPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVY---------SPP 292
            KVY   PP  PPY YSSPPPP YSP        P  PY YSSPPPP Y         SPP
Sbjct: 465  KVYYKSPP--PPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPP 522

Query: 291  PPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHS 148
            PPY YSSPPPP            P  PY YSSPPPP +  SPK +Y SPPP   PY Y+S
Sbjct: 523  PPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPP---PYVYNS 579

Query: 147  PPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVYSPPP 31
            PPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP YSP P
Sbjct: 580  PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 639

Query: 30   PYHYTSPPPP 1
              +Y SPPPP
Sbjct: 640  KVYYKSPPPP 649

 Score =  215 bits (547), Expect = 3e-54
 Identities = 128/262 (48%), Positives = 131/262 (50%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
            Y+YSSPPPP   P         PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 225  YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 284

Query: 405  YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
            Y P          PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 285  YSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 344

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 345  SPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPP---PYV 401

Query: 156  YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
            Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 402  YSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYS 461

Query: 42   --------SPPPPYHYTSPPPP 1
                    SPPPPY Y+SPPPP
Sbjct: 462  PSPKVYYKSPPPPYVYSSPPPP 483

 Score =  214 bits (545), Expect = 5e-54
 Identities = 128/262 (48%), Positives = 131/262 (50%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
           Y+YSSPPPP   P         PPP VY    PP YSP PKV     PPP VY    PP 
Sbjct: 75  YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPY 134

Query: 393 ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                        PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 135 YSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYK 194

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
             PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 195 SPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP---PYV 251

Query: 156 YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
           Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 252 YSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 311

Query: 42  --------SPPPPYHYTSPPPP 1
                   SPPPPY Y+SPPPP
Sbjct: 312 PSPKVDYKSPPPPYVYSSPPPP 333

 Score =  206 bits (525), Expect = 9e-52
 Identities = 116/225 (51%), Positives = 124/225 (55%), Gaps = 48/225 (21%)
 Frame = -3

Query: 531  YLYSSPPP------PKVYPPVSPPPKVY----PPVYSPPPKVY-----PPV---SPPPKV 406
            Y+YSSPPP      PKVY    PPP VY    PP YSP PKV+     PP    SPPP  
Sbjct: 500  YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 559

Query: 405  YPP--------VSPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSPPPPYHYS 274
            Y P          PPY Y+SPPPP YSP        P  PY YSSPPPP YSP P  +Y 
Sbjct: 560  YSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 619

Query: 273  SPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP----------KKPYYYH----SPPPP 136
            SPPP    PY YSSPPPP +  SPK YY SPPPP          K P + H     PPPP
Sbjct: 620  SPPP----PYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPP 675

Query: 135  VYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             YSP P   Y SPPP    PY Y+SPPPP YSP P  +Y SPPPP
Sbjct: 676  CYSPSPKVVYKSPPP----PYVYNSPPPPYYSPSPKVYYKSPPPP 716

 Score =  204 bits (519), Expect = 5e-51
 Identities = 130/284 (45%), Positives = 134/284 (47%), Gaps = 107/284 (37%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
           Y+Y+SPPPP   P         PPP VY    PP YSP PKV     PPP VY    PP 
Sbjct: 125 YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 184

Query: 393 ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                        PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 185 YSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYK 244

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPP----- 172
             PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPPP     
Sbjct: 245 SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSS 304

Query: 171 -KKPYY-------YHSPPPP-VY-----------------SPPPPYHYSSPPPP------ 88
              PYY       Y SPPPP VY                 SPPPPY YSSPPPP      
Sbjct: 305 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSP 364

Query: 87  ------PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
                 P  PY Y SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 365 KVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 408

 Score =  199 bits (506), Expect = 2e-49
 Identities = 119/262 (45%), Positives = 132/262 (50%), Gaps = 59/262 (22%)
 Frame = -3

Query: 609 LMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYP 430
           L+++    ++  +V+   P   ++   LYSSP P   Y   +PP    P V S PP  Y 
Sbjct: 7   LISALGVIIMATMVAAYEPETYASPPPLYSSPLPEVEYK--TPP---LPYVDSSPPPTYT 61

Query: 429 PVSPPPKVYPPVSPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
           P   P   Y    PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 62  PA--PEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 119

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
             PPPY Y+SPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 120 SPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPP---PYV 176

Query: 156 YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
           Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 177 YSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYS 236

Query: 42  --------SPPPPYHYTSPPPP 1
                   SPPPPY Y+SPPPP
Sbjct: 237 PSPKVDYKSPPPPYVYSSPPPP 258

 Score =  183 bits (465), Expect = 9e-45
 Identities = 103/201 (51%), Positives = 109/201 (54%), Gaps = 30/201 (14%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
            Y+YSSPPPP      KV+    PPP VY    PP YSP PKVY    PPP VY    PP 
Sbjct: 550  YVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 609

Query: 393  ------------SPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKK 250
                         PPY YSSPPPP YSP  K Y Y SPPPP YSP P  +Y SPP P   
Sbjct: 610  YSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVY-YKSPPPPYYSPSPKVYYKSPPHP--- 665

Query: 249  PYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP----PK 82
                  PPPP +  SPK  Y SPPP   PY Y+SPPPP YSP P  +Y SPPPP    P 
Sbjct: 666  HVCVCPPPPPCYSPSPKVVYKSPPP---PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPS 722

Query: 81   KPYYYHSPPPPVYSPPPPYHY 19
                Y SPPPP YSP P   Y
Sbjct: 723  PKVEYKSPPPPSYSPSPKTEY 743

 Score =  101 bits (251), Expect = 6e-20
 Identities = 57/126 (45%), Positives = 64/126 (50%), Gaps = 4/126 (3%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           P   S +  +Y   PPP  Y   SP PKVY   Y  PP  +  V PPP   PP      Y
Sbjct: 632 PPYYSPSPKVYYKSPPPPYY---SPSPKVY---YKSPPHPHVCVCPPP---PPC-----Y 677

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP----PKKPYKYSSPPPPEHHV 208
           S  P  VY  P  PY Y+SPPPP YSP P  +Y SPPPP    P    +Y SPPPP +  
Sbjct: 678 SPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 737

Query: 207 SPKPYY 190
           SPK  Y
Sbjct: 738 SPKTEY 743

[26][TOP]
>UniRef100_Q9LJK0 Genomic DNA, chromosome 3, P1 clone: MZN14 n=1 Tax=Arabidopsis
            thaliana RepID=Q9LJK0_ARATH
          Length = 1018

 Score =  218 bits (556), Expect = 2e-55
 Identities = 129/262 (49%), Positives = 134/262 (51%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
            Y+YSSPPPP      KV+    PPP VY    PP YSP PKV+    PPP VY    PP 
Sbjct: 659  YVYSSPPPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 718

Query: 393  ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                         PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 719  YSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYK 778

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 779  SPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPP---PYV 835

Query: 156  YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
            Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 836  YSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 895

Query: 42   --------SPPPPYHYTSPPPP 1
                    SPPPPY Y+SPPPP
Sbjct: 896  PSPKVDYKSPPPPYVYSSPPPP 917

 Score =  215 bits (547), Expect = 3e-54
 Identities = 128/262 (48%), Positives = 132/262 (50%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
            Y+YSSPPPP      K+     PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 242  YVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 301

Query: 405  YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
            Y P          PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 302  YSPSPKVVYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 361

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 362  SPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKVVYKSPPP---PYV 418

Query: 156  YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
            Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 419  YSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS 478

Query: 42   --------SPPPPYHYTSPPPP 1
                    SPPPPY Y+SPPPP
Sbjct: 479  PSPKVDYKSPPPPYVYSSPPPP 500

 Score =  212 bits (540), Expect = 2e-53
 Identities = 120/238 (50%), Positives = 123/238 (51%), Gaps = 62/238 (26%)
 Frame = -3

Query: 528  LYSSPPPPKVYPPVSPPPKVYPP----VYSPPPKVYPPVSPPPKVYPPVS--------PP 385
            +Y SPPPP VY   SPPP  Y P    VY  PP  Y   SPPP  Y P          PP
Sbjct: 384  VYKSPPPPYVYS--SPPPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 441

Query: 384  YHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP---------PPPYHYSSPPPP- 259
            Y YSSPPPP YSP        P  PY YSSPPPP YSP         PPPY YSSPPPP 
Sbjct: 442  YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 501

Query: 258  -----------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY------ 130
                       P  PY YSSPPPP +  SPK  Y SPPP   PY Y SPPPP Y      
Sbjct: 502  YSPSPKVLYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPP---PYVYSSPPPPYYSPSPKV 558

Query: 129  ---SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               SPPPPY YSSPPPP            P  PY Y SPPPP YSP P  +Y SPP P
Sbjct: 559  VYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSP 616

 Score =  212 bits (540), Expect = 2e-53
 Identities = 127/253 (50%), Positives = 130/253 (51%), Gaps = 76/253 (30%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
            Y+YSSPPPP      KV     PPP VY    PP YSP PKV     PPP VY    PP 
Sbjct: 759  YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 818

Query: 393  ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                         PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 819  YSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYK 878

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 879  SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP---PYV 935

Query: 156  YHSPPPPVY---------SPPPPYHYSSPPPP---PKKPYYYHSPPPPVY---------S 40
            Y SPPPP Y         SPPPPY YSSPPPP   P     Y SPPPP Y         S
Sbjct: 936  YSSPPPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSPKVDYKS 995

Query: 39   PPPPYHYTSPPPP 1
            PPPPY Y+SPPPP
Sbjct: 996  PPPPYVYSSPPPP 1008

 Score =  210 bits (535), Expect = 7e-53
 Identities = 122/242 (50%), Positives = 126/242 (52%), Gaps = 65/242 (26%)
 Frame = -3

Query: 531 YLYSSPPP------PKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSS 370
           Y+Y+SPPP      PKV     PPP VY    SPPP  Y P   P  VY    PPY YSS
Sbjct: 167 YVYNSPPPSYYSPSPKVDYKSPPPPYVYS---SPPPPYYSP--SPKVVYKSPPPPYVYSS 221

Query: 369 PPPPVYSP--------PKKPYHYSSPPPPVYSP---------PPPYHYSSPPPP------ 259
           PPPP YSP        P  PY YSSPPPP YSP         PPPY YSSPPPP      
Sbjct: 222 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSPSP 281

Query: 258 ------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY---------SP 124
                 P  PY YSSPPPP +  SPK  Y SPPP   PY Y SPPPP Y         SP
Sbjct: 282 KVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPP---PYVYSSPPPPYYSPTPKVDYKSP 338

Query: 123 PPPYHYSSPPPP------------PKKPYYYHSPPPPVY---------SPPPPYHYTSPP 7
           PPPY YSSPPPP            P  PY Y SPPPP Y         SPPPPY Y+SPP
Sbjct: 339 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPP 398

Query: 6   PP 1
           PP
Sbjct: 399 PP 400

 Score =  210 bits (534), Expect = 9e-53
 Identities = 124/262 (47%), Positives = 131/262 (50%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531 YLYSSPPP------PKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
           Y+Y+SPPP      PKV     PPP VY    PP+YSP PKV     PPP VY    PPY
Sbjct: 92  YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKSPPPPYVYSSPPPPY 151

Query: 381 H----------------YSSPPPPVYSP--------PKKPYHYSSPPPPVY--------- 301
           +                Y+SPPP  YSP        P  PY YSSPPPP Y         
Sbjct: 152 YSPSPKVEYKSPPSPYVYNSPPPSYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYK 211

Query: 300 SPPPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           SPPPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 212 SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPP---PYV 268

Query: 156 YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
           Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 269 YSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS 328

Query: 42  --------SPPPPYHYTSPPPP 1
                   SPPPPY Y+SPPPP
Sbjct: 329 PTPKVDYKSPPPPYVYSSPPPP 350

 Score =  209 bits (531), Expect = 2e-52
 Identities = 127/267 (47%), Positives = 130/267 (48%), Gaps = 90/267 (33%)
 Frame = -3

Query: 531  YLYSSPPP------PKVYPPVSPPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
            Y+YSSPPP      PKV     PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 442  YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 501

Query: 405  YPP--------VSPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVY--------- 301
            Y P          PPY YSSPPPP YSP        P  PY YSSPPPP Y         
Sbjct: 502  YSPSPKVLYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYK 561

Query: 300  SPPPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPP----- 172
            SPPPPY YSSPPPP            P  PY YSSPPPP +  SPK YY SPP P     
Sbjct: 562  SPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSPYHAPS 621

Query: 171  -----KKPYYYH----SPPPPVYSP---------PPPYHYSSPPPP------------PK 82
                 K P + H     PPPP YSP         PPPY YSSPPPP            P 
Sbjct: 622  PKVLYKSPPHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSPSPKVHYKSPP 681

Query: 81   KPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             PY Y SPPPP YSP P  HY SPPPP
Sbjct: 682  PPYVYSSPPPPYYSPSPKVHYKSPPPP 708

 Score =  207 bits (526), Expect = 7e-52
 Identities = 132/284 (46%), Positives = 135/284 (47%), Gaps = 107/284 (37%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
            Y+YSSPPPP      KV     PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 292  YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPY 351

Query: 405  YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVY--------- 301
            Y P          PPY YSSPPPP YSP        P  PY YSSPPPP Y         
Sbjct: 352  YSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKVVYK 411

Query: 300  SPPPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPP----- 172
            SPPPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPPP     
Sbjct: 412  SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSS 471

Query: 171  -KKPYY-------YHSPPPP-VY-----------------SPPPPYHYSSPPPP------ 88
               PYY       Y SPPPP VY                 SPPPPY YSSPPPP      
Sbjct: 472  PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPPYVYSSPPPPYYSPSP 531

Query: 87   ------PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
                  P  PY Y SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 532  KVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPP 575

 Score =  205 bits (521), Expect = 3e-51
 Identities = 120/236 (50%), Positives = 126/236 (53%), Gaps = 60/236 (25%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKV-YPPVSPPYHYSSPPPPVY 352
           +YSSPPPP  Y   SP PKV     SPPP  Y   SP PKV Y    PPY Y+SPPPP Y
Sbjct: 51  VYSSPPPPLEY---SPAPKV--DYKSPPPPYY---SPSPKVEYKSPPPPYVYNSPPPPYY 102

Query: 351 SP--------PKKPYHYSSPPPPVY---------SPPPPYHYSSPPPP------------ 259
           SP        P  PY YSSPPPP+Y         SPPPPY YSSPPPP            
Sbjct: 103 SPSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKS 162

Query: 258 PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY---------SPPPPYHY 106
           P  PY Y+SPPP  +  SPK  Y SPPP   PY Y SPPPP Y         SPPPPY Y
Sbjct: 163 PPSPYVYNSPPPSYYSPSPKVDYKSPPP---PYVYSSPPPPYYSPSPKVVYKSPPPPYVY 219

Query: 105 SSPPPP------------PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
           SSPPPP            P  PY Y SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 220 SSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPP 275

 Score =  202 bits (514), Expect = 2e-50
 Identities = 124/259 (47%), Positives = 128/259 (49%), Gaps = 82/259 (31%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPP-----VSPPPKVYPPVYSPPPKVYPPVSPPPK-VYPPVSPPYHYSS 370
            Y+YSSPPPP   P       SPPP   P VYS PP  Y   SP PK VY    PPY YSS
Sbjct: 542  YVYSSPPPPYYSPSPKVVYKSPPP---PYVYSSPPPPY--YSPSPKVVYKSPPPPYVYSS 596

Query: 369  PPPPVYSP--------PKKPYHYSS-----------------PPPPVYSP---------P 292
            PPPP YSP        P  PYH  S                 PPPP YSP         P
Sbjct: 597  PPPPYYSPSPKVYYKSPPSPYHAPSPKVLYKSPPHPHVCVCPPPPPCYSPSPKVVYKSSP 656

Query: 291  PPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHS 148
            PPY YSSPPPP            P  PY YSSPPPP +  SPK +Y SPPP   PY Y S
Sbjct: 657  PPYVYSSPPPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPP---PYVYSS 713

Query: 147  PPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY---- 43
            PPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y    
Sbjct: 714  PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSP 773

Query: 42   -----SPPPPYHYTSPPPP 1
                 SPPPPY Y+SPPPP
Sbjct: 774  KVVYKSPPPPYVYSSPPPP 792

 Score =  198 bits (503), Expect = 3e-49
 Identities = 116/238 (48%), Positives = 119/238 (50%), Gaps = 67/238 (28%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
            Y+YSSPPPP      KV     PPP VY    PP YSP PKV     PPP VY    PP 
Sbjct: 784  YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 843

Query: 393  ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                         PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 844  YSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 903

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P  PY YSSPPPP +  +PK  Y SPPPP   Y 
Sbjct: 904  SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYKSPPPP---YV 960

Query: 156  YHSPPPPVYSPPPPYHYSSPPPP------------PKKPYYYHSPPPPVYSPPPPYHY 19
            Y SPPPP YSP P   Y SPPPP            P  PY Y SPPPP YSP P   Y
Sbjct: 961  YSSPPPPYYSPSPKVDYKSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPSYSPSPKTEY 1018

 Score =  197 bits (502), Expect = 4e-49
 Identities = 120/264 (45%), Positives = 124/264 (46%), Gaps = 88/264 (33%)
 Frame = -3

Query: 528  LYSSPPPPKVYPPVSPPPKVYPP----VYSPPPKVYPPVSPPPKVYPPVS--------PP 385
            LY SPPPP VY   SPPP  Y P    VY  PP  Y   SPPP  Y P          PP
Sbjct: 509  LYKSPPPPYVYS--SPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP 566

Query: 384  YHYSSPPPPVYSPPKKPYHYSSPPPPVYS-PPPPYHYSSP-------------------- 268
            Y YSSPPPP YSP  K  + S PPP VYS PPPPY+  SP                    
Sbjct: 567  YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSPYHAPSPKVLY 626

Query: 267  -----------PPPP--------------KKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
                       PPPP                PY YSSPPPP H  SPK +Y SPPP   P
Sbjct: 627  KSPPHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSPSPKVHYKSPPP---P 683

Query: 162  YYYHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPV 46
            Y Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP 
Sbjct: 684  YVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPY 743

Query: 45   Y---------SPPPPYHYTSPPPP 1
            Y         SPPPPY Y+SPPPP
Sbjct: 744  YSPSPKVVYKSPPPPYVYSSPPPP 767

 Score =  177 bits (450), Expect = 5e-43
 Identities = 112/256 (43%), Positives = 126/256 (49%), Gaps = 61/256 (23%)
 Frame = -3

Query: 585 LLVALVSLTLPSLISA-NSYLYSSPPPPKV-YPPVSPPPKVYPPVYSPPPKVYPPVSPPP 412
           L+ A+  + + ++++A   Y  SSPPP  V  P V       P VYS PP        PP
Sbjct: 7   LVYAIGVIIMATMVAAYEPYTDSSPPPYSVPLPKVEYKSPPLPDVYSSPP--------PP 58

Query: 411 KVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVY-SPPPPYH--------------- 280
             Y P +P   Y SPPPP YSP  K  + S PPP VY SPPPPY+               
Sbjct: 59  LEYSP-APKVDYKSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPY 117

Query: 279 -YSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPP 139
            YSSPPPP            P  PY YSSPPPP +  SPK  Y SPP    PY Y+SPPP
Sbjct: 118 VYSSPPPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPP---SPYVYNSPPP 174

Query: 138 PVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY------- 43
             Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y       
Sbjct: 175 SYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVD 234

Query: 42  --SPPPPYHYTSPPPP 1
             SPPPPY Y+SPPPP
Sbjct: 235 YKSPPPPYVYSSPPPP 250

[27][TOP]
>UniRef100_Q9ZUC3 F5O8.27 protein n=1 Tax=Arabidopsis thaliana RepID=Q9ZUC3_ARATH
          Length = 895

 Score =  217 bits (552), Expect = 7e-55
 Identities = 121/240 (50%), Positives = 125/240 (52%), Gaps = 63/240 (26%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPV-------SPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPP 385
            Y+Y SPPPP  Y P        SPPP VY    PP YSP PK      PPP VY    PP
Sbjct: 562  YVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPP 621

Query: 384  YHYSSPPPPVYSPPKKPYHYSSPPPPVYSP---------PPPYHYSSPPPP--------- 259
            Y YS  P P Y  P  PY YSSPPPP YSP         PPPY YSSPPPP         
Sbjct: 622  Y-YSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPT 680

Query: 258  ---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY---------SPPPP 115
               P  PY YSSPPPP +  +PKP Y SPPP   PY Y SPPPP Y         SPPPP
Sbjct: 681  YKSPPPPYVYSSPPPPYYSPAPKPTYKSPPP---PYVYSSPPPPYYSPSPKPTYKSPPPP 737

Query: 114  YHYSSPPPP-------------PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
            Y YSSPPPP             P  PY Y SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 738  YVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 797

 Score =  213 bits (543), Expect = 8e-54
 Identities = 121/238 (50%), Positives = 126/238 (52%), Gaps = 61/238 (25%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPP--VYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPP 358
           Y+Y+SPPPP   P   P  K  PP  VYS PP  Y   SP P VY    PPY Y+SPPPP
Sbjct: 286 YVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKP-VYKSPPPPYVYNSPPPP 344

Query: 357 VYSP--------PKKPYHYSSPPPPVYSP---------PPPYHYSSPPPP---------- 259
            YSP        P  PY YSSPPPP YSP         PPPY YSSPPPP          
Sbjct: 345 YYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVY 404

Query: 258 --PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSP---------PPPY 112
             P  PY Y+SPPPP +  SPKP Y SPPP   PY Y SPPPP YSP         PPPY
Sbjct: 405 KSPPPPYIYNSPPPPYYSPSPKPSYKSPPP---PYVYSSPPPPYYSPSPKLTYKSSPPPY 461

Query: 111 HYSSPPPP------------PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
            YSSPPPP            P  PY Y SPPPP Y         SPPPPY Y SPPPP
Sbjct: 462 VYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPPP 519

 Score =  212 bits (540), Expect = 2e-53
 Identities = 125/259 (48%), Positives = 131/259 (50%), Gaps = 82/259 (31%)
 Frame = -3

Query: 531 YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
           Y+Y+SPPPP      KV     PPP VY    PP YSP PKV     PPP VY    PP 
Sbjct: 136 YVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPY 195

Query: 393 ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                        PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 196 YSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYK 255

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPP------ 175
             PPPY YSSPPPP            P  PY Y+SPPPP +  SPKP Y SPPP      
Sbjct: 256 SPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSF 315

Query: 174 PKKPYYYHSPPPPVYSPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY---- 43
           P  PYY  SP P   SPPPPY Y+SPPPP            P  PY Y SPPPP Y    
Sbjct: 316 PPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSP 375

Query: 42  -----SPPPPYHYTSPPPP 1
                SPPPPY Y+SPPPP
Sbjct: 376 KPTYKSPPPPYVYSSPPPP 394

 Score =  211 bits (537), Expect = 4e-53
 Identities = 121/242 (50%), Positives = 125/242 (51%), Gaps = 65/242 (26%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVSPPPKVYPPVY---SPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP 361
            Y+Y+SPPPP   P   P  K  PP Y   SPPP  Y P   P    PP  PPY YSSPPP
Sbjct: 613  YVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPP--PPYVYSSPPP 670

Query: 360  PVYSP--------PKKPYHYSSPPPPVYSP---------PPPYHYSSPPPP--------- 259
            P YSP        P  PY YSSPPPP YSP         PPPY YSSPPPP         
Sbjct: 671  PYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPT 730

Query: 258  ---PKKPYKYSSPPPPEHH-VSPKPYYHSPPPPKKPYYYHSPPPPVY---------SPPP 118
               P  PY YSSPPPP ++  SPK  Y SPPP   PY Y SPPPP Y         SPPP
Sbjct: 731  YKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPP---PYVYSSPPPPYYSPSPKVEYKSPPP 787

Query: 117  PYHYSSPPPP-------------PKKPYYYHSPPPPVY----------SPPPPYHYTSPP 7
            PY YSSPPPP             P  PY Y SPPPP Y          SPPPPY Y SPP
Sbjct: 788  PYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPP 847

Query: 6    PP 1
            PP
Sbjct: 848  PP 849

 Score =  209 bits (533), Expect = 1e-52
 Identities = 126/260 (48%), Positives = 131/260 (50%), Gaps = 83/260 (31%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS-------PPPKVY----PPVYSPPPKVYPPVSPPPKVY----PP 397
           Y+YSSPPPP  Y P         PPP VY    PP YSP PKV     PPP VY    PP
Sbjct: 35  YVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 94

Query: 396 V------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------ 295
                         PPY YSSPPPP YSP        P  PY Y+SPPPP YSP      
Sbjct: 95  YYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEY 154

Query: 294 ---PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPP---- 172
              PPPY YSSPPPP            P  PY Y+SPPPP +  SPKP Y SPPPP    
Sbjct: 155 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYS 214

Query: 171 --KKPYY-------YHSPPPP-VYSPPPPYHYSSPPPP----PKKPYYYHSPPPPVY--- 43
               PYY       Y SPPPP VYS PPP +YS  P P    P  PY Y SPPPP Y   
Sbjct: 215 SPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPS 274

Query: 42  ------SPPPPYHYTSPPPP 1
                 SPPPPY Y SPPPP
Sbjct: 275 PKPIYKSPPPPYVYNSPPPP 294

 Score =  208 bits (529), Expect = 3e-52
 Identities = 118/239 (49%), Positives = 125/239 (52%), Gaps = 62/239 (25%)
 Frame = -3

Query: 531 YLYSSPPP-------PKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPP 385
           Y+YSSPPP         VY    PPP VY    PP YSP PK      PPP VY    PP
Sbjct: 211 YIYSSPPPPYYSPSPKPVYKS-PPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPP 269

Query: 384 YHYSSPPPPVYSPPKKPYHYSSPPPPVY---------SPPPPYHYSSPPPP--------- 259
           Y YS  P P+Y  P  PY Y+SPPPP Y         SPPPPY YS PPPP         
Sbjct: 270 Y-YSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPV 328

Query: 258 ---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY---------SPPPP 115
              P  PY Y+SPPPP +  SPKP Y SPPP   PY Y SPPPP Y         SPPPP
Sbjct: 329 YKSPPPPYVYNSPPPPYYSPSPKPAYKSPPP---PYVYSSPPPPYYSPSPKPTYKSPPPP 385

Query: 114 YHYSSPPPP------------PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
           Y YSSPPPP            P  PY Y+SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 386 YVYSSPPPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPP 444

 Score =  198 bits (504), Expect = 3e-49
 Identities = 115/232 (49%), Positives = 121/232 (52%), Gaps = 55/232 (23%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVSP------PPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
            Y+YSSPPPP   P   P      PP VY    PP YSP PK      PPP VY    PPY
Sbjct: 663  YVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPY 722

Query: 381  H-------YSSPPPP-VY-SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---------- 259
            +       Y SPPPP VY SPP  PY+  SP     SPPPPY YSSPPPP          
Sbjct: 723  YSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEY 782

Query: 258  --PKKPYKYSSPPPPEHH-VSPKPYYHSPPPPKKPYYYHSPPPPVY----------SPPP 118
              P  PY YSSPPPP ++  SPK  Y SPPP   PY Y SPPPP Y          SPPP
Sbjct: 783  KSPPPPYVYSSPPPPPYYSPSPKVEYKSPPP---PYVYSSPPPPTYYSPSPKVEYKSPPP 839

Query: 117  PYHYSSPPPP-------------PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            PY Y+SPPPP             P  PY Y SPPPP YSP P   Y SPPPP
Sbjct: 840  PYVYNSPPPPAYYSPSPKIEYKSPPPPYVYSSPPPPSYSPSPKAEYKSPPPP 891

 Score =  197 bits (502), Expect = 4e-49
 Identities = 116/232 (50%), Positives = 122/232 (52%), Gaps = 51/232 (21%)
 Frame = -3

Query: 543 SANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           S   Y YSSPPPP +Y   SP PKV    Y  PP  Y   SPPP +    SP   Y SPP
Sbjct: 5   SYEPYTYSSPPPP-LYD--SPTPKVD---YKSPPPPYVYSSPPPPLSYSPSPKVDYKSPP 58

Query: 363 PPVYSPPKKPYHYSSPPPPVY---------SPPPPYHYSSPPPP------------PKKP 247
           PP        Y YSSPPPP Y         SPPPPY YSSPPPP            P  P
Sbjct: 59  PP--------YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 110

Query: 246 YKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY---------SPPPPYHYSSPP 94
           Y YSSPPPP +  SPKP Y SPPP   PY Y+SPPPP Y         SPPPPY YSSPP
Sbjct: 111 YVYSSPPPPYYSPSPKPTYKSPPP---PYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPP 167

Query: 93  PP------------PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
           PP            P  PY Y+SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 168 PPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPP 219

 Score =  196 bits (497), Expect = 2e-48
 Identities = 115/236 (48%), Positives = 125/236 (52%), Gaps = 59/236 (25%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVSP------PPKVY----PPVYSPPPKVY---PP------VSPPPK 409
            Y+YSSPPPP   P   P      PP VY    PP YSP PKV    PP        PPP 
Sbjct: 486  YVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPP 545

Query: 408  VYP---------PVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP- 259
             Y          P +P  ++S PPPP YSP  KP + SSPPP VYS PPP +YS  P P 
Sbjct: 546  CYSHSPKIEYKSPPTPYVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPV 605

Query: 258  ---PKKPYKYSSPPPPEHHVSPKPYYHSPPPP------KKPYY-------YHSPPPP-VY 130
               P  PY Y+SPPPP +  SPKP Y SPPPP        PYY       Y SPPPP VY
Sbjct: 606  YKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVY 665

Query: 129  SPPPPYHYSSPPPP----PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
            S PPP +YS  P P    P  PY Y SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 666  SSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPP 721

 Score =  194 bits (494), Expect = 4e-48
 Identities = 122/263 (46%), Positives = 128/263 (48%), Gaps = 86/263 (32%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVSPPPKVYPPVY---SPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP 361
            Y+Y+SPPPP   P   P  K  PP Y   SPPP  Y P   P    PP  PPY YSSPPP
Sbjct: 336  YVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPP--PPYVYSSPPP 393

Query: 360  PVYSP--------PKKPYHYSSPPPPVYSP---------PPPYHYSSPPPP-----PK-- 253
            P YSP        P  PY Y+SPPPP YSP         PPPY YSSPPPP     PK  
Sbjct: 394  PYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLT 453

Query: 252  -----KPYKYSSPPPPEHHVSPKPYYHSPPPP------KKPYY-------YHSPPPP-VY 130
                  PY YSSPPPP +  SPK  Y SPPPP        PYY       Y SPPPP VY
Sbjct: 454  YKSSPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVY 513

Query: 129  -SPPPPYH-------YSSPPPP----------------------PKKPYYYHSPPPPVY- 43
             SPPPPY+       Y SPP P                      P  PY YHSPPPP Y 
Sbjct: 514  NSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPPCYSHSPKIEYKSPPTPYVYHSPPPPPYY 573

Query: 42   ---------SPPPPYHYTSPPPP 1
                     S PPPY Y+SPPPP
Sbjct: 574  SPSPKPAYKSSPPPYVYSSPPPP 596

 Score =  137 bits (346), Expect = 5e-31
 Identities = 77/159 (48%), Positives = 81/159 (50%), Gaps = 34/159 (21%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS-------PPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPP 385
            Y+YSSPPPP  Y P         PPP VY    PP YSP PKV     PPP VY    PP
Sbjct: 738  YVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 797

Query: 384  YHYSSPPPPVYSPPKKPYHYSSPPPPVY----------SPPPPYHYSSPPPP-------- 259
             +YS  P   Y  P  PY YSSPPPP Y          SPPPPY Y+SPPPP        
Sbjct: 798  PYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPPAYYSPSPK 857

Query: 258  -----PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
                 P  PY YSSPPPP +  SPK  Y SPPP    YY
Sbjct: 858  IEYKSPPPPYVYSSPPPPSYSPSPKAEYKSPPP-PSLYY 895

[28][TOP]
>UniRef100_Q9FH26 Genomic DNA, chromosome 5, TAC clone: K20J1 n=1 Tax=Arabidopsis
            thaliana RepID=Q9FH26_ARATH
          Length = 609

 Score =  216 bits (549), Expect = 2e-54
 Identities = 129/262 (49%), Positives = 134/262 (51%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKV---YPPV-----SPPPKV 406
            Y+YSSPPPP   P         PPP VY    PP YSP PKV    PP+     SPPP  
Sbjct: 227  YVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPLPYVYSSPPPPY 286

Query: 405  YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVY--------- 301
            Y P          PPY YSSPPPP YSP        P  PY YSSPPPP Y         
Sbjct: 287  YSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 346

Query: 300  SPPPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            SPPPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 347  SPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP---PYV 403

Query: 156  YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
            Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y+SPPPP Y 
Sbjct: 404  YSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYS 463

Query: 42   --------SPPPPYHYTSPPPP 1
                    SPPPPY Y+SPPPP
Sbjct: 464  PSPKVDYKSPPPPYVYSSPPPP 485

 Score =  215 bits (547), Expect = 3e-54
 Identities = 128/262 (48%), Positives = 132/262 (50%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
            Y+YSSPPPP   P         PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 277  YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 336

Query: 405  YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
            Y P          PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 337  YSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 396

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 397  SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP---PYV 453

Query: 156  YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
            Y+SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 454  YNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 513

Query: 42   --------SPPPPYHYTSPPPP 1
                    SPPPPY Y+SPPPP
Sbjct: 514  PSPKVDYKSPPPPYVYSSPPPP 535

 Score =  214 bits (544), Expect = 6e-54
 Identities = 127/262 (48%), Positives = 132/262 (50%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
            Y+YSSPPPP   P         PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 327  YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPY 386

Query: 405  YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
            Y P          PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 387  YSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 446

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY Y+SPPPP            P  PY YSSPPPP +  SPK  Y SPPPP   Y 
Sbjct: 447  SPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP---YV 503

Query: 156  YHSPPPPVYSP---------PPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
            Y SPPPP YSP         PPPY YSSPPPP            P  PY Y+SPPPP Y 
Sbjct: 504  YSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYS 563

Query: 42   --------SPPPPYHYTSPPPP 1
                    SPPPPY Y+SPPPP
Sbjct: 564  PSPKVDYKSPPPPYVYSSPPPP 585

 Score =  211 bits (538), Expect = 3e-53
 Identities = 125/242 (51%), Positives = 128/242 (52%), Gaps = 65/242 (26%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPP-----VSPPPKVYPPVYSPPPKVYPPVSPPPKV-YPPVSPPYHYSS 370
           Y+YSSPPPP   P       SPPP   P VYS PP  Y   SP PKV Y    PPY YSS
Sbjct: 152 YVYSSPPPPYYSPTPKVDYKSPPP---PYVYSSPPPPY--YSPSPKVDYKSPPPPYVYSS 206

Query: 369 PPPPVYSP--------PKKPYHYSSPPPPVY---------SPPPPYHYSSPPPP------ 259
           PPPP YSP        P  PY YSSPPPP Y         SPPPPY YSSPPPP      
Sbjct: 207 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSP 266

Query: 258 ------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY---------SP 124
                 P  PY YSSPPPP +  SPK  Y SPPP   PY Y SPPPP Y         SP
Sbjct: 267 KVDYKSPPLPYVYSSPPPPYYSPSPKVDYKSPPP---PYVYSSPPPPYYSPSPKVDYKSP 323

Query: 123 PPPYHYSSPPPP------------PKKPYYYHSPPPPVY---------SPPPPYHYTSPP 7
           PPPY YSSPPPP            P  PY Y SPPPP Y         SPPPPY Y+SPP
Sbjct: 324 PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 383

Query: 6   PP 1
           PP
Sbjct: 384 PP 385

 Score =  207 bits (528), Expect = 4e-52
 Identities = 127/247 (51%), Positives = 130/247 (52%), Gaps = 72/247 (29%)
 Frame = -3

Query: 525 YSSPPPPKVY--PPV---SPPPKVY----PPVY---SPPPKVYPPVSPPPKV-YPPVSPP 385
           Y SPPPP VY  PP+   SP PKV     PP Y   SPPP  Y   SP PKV Y    PP
Sbjct: 120 YKSPPPPYVYSSPPLPYYSPSPKVDYKSPPPPYVYSSPPPPYY---SPTPKVDYKSPPPP 176

Query: 384 YHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP---------PPPYHYSSPPPP- 259
           Y YSSPPPP YSP        P  PY YSSPPPP YSP         PPPY YSSPPPP 
Sbjct: 177 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 236

Query: 258 -----------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY------ 130
                      P  PY YSSPPPP +  SPK  Y SPP    PY Y SPPPP Y      
Sbjct: 237 YSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPP---LPYVYSSPPPPYYSPSPKV 293

Query: 129 ---SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY---------SPPPPYH 22
              SPPPPY YSSPPPP            P  PY Y SPPPP Y         SPPPPY 
Sbjct: 294 DYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 353

Query: 21  YTSPPPP 1
           Y+SPPPP
Sbjct: 354 YSSPPPP 360

 Score =  206 bits (524), Expect = 1e-51
 Identities = 122/253 (48%), Positives = 126/253 (49%), Gaps = 76/253 (30%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
            Y+YSSPPPP   P         PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 352  YVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 411

Query: 405  YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
            Y P          PPY YSSPPPP YSP        P  PY Y+SPPPP YSP       
Sbjct: 412  YSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYK 471

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPPP   Y 
Sbjct: 472  SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP---YV 528

Query: 156  YHSPPPPVYSP---------PPPYHYSSPPPP------------PKKPYYYHSPPPPVYS 40
            Y SPPPP YSP         PPPY Y+SPPPP            P  PY Y SPPPP YS
Sbjct: 529  YSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 588

Query: 39   PPPPYHYTSPPPP 1
            P P   Y S PPP
Sbjct: 589  PSPKVTYKSLPPP 601

 Score =  204 bits (519), Expect = 5e-51
 Identities = 121/242 (50%), Positives = 126/242 (52%), Gaps = 65/242 (26%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPV-----SPPPKVYPPVYSPPPKVYPPVSPPPKV-YPPVSPPYHYSS 370
           Y+Y+SPPPP   P       SPPP   P VYS PP  Y   +P PKV Y    PPY YSS
Sbjct: 52  YIYNSPPPPYYSPSPKVNYKSPPP---PYVYSSPPPPY--YTPSPKVDYKSPPPPYEYSS 106

Query: 369 PPPPVYSP--------PKKPYHYSSPPPPVYSP---------PPPYHYSSPPPP------ 259
           PPPP YSP        P  PY YSSPP P YSP         PPPY YSSPPPP      
Sbjct: 107 PPPPYYSPSPKIDYKSPPPPYVYSSPPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTP 166

Query: 258 ------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSP--------- 124
                 P  PY YSSPPPP +  SPK  Y SPPPP   Y Y SPPPP YSP         
Sbjct: 167 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP---YVYSSPPPPYYSPSPKVDYKSP 223

Query: 123 PPPYHYSSPPPP------------PKKPYYYHSPPPPVYSPPP---------PYHYTSPP 7
           PPPY YSSPPPP            P  PY Y SPPPP YSP P         PY Y+SPP
Sbjct: 224 PPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPLPYVYSSPP 283

Query: 6   PP 1
           PP
Sbjct: 284 PP 285

 Score =  189 bits (480), Expect = 2e-46
 Identities = 114/236 (48%), Positives = 124/236 (52%), Gaps = 45/236 (19%)
 Frame = -3

Query: 573 LVSLTLPSLISAN--SYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYP 400
           LV + + S I+A   SY YSSP  P+      P  +   P Y+P  K Y   SPPP  Y 
Sbjct: 7   LVYVVVLSAIAATVTSYPYSSPQTPQYN---FPSHQHKSPKYTPHSKPYIYNSPPPPYYS 63

Query: 399 PVSPPYHYSSPPPP-VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP------------ 259
           P SP  +Y SPPPP VYS P  PY+  SP     SPPPPY YSSPPPP            
Sbjct: 64  P-SPKVNYKSPPPPYVYSSPPPPYYTPSPKVDYKSPPPPYEYSSPPPPYYSPSPKIDYKS 122

Query: 258 PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY---------SPPPPYHY 106
           P  PY YSSPP P +  SPK  Y SPPP   PY Y SPPPP Y         SPPPPY Y
Sbjct: 123 PPPPYVYSSPPLPYYSPSPKVDYKSPPP---PYVYSSPPPPYYSPTPKVDYKSPPPPYVY 179

Query: 105 SSPPPP------------PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
           SSPPPP            P  PY Y SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 180 SSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 235

[29][TOP]
>UniRef100_Q39949 Hydroxyproline-rich protein n=1 Tax=Helianthus annuus
           RepID=Q39949_HELAN
          Length = 263

 Score =  215 bits (547), Expect = 3e-54
 Identities = 130/262 (49%), Positives = 137/262 (52%), Gaps = 58/262 (22%)
 Frame = -3

Query: 612 SLMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVY 433
           S + +   TL V +VSLTLPS  +A +Y YSSPPPP       PPPK      SPPP   
Sbjct: 4   SSITTLLITLAVVIVSLTLPSPTTA-TYHYSSPPPPPPKKSPPPPPKQQYVYKSPPP--- 59

Query: 432 PPV--SPPPKVYPPVSPPYHYSSPPPPVYS-----------PPKKPYHY----------S 322
           PPV  SPPP VY    PP H  SPPPPV+            PPKKPY Y           
Sbjct: 60  PPVYKSPPPPVYKSPPPPVH-KSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHK 118

Query: 321 SPPPPVYSPPPPYHYSSPPPPPKK---PYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYY- 154
           SPPPPVY  PPP  Y SPPPP  K   P  Y SPPPP H   P P Y SPPPPKKPY Y 
Sbjct: 119 SPPPPVYKSPPPPVYESPPPPVYKSPPPPVYKSPPPPVHKSPPPPVYKSPPPPKKPYVYK 178

Query: 153 ---------HSPPPPVY-SPPPPYHYSSP--------------------PPPPKKPYYYH 64
                     SPPPPVY SP PP H S P                    PPPPKKPY Y 
Sbjct: 179 SPPPPPPVHKSPPPPVYKSPTPPVHKSPPHPVYKSPLPVHKSPPPVYKSPPPPKKPYVYK 238

Query: 63  SPPPPVYS-PPPPYHYTSPPPP 1
           SPPPPV   PPP Y Y+SPPPP
Sbjct: 239 SPPPPVKKHPPPHYIYSSPPPP 260

 Score =  126 bits (317), Expect = 1e-27
 Identities = 83/164 (50%), Positives = 86/164 (52%), Gaps = 49/164 (29%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPV--SPPPKVY----PPVY-SPPPKVYPPVSPPPKVYPPVSPPYHYS 373
           Y+Y SPPPP   PPV  SPPP VY    PPVY SPPP VY   SPPP VY    PP H  
Sbjct: 105 YVYKSPPPP---PPVHKSPPPPVYKSPPPPVYESPPPPVYK--SPPPPVYKSPPPPVH-K 158

Query: 372 SPPPPVYS---PPKKPYHYSSPPPP----------VY-SPPPPYHYSSP----------- 268
           SPPPPVY    PPKKPY Y SPPPP          VY SP PP H S P           
Sbjct: 159 SPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPTPPVHKSPPHPVYKSPLPVH 218

Query: 267 ---------PPPPKKPYKYSSPPPP--EH------HVSPKPYYH 187
                    PPPPKKPY Y SPPPP  +H      + SP P YH
Sbjct: 219 KSPPPVYKSPPPPKKPYVYKSPPPPVKKHPPPHYIYSSPPPPYH 262

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 65/141 (46%), Positives = 69/141 (48%), Gaps = 57/141 (40%)
 Frame = -3

Query: 528 LYSSPPPPKVY----PPV--SPPPKVY----PPVY-SPPPKVY----------------- 433
           +Y SPPPP VY    PPV  SPPP VY    PPV+ SPPP VY                 
Sbjct: 124 VYKSPPPP-VYESPPPPVYKSPPPPVYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPP 182

Query: 432 -PPV--SPPPKVYPPVSPPYHYSSP-------------PPPVYS---PPKKPYHYSSPPP 310
            PPV  SPPP VY   +PP H S P             PPPVY    PPKKPY Y SPPP
Sbjct: 183 PPPVHKSPPPPVYKSPTPPVHKSPPHPVYKSPLPVHKSPPPVYKSPPPPKKPYVYKSPPP 242

Query: 309 PVY----------SPPPPYHY 277
           PV           SPPPPYH+
Sbjct: 243 PVKKHPPPHYIYSSPPPPYHH 263

[30][TOP]
>UniRef100_Q39864 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39864_SOYBN
          Length = 199

 Score =  215 bits (547), Expect = 3e-54
 Identities = 116/198 (58%), Positives = 119/198 (60%), Gaps = 21/198 (10%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY----PPVSPPYHYSSPP 364
           Y Y SPPPP  YP   PPP  YP   SPPP VY   SPPP VY    PP  PPY Y SPP
Sbjct: 16  YKYKSPPPPYKYPSPPPPPYKYP---SPPPPVYKYKSPPPPVYKYKSPP--PPYKYPSPP 70

Query: 363 PPVY---SPPKKPYHYSSPPPPVY---SPPPPYHYSSPPPPPKK-------PYKYSSPPP 223
           PP Y   SPP   Y Y SPPPPVY   SPPPPY Y SPPPPP K        YKY SPPP
Sbjct: 71  PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 130

Query: 222 PEH-HVSPKPYYHSPPPPKKPYYYHSPPPPVY---SPPPPYHYSSPPPPPKKPYYYHSPP 55
           P + + SP P +  P PP  PY Y SPPPPVY   SPPPPY Y SPPPP   PY Y SPP
Sbjct: 131 PVYKYKSPPPPHKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPP---PYKYPSPP 187

Query: 54  PPVYSPPPPYHYTSPPPP 1
           PPVY       Y SPPPP
Sbjct: 188 PPVYK------YKSPPPP 199

 Score =  203 bits (517), Expect = 8e-51
 Identities = 112/195 (57%), Positives = 114/195 (58%), Gaps = 24/195 (12%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKP 334
           PP K Y   SPPP VY     PPP  YP  SPPP       PPY Y SPPPPVY      
Sbjct: 1   PPKKPYKYPSPPPPVYKYKSPPPPYKYP--SPPP-------PPYKYPSPPPPVYK----- 46

Query: 333 YHYSSPPPPVY---SPPPPYHYSSPPPPPKK-------PYKYSSPPPPEH-HVSPKPYYH 187
             Y SPPPPVY   SPPPPY Y SPPPPP K        YKY SPPPP + + SP P Y 
Sbjct: 47  --YKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYK 104

Query: 186 SPPPPKKPYYYHSPPPPVY---SPPPP-YHYSSPPP------PPKKPYYYHSPPPPVY-- 43
            P PP  PY Y SPPPPVY   SPPPP Y Y SPPP      PP  PY Y SPPPPVY  
Sbjct: 105 YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKYPSPPPPVYKY 164

Query: 42  -SPPPPYHYTSPPPP 1
            SPPPPY Y SPPPP
Sbjct: 165 KSPPPPYKYPSPPPP 179

[31][TOP]
>UniRef100_Q9STM8 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STM8_ARATH
          Length = 513

 Score =  214 bits (545), Expect = 5e-54
 Identities = 132/284 (46%), Positives = 135/284 (47%), Gaps = 106/284 (37%)
 Frame = -3

Query: 534 SYLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKVYPPVSPPPKVY----PP 397
           SY+YSSPPPP   P         PPP VY    PP YSP PKV     PPP VY    PP
Sbjct: 86  SYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPP 145

Query: 396 V------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------ 295
                         PPY YSSPPPP YSP        P  PY YSSPPPP YSP      
Sbjct: 146 YYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDY 205

Query: 294 ---PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPK--------PYYHS 184
              PPPY YSSPPPP            P  PY YSSPPPP +  SPK        PYY S
Sbjct: 206 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYYRS 265

Query: 183 PPPP-------------KKPYYYHSPPPPVYSP---------PPPYHYSSPPPP------ 88
           PPPP               PY Y SPPPP YSP         PPPY YSSPPPP      
Sbjct: 266 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTP 325

Query: 87  ------PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
                 P  PY Y SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 326 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 369

 Score =  209 bits (532), Expect = 1e-52
 Identities = 125/261 (47%), Positives = 130/261 (49%), Gaps = 84/261 (32%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
           Y+YSSPPPP   P         PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 162 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPY 221

Query: 405 YPPVS--------PPYHYSSPPPPVYSPPKK-------PYHYSSPPPPVYSP-------- 295
           Y P          PPY YSSPPPP YSP  K       P +Y SPPPP YSP        
Sbjct: 222 YSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKS 281

Query: 294 -PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYY 154
            PPPY YSSPPPP            P  PY YSSPPPP +  +PK  Y SPPPP   Y Y
Sbjct: 282 PPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPP---YVY 338

Query: 153 HSPPPPVYSP---------PPPYHYSSPPPP------------PKKPYYYHSPPPPVY-- 43
            SPPPP YSP         PPPY YSSPPPP            P  PY Y+SPPPP Y  
Sbjct: 339 SSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSP 398

Query: 42  -------SPPPPYHYTSPPPP 1
                  SPPPPY Y SPPPP
Sbjct: 399 SPKVDYKSPPPPYIYNSPPPP 419

 Score =  208 bits (529), Expect = 3e-52
 Identities = 121/238 (50%), Positives = 126/238 (52%), Gaps = 61/238 (25%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPV-----SPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYH 379
           Y+YSSPPPP   P       SPPP  Y    PP YSP PKV     PPP VY   SPP  
Sbjct: 237 YVYSSPPPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYS--SPPPP 294

Query: 378 YSSPPPPV-YSPPKKPYHYSSPPPPVY---------SPPPPYHYSSPPPP---------- 259
           Y SP P V Y  P  PY YSSPPPP Y         SPPPPY YSSPPPP          
Sbjct: 295 YYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDY 354

Query: 258 --PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY---------SPPPPY 112
             P  PY YSSPPPP +  SPK  Y SPPP   PY Y+SPPPP Y         SPPPPY
Sbjct: 355 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPP---PYVYNSPPPPYYSPSPKVDYKSPPPPY 411

Query: 111 HYSSPPPP------------PKKPYYYHSPPPPVY---------SPPPPYHYTSPPPP 1
            Y+SPPPP            P  PY Y SPPPP Y         SPPPPY Y+SPPPP
Sbjct: 412 IYNSPPPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPP 469

 Score =  199 bits (507), Expect = 1e-49
 Identities = 125/266 (46%), Positives = 135/266 (50%), Gaps = 63/266 (23%)
 Frame = -3

Query: 609 LMASTTFTLLVALVSLTLPSLISAN--SYLYSSPPPPKV--------YPPVSPPPKVYPP 460
           +  S T  L   +V + + S I+A   SY Y+SP  P           P  +P PK  P 
Sbjct: 4   IRTSRTMGLGQCMVYVVVLSAIAATVTSYPYTSPQTPHYNSPSHEHKIPKYTPHPK--PS 61

Query: 459 VYS--PPPKVYPPVSPPPKV-YPPVSPPYHYSSPPPPVYSPPKK--------PYHYSSPP 313
           +YS  PPP  Y   SP PKV Y    P Y YSSPPPP YSP  K        PY YSSPP
Sbjct: 62  IYSSSPPPSYY---SPSPKVDYKSPPPSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPP 118

Query: 312 PPVYSP---------PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKP 196
           PP YSP         PPPY YSSPPPP            P  PY YSSPPPP +  SPK 
Sbjct: 119 PPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKV 178

Query: 195 YYHSPPPPKKPYYYHSPPPPVY---------SPPPPYHYSSPPPP------------PKK 79
            Y SPPP   PY Y SPPPP Y         SPPPPY YSSPPPP            P  
Sbjct: 179 DYKSPPP---PYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP 235

Query: 78  PYYYHSPPPPVYSPPPPYHYTSPPPP 1
           PY Y SPPPP YSP P  +Y SPPPP
Sbjct: 236 PYVYSSPPPPYYSPSPKVNYKSPPPP 261

 Score =  197 bits (502), Expect = 4e-49
 Identities = 115/237 (48%), Positives = 121/237 (51%), Gaps = 62/237 (26%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPV----YSPPPKVYPPVSPPPKVYPPVS--------PPY 382
           Y SPPPP VY   SPPP  Y P     Y  PP  Y   SPPP  Y P          PPY
Sbjct: 279 YKSPPPPYVYS--SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPY 336

Query: 381 HYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP---------PPPYHYSSPPPP-- 259
            YSSPPPP YSP        P  PY YSSPPPP YSP         PPPY Y+SPPPP  
Sbjct: 337 VYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYY 396

Query: 258 ----------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYH 109
                     P  PY Y+SPPPP +  SPK  Y +PPPP   Y Y SPPPP YSP P  +
Sbjct: 397 SPSPKVDYKSPPPPYIYNSPPPPYYSPSPKVNYKTPPPP---YVYSSPPPPYYSPSPKVN 453

Query: 108 YSSPPPP-----PKKPYY-------YHSPPPPVY--SPPPPYH-------YTSPPPP 1
           Y SPPPP     P  PYY       Y SPPPP    SPP PY+       Y SPPPP
Sbjct: 454 YKSPPPPYVYSSPPPPYYSPSPNVDYKSPPPPYVYSSPPTPYYSPSSKVTYKSPPPP 510

 Score =  156 bits (395), Expect = 1e-36
 Identities = 96/206 (46%), Positives = 100/206 (48%), Gaps = 64/206 (31%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
           Y+YSSPPPP   P         PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 311 YVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 370

Query: 405 YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
           Y P          PPY Y+SPPPP YSP        P  PY Y+SPPPP YSP       
Sbjct: 371 YSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYIYNSPPPPYYSPSPKVNYK 430

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
             PPPY YSSPPPP            P  PY YSSPPPP +  SP   Y SPPPP   Y 
Sbjct: 431 TPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPNVDYKSPPPP---YV 487

Query: 156 YHSPPPPVYSP---------PPPYHY 106
           Y SPP P YSP         PPPY Y
Sbjct: 488 YSSPPTPYYSPSSKVTYKSPPPPYVY 513

[32][TOP]
>UniRef100_C3VPW8 Extensin n=1 Tax=Lithospermum erythrorhizon RepID=C3VPW8_LITER
          Length = 247

 Score =  214 bits (544), Expect = 6e-54
 Identities = 125/222 (56%), Positives = 139/222 (62%), Gaps = 18/222 (8%)
 Frame = -3

Query: 612 SLMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPV-------SPPPKVY---- 466
           S MAS   TLLV +++ T+PS  SAN Y YSSPPPPK Y P        SPPP VY    
Sbjct: 9   SKMASLVTTLLVLVIAFTIPSETSAN-YKYSSPPPPKKYSPPPHHYHHKSPPPPVYKSPP 67

Query: 465 PPVY-SPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPP 289
           PP++ SPPP VY   SPPP ++    PP  YS PPPPVY  P  P H S PPP  YSPPP
Sbjct: 68  PPMHKSPPPPVYK--SPPPPMHKSPPPPKKYS-PPPPVYKSPPPPMHKSPPPPKKYSPPP 124

Query: 288 PYHYSSPPPP----PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY-SP 124
           P  Y SPPPP    P  P KY SPPPP +   P P + SPPPPKK    +SPPPPVY SP
Sbjct: 125 PV-YKSPPPPMHKSPPPPKKY-SPPPPVYKSPPPPMHKSPPPPKK----YSPPPPVYKSP 178

Query: 123 PPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPY-HYTSPPPP 1
           PPP H S  PPPPKK    +SPPPPV+ PPP + H  SPPPP
Sbjct: 179 PPPMHKS--PPPPKK----YSPPPPVHKPPPHWSHKYSPPPP 214

 Score =  154 bits (388), Expect = 7e-36
 Identities = 86/170 (50%), Positives = 101/170 (59%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
           ++ SPPPPK Y   SPPP VY    SPPP ++    PPPK Y P  PP  Y SPPPP++ 
Sbjct: 86  MHKSPPPPKKY---SPPPPVYK---SPPPPMHKS-PPPPKKYSP--PPPVYKSPPPPMHK 136

Query: 348 PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
            P  P  YS PPP   SPPPP H S  PPPPKK     SPPPP +   P P + SPPPPK
Sbjct: 137 SPPPPKKYSPPPPVYKSPPPPMHKS--PPPPKK----YSPPPPVYKSPPPPMHKSPPPPK 190

Query: 168 KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHY 19
           K    +SPPPPV+ PPP  H+S          + +SPPPPV+   PP+HY
Sbjct: 191 K----YSPPPPVHKPPP--HWS----------HKYSPPPPVHK-SPPHHY 223

[33][TOP]
>UniRef100_Q9FG06 Genomic DNA, chromosome 5, BAC clone:F15M7 n=1 Tax=Arabidopsis
           thaliana RepID=Q9FG06_ARATH
          Length = 689

 Score =  213 bits (542), Expect = 1e-53
 Identities = 123/243 (50%), Positives = 130/243 (53%), Gaps = 66/243 (27%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPV------SPPPKVYPPVYSPPPKVYPPVSPPPKV-YPPVSPPYHYS 373
           Y+Y SPPPP  Y P       SPPP   P VY+ PP  Y   SP PKV Y    PPY YS
Sbjct: 81  YVYISPPPPSYYSPSPKVNYKSPPP---PNVYNSPPPPY--YSPSPKVDYKSPPPPYVYS 135

Query: 372 SPPPPVYSP--------PKKPYHYSSPPPPVY---------SPPPPYHYSSPPPP----- 259
           SPPPP YSP        P  PY YSSPPPP Y         SPPPPY Y+SPPPP     
Sbjct: 136 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPS 195

Query: 258 -------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY---------S 127
                  P  PY YSSPPPP +  SPK  Y SPPP   PY Y+SPPPP Y         S
Sbjct: 196 PKIEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP---PYVYNSPPPPYYSPSPKVDYKS 252

Query: 126 PPPPYHYSSPPPP------------PKKPYYYHSPPPPVY---------SPPPPYHYTSP 10
           PPPPY YSSPPPP            P  PY Y+SPPPP Y         SPPPPY Y+SP
Sbjct: 253 PPPPYVYSSPPPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSP 312

Query: 9   PPP 1
           PPP
Sbjct: 313 PPP 315

 Score =  209 bits (531), Expect = 2e-52
 Identities = 125/262 (47%), Positives = 130/262 (49%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
            Y+Y+SPPPP   P         PPP VY    PP +SP PKV     PPP VY    PP 
Sbjct: 232  YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYFSPSPKVEYKSPPPPYVYNSPPPPY 291

Query: 393  ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                         PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 292  YSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYK 351

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P  PY YSSPPP  +  SPK  Y SPPP   PY 
Sbjct: 352  SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSPPP---PYV 408

Query: 156  YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
            Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y SPPPP Y 
Sbjct: 409  YSSPPPPYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 468

Query: 42   --------SPPPPYHYTSPPPP 1
                    SPPPPY Y+SPPPP
Sbjct: 469  PSPKVEYKSPPPPYVYSSPPPP 490

 Score =  208 bits (530), Expect = 2e-52
 Identities = 124/262 (47%), Positives = 128/262 (48%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
            Y+YSSPPPP      KVY    PPP VY    PP YSP PKV     PPP VY    PPY
Sbjct: 307  YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 366

Query: 381  H-------YSSPPPP-----------------VYSPPKKPYHYSSPPPPVY--------- 301
            +       Y SPPPP                  Y  P  PY YSSPPPP Y         
Sbjct: 367  YSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYK 426

Query: 300  SPPPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            SPPPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPP   PY 
Sbjct: 427  SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPP---PYV 483

Query: 156  YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
            Y SPPPP Y         SPPPPY YSSPPPP            P  PY Y S PPP Y 
Sbjct: 484  YSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSPPPPYVYSSHPPPYYS 543

Query: 42   --------SPPPPYHYTSPPPP 1
                    SPPPPY Y+SPPPP
Sbjct: 544  PSPKVNYKSPPPPYVYSSPPPP 565

 Score =  203 bits (517), Expect = 8e-51
 Identities = 118/232 (50%), Positives = 121/232 (52%), Gaps = 55/232 (23%)
 Frame = -3

Query: 531  YLYSSPPP------PKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
            Y+YSSPPP      PKV     PPP VY    PP YSP PKV     PPP VY    PP 
Sbjct: 382  YVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPPYVYSSPPPPY 441

Query: 393  ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                         PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 442  YSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYK 501

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP            P  PY YSS PPP +  SPK  Y SPPP   PY 
Sbjct: 502  SPPPPYVYSSPPPPYHSPSPKVNYKSPPPPYVYSSHPPPYYSPSPKVNYKSPPP---PYV 558

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            Y SPPPP YSP P  +Y SPPP    PY Y SPPPP YSP P   Y S PPP
Sbjct: 559  YSSPPPPYYSPSPKVNYKSPPP----PYVYSSPPPPYYSPSPMVDYKSTPPP 606

 Score =  201 bits (510), Expect = 5e-50
 Identities = 122/252 (48%), Positives = 127/252 (50%), Gaps = 75/252 (29%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
           Y+YSSPPPP   P         PPP VY    PP YSP PKV     PPP VY    PP 
Sbjct: 132 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPY 191

Query: 393 ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                        PPY YSSPPPP YSP        P  PY Y+SPPPP YSP       
Sbjct: 192 YSPSPKIEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYK 251

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPP----- 172
             PPPY YSSPPPP            P  PY Y+SPPPP +  SPK  Y SPPPP     
Sbjct: 252 SPPPPYVYSSPPPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSS 311

Query: 171 -KKPYY-------YHSPPPP-VYSPPPPYHYSSPP------PPPKKPYYYHSPPPPVYSP 37
              PYY       Y SPPPP VYS PPP +YS  P      PPP  PY Y SPPPP YSP
Sbjct: 312 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP--PYVYSSPPPPYYSP 369

Query: 36  PPPYHYTSPPPP 1
            P   Y SPPPP
Sbjct: 370 SPKVDYKSPPPP 381

 Score =  199 bits (506), Expect = 2e-49
 Identities = 116/249 (46%), Positives = 133/249 (53%), Gaps = 46/249 (18%)
 Frame = -3

Query: 609 LMASTTFTLLVALVSLTLPSLISAN--SYLYSSPPPPKVYPPVSPPPKVYP-PVYSPPPK 439
           + +S T  L   +V + + S I+A   SY YSSP      P  + P   +  P Y+P PK
Sbjct: 20  MRSSRTMGLGHCMVYVVVLSAIAATVTSYPYSSPYSSPQTPHYNSPSHEHKSPKYAPHPK 79

Query: 438 VYPPVSPPPKVYPPVSPPYHYSSPPPP-VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPP 262
            Y  +SPPP  Y   SP  +Y SPPPP VY+ P  PY+  SP     SPPPPY YSSPPP
Sbjct: 80  PYVYISPPPPSYYSPSPKVNYKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPP 139

Query: 261 P------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY---- 130
           P            P  PY YSSPPPP +  SPK  Y SPPP   PY Y+SPPPP Y    
Sbjct: 140 PYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPP---PYVYNSPPPPYYSPSP 196

Query: 129 -----SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY---------SPPPP 28
                SPPPPY YSSPPPP            P  PY Y+SPPPP Y         SPPPP
Sbjct: 197 KIEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 256

Query: 27  YHYTSPPPP 1
           Y Y+SPPPP
Sbjct: 257 YVYSSPPPP 265

 Score =  195 bits (495), Expect = 3e-48
 Identities = 114/232 (49%), Positives = 117/232 (50%), Gaps = 55/232 (23%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
            Y+YSSPPPP      KV     PPP VY    PP YSP PKV     PPP VY    PPY
Sbjct: 457  YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 516

Query: 381  H----------------YSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
            H                YSS PPP YSP        P  PY YSSPPPP YSP       
Sbjct: 517  HSPSPKVNYKSPPPPYVYSSHPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVNYK 576

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
              PPPY YSSPPPP               PY YS PP P +  SPK  Y SPP    PY 
Sbjct: 577  SPPPPYVYSSPPPPYYSPSPMVDYKSTPPPYVYSFPPLPYYSPSPKVDYKSPP---LPYV 633

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            Y SPPP  YSP P  HY SPPPP    Y Y+SPPPP YSP P   Y SPPPP
Sbjct: 634  YSSPPPLYYSPSPKVHYKSPPPP----YVYNSPPPPYYSPSPKVTYKSPPPP 681

 Score =  161 bits (407), Expect = 5e-38
 Identities = 103/213 (48%), Positives = 107/213 (50%), Gaps = 59/213 (27%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
            Y+YSSPPPP      KV     PPP VY    PP +SP PKV     PPP VY    PP 
Sbjct: 482  YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSPPPPYVYSSHPPPY 541

Query: 393  ------------SPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
                         PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 542  YSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPMVDYK 601

Query: 294  --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYH--SPPPPKKP 163
              PPPY YS PP P            P  PY YSSPPP   + SP P  H  SPPP   P
Sbjct: 602  STPPPYVYSFPPLPYYSPSPKVDYKSPPLPYVYSSPPPL--YYSPSPKVHYKSPPP---P 656

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPP--PKKPYY 70
            Y Y+SPPPP YSP P   Y SPPPP   K PYY
Sbjct: 657  YVYNSPPPPYYSPSPKVTYKSPPPPYVYKAPYY 689

[34][TOP]
>UniRef100_Q9STM7 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9STM7_ARATH
          Length = 707

 Score =  211 bits (538), Expect = 3e-53
 Identities = 126/247 (51%), Positives = 129/247 (52%), Gaps = 72/247 (29%)
 Frame = -3

Query: 525  YSSPPPPKVY-----PPVSPPPKVY----PPVY---SPPPKVYPPVSPPPKV-YPPVSPP 385
            Y SPPPP +Y     P  SP PKV     PP Y   SPPP  Y   SP PKV Y P  PP
Sbjct: 423  YKSPPPPYIYSSTPLPYYSPSPKVDYKSPPPPYVYSSPPPPYY---SPSPKVDYKPPPPP 479

Query: 384  YHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP---------PPPYHYSSPPPP- 259
            Y YSSPPPP YSP        P  PY YS PPPP YSP         PPPY YSSPPPP 
Sbjct: 480  YVYSSPPPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 539

Query: 258  -----------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY------ 130
                       P  PY YSSPPPP +  SPK  Y SPPP   PY Y SPPPP Y      
Sbjct: 540  YSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPP---PYIYSSPPPPYYAPSPKV 596

Query: 129  ---SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY---------SPPPPYH 22
               SPPPPY YSSPPPP            P  PY Y SPPPP Y         SPPPPY 
Sbjct: 597  DYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYV 656

Query: 21   YTSPPPP 1
            Y+SPPPP
Sbjct: 657  YSSPPPP 663

 Score =  208 bits (530), Expect = 2e-52
 Identities = 123/253 (48%), Positives = 125/253 (49%), Gaps = 76/253 (30%)
 Frame = -3

Query: 531 YLYSSPPPP------KVYPPVSPPPKVY----PPVYSP--------PPKVYPPVSPPPKV 406
           Y+YSSPPPP      KV     PPP VY    PP YSP        PP  Y   SPPP  
Sbjct: 130 YVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPY 189

Query: 405 YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
           Y P          PPY YSSPPPP YSP        P  PY YSSPPPP YSP       
Sbjct: 190 YSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 249

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
             PPPY YSSPPPP            P  PY Y SPPPP +  SPK  Y SPPP   PY 
Sbjct: 250 SPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPP---PYV 306

Query: 156 YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVYS 40
           Y SPPPP Y         SPPPPY Y SPPPP            P  PY Y SPPPP YS
Sbjct: 307 YSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 366

Query: 39  PPPPYHYTSPPPP 1
           P P   Y SPPPP
Sbjct: 367 PSPKVDYKSPPPP 379

 Score =  201 bits (512), Expect = 3e-50
 Identities = 122/262 (46%), Positives = 125/262 (47%), Gaps = 85/262 (32%)
 Frame = -3

Query: 531  YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
            Y+YSSPPPP      KV     PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 305  YVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 364

Query: 405  YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSPPPPYHYS 274
            Y P          PPY YSS PPP YSP        P  PY YSSPPPP YSP P   Y 
Sbjct: 365  YSPSPKVDYKSPPPPYVYSSTPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 424

Query: 273  SPPPP---------------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            SPPPP                     P  PY YSSPPPP +  SPK  Y  PPP   PY 
Sbjct: 425  SPPPPYIYSSTPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKPPPP---PYV 481

Query: 156  YHSPPPPVY---------SPPPPYHYSSPPPP------------PKKPYYYHSPPPPVY- 43
            Y SPPPP Y         SPPPPY YS PPPP            P  PY Y SPPPP Y 
Sbjct: 482  YSSPPPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 541

Query: 42   --------SPPPPYHYTSPPPP 1
                    SPPPPY Y+SPPPP
Sbjct: 542  PSPKVNYKSPPPPYVYSSPPPP 563

 Score =  199 bits (507), Expect = 1e-49
 Identities = 125/266 (46%), Positives = 135/266 (50%), Gaps = 63/266 (23%)
 Frame = -3

Query: 609 LMASTTFTLLVALVSLTLPSLISAN--SYLYSSPPPPKV--------YPPVSPPPKVYPP 460
           +  S T  L   +V + + S I+A   SY Y+SP  P           P  +P PK  P 
Sbjct: 22  IRTSRTMGLGQCMVYVVVLSAIAATVTSYPYTSPQTPHYNSPSHEHKIPKYTPHPK--PS 79

Query: 459 VYS--PPPKVYPPVSPPPKV-YPPVSPPYHYSSPPPPVYSPPKK--------PYHYSSPP 313
           +YS  PPP  Y   SP PKV Y    P Y YSSPPPP YSP  K        PY YSSPP
Sbjct: 80  IYSSSPPPSYY---SPSPKVDYKSPPPSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPP 136

Query: 312 PPVYSP---------PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKP 196
           PP YSP         PPPY YSSPPPP            P  PY YSSPPPP +  SPK 
Sbjct: 137 PPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKV 196

Query: 195 YYHSPPPPKKPYYYHSPPPPVY---------SPPPPYHYSSPPPP------------PKK 79
            Y SPPP   PY Y SPPPP Y         SPPPPY YSSPPPP            P  
Sbjct: 197 DYKSPPP---PYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP 253

Query: 78  PYYYHSPPPPVYSPPPPYHYTSPPPP 1
           PY Y SPPPP YSP P  +Y SPPPP
Sbjct: 254 PYVYSSPPPPYYSPSPKVNYKSPPPP 279

 Score =  196 bits (499), Expect = 1e-48
 Identities = 121/252 (48%), Positives = 124/252 (49%), Gaps = 75/252 (29%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
           Y+YSSPPPP   P         PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 180 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPY 239

Query: 405 YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP------- 295
           Y P          PPY YSSPPPP YSP        P  PY Y SPPPP YSP       
Sbjct: 240 YSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYK 299

Query: 294 --PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPP----- 172
             PPPY YSSPPPP            P  PY Y SPPPP +  SPK  Y SPPPP     
Sbjct: 300 SPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSS 359

Query: 171 -KKPYY-------YHSPPPP-VYSPPPPYHYSSPP------PPPKKPYYYHSPPPPVYSP 37
              PYY       Y SPPPP VYS  PP +YS  P      PPP  PY Y SPPPP YSP
Sbjct: 360 PPPPYYSPSPKVDYKSPPPPYVYSSTPPPYYSPSPKVDYKSPPP--PYVYSSPPPPYYSP 417

Query: 36  PPPYHYTSPPPP 1
            P   Y SPPPP
Sbjct: 418 SPKVDYKSPPPP 429

 Score =  196 bits (497), Expect = 2e-48
 Identities = 112/212 (52%), Positives = 115/212 (54%), Gaps = 35/212 (16%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPP-----VSPPPKVYPPVYSPPPKVYPPVSPPPKV-YPPVSPPYHYSS 370
            Y+YS PPPP   P       SPPP   P VYS PP  Y   SP PKV Y    PPY YSS
Sbjct: 505  YVYSFPPPPYYSPSPKVDYKSPPP---PYVYSSPPPPY--YSPSPKVNYKSPPPPYVYSS 559

Query: 369  PPPPVYSP--------PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEH 214
            PPPP YSP        P  PY YSSPPPP Y+P P   Y SPPP    PY YSSPPPP +
Sbjct: 560  PPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSPPP----PYVYSSPPPPYY 615

Query: 213  HVSPKPYYHSPPPPKKPYYYHSPPPPVY---------SPPPPYHYSSPPPPPKKP----- 76
              SPK  Y SPPP   PY Y SPPPP Y         SPPPPY YSSPPPP   P     
Sbjct: 616  SPSPKVDYKSPPP---PYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVD 672

Query: 75   -------YYYHSPPPPVYSPPPPYHYTSPPPP 1
                   Y Y SPP P YSP P   Y SPPPP
Sbjct: 673  YKSSPPQYVYSSPPTPYYSPSPKVTYKSPPPP 704

 Score =  154 bits (390), Expect = 4e-36
 Identities = 100/231 (43%), Positives = 102/231 (44%), Gaps = 89/231 (38%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKV--------YPPVSPPPKV 406
            Y+YSSPPPP   P         PPP VY    PP YSP PKV        Y   SPPP  
Sbjct: 480  YVYSSPPPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 539

Query: 405  YPPVS--------PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVY--------- 301
            Y P          PPY YSSPPPP YSP        P  PY YSSPPPP Y         
Sbjct: 540  YSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYK 599

Query: 300  SPPPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            SPPPPY YSSPPPP            P  PY YSSPPPP +  SPK  Y SPPPP   Y 
Sbjct: 600  SPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPP---YV 656

Query: 156  YHSPPPPVYSP----------------------------------PPPYHY 106
            Y SPPPP YSP                                  PPPY Y
Sbjct: 657  YSSPPPPYYSPSPKVDYKSSPPQYVYSSPPTPYYSPSPKVTYKSPPPPYVY 707

[35][TOP]
>UniRef100_Q8H9E0 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Solanum
           tuberosum RepID=Q8H9E0_SOLTU
          Length = 217

 Score =  207 bits (528), Expect = 4e-52
 Identities = 121/211 (57%), Positives = 125/211 (59%), Gaps = 34/211 (16%)
 Frame = -3

Query: 531 YLYSSPPPPK-VYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVY-----PPVSPPY 382
           Y Y SPPPP  VY   SPPP VY    PP   PPP VY   SPPP VY     PP  P Y
Sbjct: 12  YKYKSPPPPPPVYKYKSPPPPVYKYKSPP---PPPPVYKYKSPPPPVYKYKSPPPPPPVY 68

Query: 381 HYSSPPPPVY---SPPKKPYHYSSPPPPVY---SPPPP-YHYSSPPPPPKKPYKYSSPPP 223
            Y SPPPPVY   SPP   Y Y SPPPPVY   SPPPP Y Y SPPPP    YKY SPPP
Sbjct: 69  KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPV---YKYKSPPP 125

Query: 222 PEH-HVSPKP---YYHSPPPPKKPYYYHSPPPPVY---SPPPP---YHYSSPPPP----- 88
           P + + SP P    Y SPPPP   Y Y SPPPPVY   SPPPP   Y Y SPPPP     
Sbjct: 126 PVYKYKSPPPPVYKYKSPPPPV--YKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYK 183

Query: 87  --PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             P   Y Y SPPPPV+  P PY+YTSPPPP
Sbjct: 184 SPPPPVYKYKSPPPPVHKSPAPYYYTSPPPP 214

 Score =  198 bits (503), Expect = 3e-49
 Identities = 124/210 (59%), Positives = 126/210 (60%), Gaps = 33/210 (15%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPPVY---SPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP 361
           Y Y SPPPP VY   SPPP   PPVY   SPPP VY   SPPP   PP  P Y Y SPPP
Sbjct: 2   YKYKSPPPP-VYKYKSPPPP--PPVYKYKSPPPPVYKYKSPPP---PP--PVYKYKSPPP 53

Query: 360 PVY---SPPKKP--YHYSSPPPPVY---SPPPP-YHYSSPPPPPKKPYKYSSPPPPEH-H 211
           PVY   SPP  P  Y Y SPPPPVY   SPPPP Y Y SPPPP    YKY SPPPP + +
Sbjct: 54  PVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPV---YKYKSPPPPVYKY 110

Query: 210 VSPKP---YYHSPPPPKKPYYYHSPPPPVY---SPPPP-YHYSSP---------PPPPKK 79
            SP P    Y SPPPP   Y Y SPPPPVY   SPPPP Y Y SP         PPPP  
Sbjct: 111 KSPPPPVYKYKSPPPPV--YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPP 168

Query: 78  PYYYHSPPPPVY---SPPPP-YHYTSPPPP 1
            Y Y SPPPPVY   SPPPP Y Y SPPPP
Sbjct: 169 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 198

 Score =  172 bits (437), Expect = 2e-41
 Identities = 104/174 (59%), Positives = 106/174 (60%), Gaps = 28/174 (16%)
 Frame = -3

Query: 438 VYPPVSPPPKVY-----PPVSPPYHYSSPPPPVY---SPPKKP--YHYSSPPPPVY---S 298
           VY   SPPP VY     PP  P Y Y SPPPPVY   SPP  P  Y Y SPPPPVY   S
Sbjct: 1   VYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKS 60

Query: 297 PPPP---YHYSSPPPPPKKPYKYSSPPPPEH-HVSPKP---YYHSPPPPKKPYYYHSPPP 139
           PPPP   Y Y SPPPP    YKY SPPPP + + SP P    Y SPPPP   Y Y SPPP
Sbjct: 61  PPPPPPVYKYKSPPPP---VYKYKSPPPPVYKYKSPPPPVYKYKSPPPP--VYKYKSPPP 115

Query: 138 PVY---SPPPP-YHYSSPPPPPKKPYYYHSPPPPVY---SPPPP-YHYTSPPPP 1
           PVY   SPPPP Y Y SPPPP    Y Y SPPPPVY   SPPPP Y Y SPPPP
Sbjct: 116 PVYKYKSPPPPVYKYKSPPPP---VYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 166

 Score =  149 bits (376), Expect = 2e-34
 Identities = 86/152 (56%), Positives = 88/152 (57%), Gaps = 28/152 (18%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY------PPVY---SPPPKVYPPVSPPPKVYPPVSPP-- 385
           Y Y SPPPP VY   SPPP VY      PPVY   SPPP VY   SPPP VY   SPP  
Sbjct: 68  YKYKSPPPP-VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 126

Query: 384 -YHYSSPPPPVY---SPPKKPYHYSSPPPPVY---SPPPP---YHYSSPPPP-------P 256
            Y Y SPPPPVY   SPP   Y Y SPPPPVY   SPPPP   Y Y SPPPP       P
Sbjct: 127 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPP 186

Query: 255 KKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
              YKY SPPPP H  SP PYY++ PPP   Y
Sbjct: 187 PPVYKYKSPPPPVHK-SPAPYYYTSPPPPSHY 217

[36][TOP]
>UniRef100_Q39599 Extensin n=1 Tax=Catharanthus roseus RepID=Q39599_CATRO
          Length = 225

 Score =  207 bits (526), Expect = 7e-52
 Identities = 127/234 (54%), Positives = 134/234 (57%), Gaps = 44/234 (18%)
 Frame = -3

Query: 570 VSLTLPSLISANSYLYSSPPPPKVYPPV---SPPPKVYPPVYS---PPPKVYPPVSPPPK 409
           ++L+L S  +AN+Y YSSPPPP   PP    SPPP   PPV+    PPP  Y    PPP 
Sbjct: 1   MALSLASETTANNYHYSSPPPPHYSPPYHYKSPPPP--PPVHKYPPPPPPFYKSPPPPPP 58

Query: 408 VYP-PVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSS 232
           VY  P  PPY Y SPPPP    P KPY Y SPPPP     PP  Y SPPPPP KPYKY S
Sbjct: 59  VYKSPPPPPYKYKSPPPP----PHKPYKYKSPPPP-----PPV-YKSPPPPPHKPYKYKS 108

Query: 231 PPPPEHHVSPKPY-YHSPPPP---KKPYYYHSP-------------PPPVY----SPPP- 118
           PPPP      KPY Y SPPPP   K PY Y SP             PPPVY    SPPP 
Sbjct: 109 PPPPP-PPPHKPYKYKSPPPPPVYKPPYVYKSPPPPPSVHKYPPPSPPPVYKSPPSPPPK 167

Query: 117 -PYHYSSPPP----------PPKKPYYYHSPPP-PVY-SPPPPYH--YTSPPPP 1
            PY Y SPPP          PPKKPY Y  PPP PVY SPPPP+H  YTSPPPP
Sbjct: 168 KPYKYKSPPPPPIHKSPLPSPPKKPYKYKYPPPTPVYKSPPPPHHYLYTSPPPP 221

 Score =  130 bits (327), Expect = 9e-29
 Identities = 78/143 (54%), Positives = 79/143 (55%), Gaps = 8/143 (5%)
 Frame = -3

Query: 531 YLYSSPPPP-----KVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKV--YPPVSPPYHYS 373
           Y Y SPPPP     K Y   SPPP   PPVY PP  VY    PPP V  YPP SPP  Y 
Sbjct: 104 YKYKSPPPPPPPPHKPYKYKSPPP---PPVYKPP-YVYKSPPPPPSVHKYPPPSPPPVYK 159

Query: 372 SPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPP-PEHHVSPKP 196
           SPP P   PPKKPY Y SPPPP      P H S  P PPKKPYKY  PPP P        
Sbjct: 160 SPPSP---PPKKPYKYKSPPPP------PIHKSPLPSPPKKPYKYKYPPPTPV------- 203

Query: 195 YYHSPPPPKKPYYYHSPPPPVYS 127
            Y SPPPP   Y Y SPPPP Y+
Sbjct: 204 -YKSPPPPHH-YLYTSPPPPPYN 224

[37][TOP]
>UniRef100_Q9FSG1 Putative extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG1_NICSY
          Length = 311

 Score =  206 bits (525), Expect = 9e-52
 Identities = 124/223 (55%), Positives = 128/223 (57%), Gaps = 47/223 (21%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVY--------PPVY-SPPPKVYPPVSPPPKVYP---PVSPP 385
           +Y SPPPP VY   SPPP VY        PPVY SPPP VY   SPPP VY    P  PP
Sbjct: 91  VYKSPPPP-VYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPP 149

Query: 384 YHYSSPPPPVY---SPPKKPYHYSSPPPPVY---SPPPP-YHYSSPPPPP---------- 256
             Y SPPPPVY   SPP  P  + SPPPP+Y   SPPPP Y Y SPPPPP          
Sbjct: 150 PVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPPPPPPMYKSPPPPV 209

Query: 255 ---KKP------YKYSSPPPPEHHVS----PKPYYHSPPPPKKPYYYHSPPPPVY-SPPP 118
              K P      YKY SPPPP +       P P Y SPPPP   Y    PPPPVY SPPP
Sbjct: 210 YKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPP 269

Query: 117 P-YHYSSPPPPPKKPYYYHSPPPPVY-SPPPPYH--YTSPPPP 1
           P Y Y SPPPPP     Y SPPPPVY SPPPPYH  YTSPPPP
Sbjct: 270 PVYKYKSPPPPPP---VYKSPPPPVYKSPPPPYHYYYTSPPPP 309

 Score =  199 bits (505), Expect = 2e-49
 Identities = 124/238 (52%), Positives = 131/238 (55%), Gaps = 36/238 (15%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPP 427
           + S   TL+VAL+SL+ P    AN Y  S PPP K Y        VY    SPPP VY  
Sbjct: 4   IVSLLATLVVALLSLSFPLECKANYYYSSPPPPTKKY--------VYS---SPPPPVYKY 52

Query: 426 VSPPPKV---YPPVSPPYHYSSPPPPVY---SPPKKPYHYSSPPPPVY---SPPPP-YHY 277
            SPPP +     P  P Y Y SPPPPVY   SPP  P  Y SPPPPVY   SPPPP Y Y
Sbjct: 53  KSPPPPLPIYRSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKY 112

Query: 276 SSPPPPP---KKP----YKYSSPPPPEHHVS----PKPYYHSPPPPKKPYYYHSPPPPVY 130
            SPPPPP   K P    YKY SPPPP +       P P Y SPPPP   Y    PPPPV+
Sbjct: 113 KSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVH 172

Query: 129 -SPPPP-YHYSSPPP-------PPKKPYYYHSPPPPVY---SPPPP---YHYTSPPPP 1
            SPPPP Y Y SPPP       PP  P  Y SPPPPVY   SPPPP   Y Y SPPPP
Sbjct: 173 KSPPPPIYKYKSPPPPVYKYKSPPPPPPMYKSPPPPVYKHKSPPPPPPVYKYKSPPPP 230

 Score =  171 bits (434), Expect = 3e-41
 Identities = 101/187 (54%), Positives = 104/187 (55%), Gaps = 24/187 (12%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPV--SPPPKVY--------PPVY-SPPPKVYPPVSPPPKVYP---PV 394
           Y Y SPPPP   PPV  SPPP VY        PPV+ SPPP +Y   SPPP VY    P 
Sbjct: 140 YKYKSPPPP---PPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPP 196

Query: 393 SPPYHYSSPPPPVY---SPPKKP--YHYSSPPPPVYS----PPPPYHYSSPPPPPKKPYK 241
            PP  Y SPPPPVY   SPP  P  Y Y SPPPPVY     PPPP  Y SPPPP  K YK
Sbjct: 197 PPPPMYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYK-YK 255

Query: 240 YSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY-SPPPPYHYSSPPPPPKKPYYYH 64
              PPPP +   P P Y    PP  P  Y SPPPPVY SPPPPYH           YYY 
Sbjct: 256 SPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKSPPPPYH-----------YYYT 304

Query: 63  SPPPPVY 43
           SPPPP Y
Sbjct: 305 SPPPPHY 311

[38][TOP]
>UniRef100_P06599 Extensin n=1 Tax=Daucus carota RepID=EXTN_DAUCA
          Length = 306

 Score =  205 bits (521), Expect = 3e-51
 Identities = 128/304 (42%), Positives = 145/304 (47%), Gaps = 100/304 (32%)
 Frame = -3

Query: 612 SLMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPV---SPPPKVY-----PPV 457
           S M+S   +LLV LVSL L S  +A  Y YSSPPPP+  PP    SPPP  +     PP 
Sbjct: 8   SKMSSLIVSLLVVLVSLNLASETTAK-YTYSSPPPPEHSPPPPEHSPPPPYHYESPPPPK 66

Query: 456 YSPPPK--VYPPVSPPPKVYPPVSPPYHYSSPPPPVYS---------------------- 349
           +SPPP   VY   SPPP ++ P  PPYH+ SPPPP +S                      
Sbjct: 67  HSPPPPTPVYKYKSPPPPMHSP-PPPYHFESPPPPKHSPPPPTPVYKYKSPPPPKHSPAP 125

Query: 348 ----------PPKKPYHYSSPPPPVYSP-----------PPPYHYSSP------------ 268
                     PP   Y Y SPPPP +SP           PPP H+ +P            
Sbjct: 126 VHHYKYKSPPPPTPVYKYKSPPPPKHSPAPEHHYKYKSPPPPKHFPAPEHHYKYKYKSPP 185

Query: 267 ----------PPPPKKPYKYSSPPPPEH-------------------HVSPKPYYHSPPP 175
                     PPPP   YKY SPPPP+H                   + SP P  HSPPP
Sbjct: 186 PPTPVYKYKSPPPPTPVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYKSPPPPEHSPPP 245

Query: 174 PKKPYYYHSPPPPVYSPPPP---YHYSSPPPPPKKPYYYHSPPPPVYSPPPP---YHYTS 13
           P   Y Y SPPPP++SPPPP   Y Y SPPPP       HSPPPPVYSPPPP   Y YTS
Sbjct: 246 PTPVYKYKSPPPPMHSPPPPTPVYKYKSPPPP------MHSPPPPVYSPPPPKHHYSYTS 299

Query: 12  PPPP 1
           PPPP
Sbjct: 300 PPPP 303

 Score =  117 bits (292), Expect = 1e-24
 Identities = 60/119 (50%), Positives = 70/119 (58%), Gaps = 12/119 (10%)
 Frame = -3

Query: 531 YLYSSPPPPK-VYPPVSPPPKVYPPV-------YSPPPKVYPPVSPPPKVY--PPVSPPY 382
           Y Y SPPPP  VY   SPPP  + P         SPPP      SPPP  +  PP +P Y
Sbjct: 191 YKYKSPPPPTPVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYKSPPPPEHSPPPPTPVY 250

Query: 381 HYSSPPPPVYSPPKKP--YHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHH 211
            Y SPPPP++SPP     Y Y SPPPP++SPPPP +    PPPPK  Y Y+SPPPP H+
Sbjct: 251 KYKSPPPPMHSPPPPTPVYKYKSPPPPMHSPPPPVY---SPPPPKHHYSYTSPPPPHHY 306

[39][TOP]
>UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO
          Length = 538

 Score =  204 bits (518), Expect = 6e-51
 Identities = 110/199 (55%), Positives = 114/199 (57%), Gaps = 23/199 (11%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPK--VYPPVSPPYHYSSPPPPV 355
           +YS PPPP VY P  PPP   PPVYSPPP   P  SPPP   VY P  PP     PPPPV
Sbjct: 255 VYSPPPPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPV 314

Query: 354 YSPPKKPYHYS-SPPPPVYSPPPPYHY----SSPPPPPKKPYKYSSPPPPEHHVSPKPYY 190
           YSPP  P     SPPPPVYSPPPP       S PPP P  P     PPPP +   P P  
Sbjct: 315 YSPPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPL 374

Query: 189 HSPPPPKKPYYY---------HSPPPPVYSPPPPYHYSSPPPPPKKP----YYYHSPPP- 52
            SPPPP  PYYY         HSPPPP +SPPPP    SPPPPP  P    Y Y SPPP 
Sbjct: 375 FSPPPPT-PYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPP 433

Query: 51  --PVYSPPPPYHYTSPPPP 1
             PVYSPPPP  Y+ PPPP
Sbjct: 434 PHPVYSPPPPPVYSPPPPP 452

 Score =  198 bits (504), Expect = 3e-49
 Identities = 109/201 (54%), Positives = 114/201 (56%), Gaps = 28/201 (13%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVY-----PPVYSPPPKVYPPVSPPPKVY--PPVSPPYHYSSPPP 361
           SPP P   PPV  PP VY     PPVYSPPP   PP SPPP VY  PP  PP +   PPP
Sbjct: 239 SPPMPVPSPPVYLPPPVYSPPPPPPVYSPPP---PPPSPPPPVYSPPPPPPPVYSPPPPP 295

Query: 360 PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSP 181
           PVYSPP  P     PPPPVYSPPPP    SPPPP   P  YS PPPP     P P   SP
Sbjct: 296 PVYSPPPPPPSPPPPPPPVYSPPPP---PSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSP 352

Query: 180 ------PPPKKPYYYHSPPPPVYSPPP--PYHYSSPPPP------------PKKPYYYHS 61
                 PPP  P     PPPP++SPPP  PY+YSSPPPP            P  P   HS
Sbjct: 353 LPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHS 412

Query: 60  PPPPVYSPPPP-YHYTSPPPP 1
           PPPP +SPPPP Y Y SPPPP
Sbjct: 413 PPPPPHSPPPPIYPYLSPPPP 433

 Score =  192 bits (488), Expect = 2e-47
 Identities = 108/219 (49%), Positives = 116/219 (52%), Gaps = 46/219 (21%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVY---PPVYSPPPKVYPPVSP-PPKVYPPVSPPYHYSSPPPPVY 352
           SPPPP   PP SPPP VY   PP  SPPP   PP SP PP V PP  PP +   PPPP++
Sbjct: 316 SPPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLF 375

Query: 351 SPPKK-PYHYSSPPPPV---------YSPPPPYHYSSPPPPPKKP----YKYSSPPPPEH 214
           SPP   PY+YSSPPPP          +SPPPP    SPPPPP  P    Y Y SPPPP H
Sbjct: 376 SPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPH 435

Query: 213 HV---SPKPYYHSPPPPKKPYYY----------HSPPPPVYSPPPPYHYSSP--PPPPKK 79
            V    P P Y  PPPP  P             +SPPPP  SPPPP  Y  P  P PP  
Sbjct: 436 PVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPP 495

Query: 78  PYYYHSPPPPVYSPPPP-------------YHYTSPPPP 1
           P +Y+SPPPP  SPPPP               Y SPPPP
Sbjct: 496 PVHYYSPPPPSQSPPPPAPVYEGPLPPITGVSYASPPPP 534

 Score =  159 bits (402), Expect = 2e-37
 Identities = 92/179 (51%), Positives = 100/179 (55%), Gaps = 21/179 (11%)
 Frame = -3

Query: 474 KVYPPVYSPPPKVYPPV---SPPPKVYPPV-SPPYHYSSPPPPVYSPPKKPYHYSSPPPP 307
           K + P    PP   PP+   SPP  + PPV SPP     PPPPVYSPP  P    SPPPP
Sbjct: 226 KPFVPTLPAPPPPSPPMPVPSPPVYLPPPVYSPP-----PPPPVYSPPPPP---PSPPPP 277

Query: 306 VYSPPPPYH--YSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV 133
           VYSPPPP    YS PPPPP     YS PPPP     P P  +SPPPP  P    SPPPPV
Sbjct: 278 VYSPPPPPPPVYSPPPPPP----VYSPPPPPPSPPPPPPPVYSPPPPPSP-PPPSPPPPV 332

Query: 132 YSPPPPYHYSSPP-------------PPPKKPYYYHSPPPPVYSPPP--PYHYTSPPPP 1
           YSPPPP     PP             PPP  P     PPPP++SPPP  PY+Y+SPPPP
Sbjct: 333 YSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPP 391

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 56/118 (47%), Positives = 60/118 (50%), Gaps = 3/118 (2%)
 Frame = -3

Query: 345 PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPP--- 175
           P KP   SS     + P  P    +PPPP        SPP P     P P  + PPP   
Sbjct: 214 PFKPVDCSSFRCKPFVPTLP----APPPP--------SPPMPV----PSPPVYLPPPVYS 257

Query: 174 PKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           P  P   +SPPPP  SPPPP  YS PPPPP  P Y   PPPPVYSPPPP     PPPP
Sbjct: 258 PPPPPPVYSPPPPPPSPPPPV-YSPPPPPP--PVYSPPPPPPVYSPPPPPPSPPPPPP 312

[40][TOP]
>UniRef100_Q38913-2 Isoform 2 of Extensin-1 n=1 Tax=Arabidopsis thaliana RepID=Q38913-2
          Length = 246

 Score =  204 bits (518), Expect = 6e-51
 Identities = 126/231 (54%), Positives = 130/231 (56%), Gaps = 35/231 (15%)
 Frame = -3

Query: 588 TLLVALVSLTLPSLISANSYLYSSPPPPKVY---PPV--SPPPKVY----PPVYSPPPKV 436
           + LV   SL   S  +AN Y YSSPPPP  +   PPV  SPPP V     PPVY  PP  
Sbjct: 3   SFLVLAFSLAFVSQTTAN-YFYSSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 61

Query: 435 YPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPV--YSPPPPYHYSSPPP 262
               SPPP VY    PP  Y SPPP   SPP  P  Y SPPPPV  YSPPP   Y SPPP
Sbjct: 62  VKHYSPPP-VYKSPPPPVKYYSPPPVYKSPP--PPVYKSPPPPVKHYSPPPV--YKSPPP 116

Query: 261 PPK---KPYKYSSPPPPEHHVSPKPYYHSPPPPKK-----PYYYHSPPPPV--------- 133
           P K    P  Y SPPPP  H SP P Y SPPPP K     P  YHSPPPPV         
Sbjct: 117 PVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVVYHSPPPPVHYSPPPVVY 176

Query: 132 YSPPPPYHYSSP------PPPPKKPYYYHSPPPPV-YSPPPPYHYTSPPPP 1
           +SPPPP HYS P      PPPPKK Y Y SPPPPV YSPP  YH  SPPPP
Sbjct: 177 HSPPPPVHYSPPPVVYHSPPPPKKHYEYKSPPPPVHYSPPTVYH--SPPPP 225

 Score =  156 bits (395), Expect = 1e-36
 Identities = 103/202 (50%), Positives = 109/202 (53%), Gaps = 40/202 (19%)
 Frame = -3

Query: 528 LYSSPPPPKVY---PPV--SPPPKVY----PPV--YSPPPKVYPPVSP-----PPKVY-- 403
           +Y SPPPP  Y   PPV  SPPP VY    PPV  YSPPP    P  P     PP VY  
Sbjct: 70  VYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKS 129

Query: 402 --PPV---SPPYHYSSPPPPV--YSPPKKPYHYSSPPPPVY---------SPPPPYHYSS 271
             PPV   SPP  Y SPPPPV  YSPP   YH  SPPPPV+         SPPPP HYS 
Sbjct: 130 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVVYH--SPPPPVHYSPPPVVYHSPPPPVHYSP 187

Query: 270 PP------PPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYH 109
           PP      PPPKK Y+Y SPPPP H        +SPP       YHSPPPPV+      H
Sbjct: 188 PPVVYHSPPPPKKHYEYKSPPPPVH--------YSPPT-----VYHSPPPPVH------H 228

Query: 108 YSSPPPPPKKPYYYHSPPPPVY 43
           YS    PP +PY Y SPPPP Y
Sbjct: 229 YS----PPHQPYLYKSPPPPHY 246

[41][TOP]
>UniRef100_Q39865 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39865_SOYBN
          Length = 169

 Score =  203 bits (517), Expect = 8e-51
 Identities = 96/159 (60%), Positives = 101/159 (63%), Gaps = 10/159 (6%)
 Frame = -3

Query: 447 PPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSP 268
           PP  Y    PPP   PP  PPY+Y SPPPP  SPP  PY+Y SPPPP  SPPPPY+Y SP
Sbjct: 1   PPPYYYHSPPPPSPSPP--PPYYYKSPPPPSPSPP-PPYYYHSPPPPSPSPPPPYYYHSP 57

Query: 267 PPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPK----KPYYYHSPPPPVYSPPPPYH 109
           PPP   P  PY Y SPPPP     P  YY SPPPP      PYYY SPPPP   PPPPYH
Sbjct: 58  PPPSPSPPSPYYYKSPPPPSPSPPPPYYYKSPPPPSPTSHPPYYYKSPPPPTSYPPPPYH 117

Query: 108 YSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           Y SPPPP   P  PY+Y SPPPP  +P P Y Y SPPPP
Sbjct: 118 YVSPPPPSPSPPPPYHYTSPPPPSPAPAPKYIYKSPPPP 156

 Score =  197 bits (500), Expect = 8e-49
 Identities = 102/177 (57%), Positives = 108/177 (61%), Gaps = 12/177 (6%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKP 334
           PPP  Y   SPPP    P  SPPP  Y    PPP   PP  PPY+Y SPPPP  SPP  P
Sbjct: 1   PPPYYYH--SPPP----PSPSPPPPYYYKSPPPPSPSPP--PPYYYHSPPPPSPSPPP-P 51

Query: 333 YHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK- 166
           Y+Y SPPPP  SPP PY+Y SPPPP   P  PY Y SPPPP     P  YY SPPPP   
Sbjct: 52  YYYHSPPPPSPSPPSPYYYKSPPPPSPSPPPPYYYKSPPPPSPTSHPPYYYKSPPPPTSY 111

Query: 165 ---PYYYHSPPPPVYSPPPPYHYSSPPPPPKKP---YYYHSPPPPVY--SPPPPYHY 19
              PY+Y SPPPP  SPPPPYHY+SPPPP   P   Y Y SPPPPVY  + PPP  Y
Sbjct: 112 PPPPYHYVSPPPPSPSPPPPYHYTSPPPPSPAPAPKYIYKSPPPPVYIYASPPPPIY 168

 Score =  196 bits (499), Expect = 1e-48
 Identities = 100/182 (54%), Positives = 106/182 (58%), Gaps = 10/182 (5%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPP   + P  P P   PP Y   P       PPP   PP  PPY+Y SPPPP  SPP  
Sbjct: 1   PPPYYYHSPPPPSPSPPPPYYYKSP-------PPPSPSPP--PPYYYHSPPPPSPSPP-P 50

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
           PY+Y SPPPP  SPP PY+Y SPPPP   P  PY Y SPPPP     P  YY SPPPP  
Sbjct: 51  PYYYHSPPPPSPSPPSPYYYKSPPPPSPSPPPPYYYKSPPPPSPTSHPPYYYKSPPPPTS 110

Query: 165 ----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPP 7
               PY+Y SPPPP  SPPPPYHY+SPPPP   P   Y Y SPPPPVY       Y SPP
Sbjct: 111 YPPPPYHYVSPPPPSPSPPPPYHYTSPPPPSPAPAPKYIYKSPPPPVYI------YASPP 164

Query: 6   PP 1
           PP
Sbjct: 165 PP 166

 Score =  178 bits (452), Expect = 3e-43
 Identities = 94/178 (52%), Positives = 103/178 (57%), Gaps = 7/178 (3%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           PS      Y Y SPPPP    P  PPP  Y   +SPPP   P  SPP        PPY+Y
Sbjct: 12  PSPSPPPPYYYKSPPPPS---PSPPPPYYY---HSPPP---PSPSPP--------PPYYY 54

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVS 205
            SPPPP  SPP  PY+Y SPPPP  SPPPPY+Y SPPPP      PY Y SPPPP  +  
Sbjct: 55  HSPPPPSPSPP-SPYYYKSPPPPSPSPPPPYYYKSPPPPSPTSHPPYYYKSPPPPTSYPP 113

Query: 204 PKPYYHSPPPPK----KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY 43
           P  +Y SPPPP      PY+Y SPPPP  +P P Y Y SPPPP    Y Y SPPPP+Y
Sbjct: 114 PPYHYVSPPPPSPSPPPPYHYTSPPPPSPAPAPKYIYKSPPPP---VYIYASPPPPIY 168

[42][TOP]
>UniRef100_Q7DLZ6 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q7DLZ6_VIGUN
          Length = 164

 Score =  202 bits (513), Expect = 2e-50
 Identities = 107/184 (58%), Positives = 111/184 (60%), Gaps = 7/184 (3%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y Y SPPPP    P  PPP VY    PP  SPPP  Y    PPP   PP  PPY+Y SPP
Sbjct: 7   YYYKSPPPPS---PSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPP--PPYYYKSPP 61

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPY 193
           PP  SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP    SP   
Sbjct: 62  PPSPSPP-PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPP----SP--- 113

Query: 192 YHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTS 13
             SPPP   PYYY SPPPP  SPPPPY+Y SPPPP        SPPPP Y    PY Y S
Sbjct: 114 --SPPP---PYYYKSPPPPSPSPPPPYYYKSPPPPSP------SPPPPYY----PYLYNS 158

Query: 12  PPPP 1
           PPPP
Sbjct: 159 PPPP 162

 Score =  201 bits (511), Expect = 4e-50
 Identities = 93/144 (64%), Positives = 96/144 (66%), Gaps = 10/144 (6%)
 Frame = -3

Query: 402 PPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSS 232
           P   PPY+Y SPPPP  SPP  PY Y SPPPP  SPPPPY+Y SPPPP   P  PY Y S
Sbjct: 1   PSPPPPYYYKSPPPPSPSPP-PPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKS 59

Query: 231 PPPPEHHVSPKPYYHSPPPPK----KPYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPY 73
           PPPP     P  YY SPPPP      PYYY SPPPP  SPPPPY Y SPPPP   P  PY
Sbjct: 60  PPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPY 119

Query: 72  YYHSPPPPVYSPPPPYHYTSPPPP 1
           YY SPPPP  SPPPPY+Y SPPPP
Sbjct: 120 YYKSPPPPSPSPPPPYYYKSPPPP 143

 Score =  156 bits (394), Expect = 1e-36
 Identities = 80/146 (54%), Positives = 85/146 (58%), Gaps = 4/146 (2%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP   PP  P
Sbjct: 31  PSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP--P 85

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHV 208
           PY+Y SPPPP  SPP  PY Y SPPPP  SPPPPY+Y SPPPP        SPPPP ++ 
Sbjct: 86  PYYYKSPPPPSPSPP-PPYVYKSPPPPSPSPPPPYYYKSPPPPS------PSPPPPYYYK 138

Query: 207 SPKPYYHSPPPPKKPYYYHSPPPPVY 130
           SP P   SPPPP  PY Y+SPPPP Y
Sbjct: 139 SPPPPSPSPPPPYYPYLYNSPPPPAY 164

[43][TOP]
>UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis
           thaliana RepID=Q9XIL9_ARATH
          Length = 727

 Score =  201 bits (512), Expect = 3e-50
 Identities = 112/184 (60%), Positives = 116/184 (63%), Gaps = 11/184 (5%)
 Frame = -3

Query: 519 SPPPPKVYPPV------SPPPKVYPPVYSPPPK--VYPPVSPPPKVYPPVSPPYHYSSPP 364
           SPPPP V+ P       SPPP   PPVYSPPP   VY P  PPP   PP  PP H  SPP
Sbjct: 492 SPPPPPVHSPPPPSPIHSPPP---PPVYSPPPPPPVYSPPPPPPVYSPPPPPPVH--SPP 546

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYK--YSSPPPPEHHVSPKPYY 190
           PPV+SPP  P H  SPPPPV+SPPPP H  SPPPP   P    YS PPPP H  SP P  
Sbjct: 547 PPVHSPPP-PVH--SPPPPVHSPPPPVH--SPPPPVHSPPPPVYSPPPPPVH--SPPPPV 599

Query: 189 HSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPP-KKPYYYHSPPPPVYSPPPPYHYTS 13
           HSPPPP      HSPPPPVYSPPPP    SPPPP    P   HSPPPPVYSPPPP  Y+ 
Sbjct: 600 HSPPPP-----VHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPV-YSP 653

Query: 12  PPPP 1
           PPPP
Sbjct: 654 PPPP 657

 Score =  188 bits (477), Expect = 3e-46
 Identities = 105/189 (55%), Positives = 109/189 (57%), Gaps = 18/189 (9%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYP-PVYSP-PPKVYP---------PVS-----PPPKVYPPVSPPY 382
           PPP   PP SPP    P PV+ P PPK  P         PV      PPP V+ P  P  
Sbjct: 447 PPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSP 506

Query: 381 HYSSPPPPVYSPPKKPYHYSSPPPP-VYSPPPPYHYSSPPPP-PKKPYKYSSPPPPEHHV 208
            +S PPPPVYSPP  P  YS PPPP VYSPPPP    SPPPP    P    SPPPP H  
Sbjct: 507 IHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVH-- 564

Query: 207 SPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPP 28
           SP P  HSPPPP      HSPPPPVYSPPPP  +S PPP    P   HSPPPPVYSPPPP
Sbjct: 565 SPPPPVHSPPPP-----VHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 619

Query: 27  YHYTSPPPP 1
               SPPPP
Sbjct: 620 PPVHSPPPP 628

 Score =  184 bits (468), Expect = 4e-45
 Identities = 112/200 (56%), Positives = 118/200 (59%), Gaps = 24/200 (12%)
 Frame = -3

Query: 528  LYSSPPPPKVYPPVSPPPKVY-----PPVYSPPPKVY---PPV-SPPPKVY---PPV-SP 388
            +YS PPPP VY P  PPP VY     PPV+SPPP V+   PPV SPPP V+   PPV SP
Sbjct: 515  VYSPPPPPPVYSP-PPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 573

Query: 387  PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHV 208
            P    SPPPPVYSPP  P H  SPPPPV+SPPPP H  SPPPP      YS PPPP  H 
Sbjct: 574  PPPVHSPPPPVYSPPPPPVH--SPPPPVHSPPPPVH--SPPPPV-----YSPPPPPPVHS 624

Query: 207  SPKPYYHSPPP---PKKPYYYHSPPPPVYSPPPPYHYSSPPP----PPKKPYYYHSPP-- 55
             P P +  PPP   P  P Y  SPPPPVYSPPPP   S PPP    PP  P    SPP  
Sbjct: 625  PPPPVFSPPPPVHSPPPPVY--SPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQ 682

Query: 54   PPVYSPPP--PYHYTSPPPP 1
             PV SPPP  P      PPP
Sbjct: 683  TPVNSPPPRTPSQTVEAPPP 702

 Score =  182 bits (461), Expect = 3e-44
 Identities = 105/197 (53%), Positives = 113/197 (57%), Gaps = 24/197 (12%)
 Frame = -3

Query: 519 SPPPPKVY--------PPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSS-- 370
           SPPPP+          PP S PP   PPV+S P  V+ P   PPK  P  + PY  S   
Sbjct: 432 SPPPPQQPHHHVVHSPPPASSPP-TSPPVHSTPSPVHKP--QPPKESPQPNDPYDQSPVK 488

Query: 369 -----PPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVS 205
                PPPPV+SPP     +S PPPPVYSPPPP    SPPPPP     YS PPPP  H S
Sbjct: 489 FRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPV---YSPPPPPPVH-S 544

Query: 204 PKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYY------YHSPPP 52
           P P  HSPPPP      HSPPPPV+SPPPP H  SPPPP   P  P Y       HSPPP
Sbjct: 545 PPPPVHSPPPP-----VHSPPPPVHSPPPPVH--SPPPPVHSPPPPVYSPPPPPVHSPPP 597

Query: 51  PVYSPPPPYHYTSPPPP 1
           PV+SPPPP H  SPPPP
Sbjct: 598 PVHSPPPPVH--SPPPP 612

 Score =  158 bits (400), Expect = 3e-37
 Identities = 103/211 (48%), Positives = 113/211 (53%), Gaps = 35/211 (16%)
 Frame = -3

Query: 528  LYSSPPPPKVY---PPV-SPPPKVY---PPVYSPPPKVY---PPV-SPPPKVYPPVSPPY 382
            +YS PPPP V+   PPV SPPP V+   PPV+SPPP V+   PPV SPPP VY P  PP 
Sbjct: 533  VYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPV 592

Query: 381  H------------YSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKY 238
            H              SPPPPVYSPP  P  +S PPPPV+SPPPP H  SPPPP      Y
Sbjct: 593  HSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHS-PPPPVFSPPPPVH--SPPPP-----VY 644

Query: 237  SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPP-PPYHYSSPP-------PPPK 82
            S PP         P Y  PPPP K      PPPPVYSPP  P   SSPP       PPP+
Sbjct: 645  SPPP---------PVYSPPPPPVK----SPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPR 691

Query: 81   KPYYYHSPPPP----VYSPPPPYHYTSPPPP 1
             P      PPP    +  P   + Y SPPPP
Sbjct: 692  TPSQTVEAPPPSEEFIIPPFIGHQYASPPPP 722

 Score =  146 bits (368), Expect = 2e-33
 Identities = 88/188 (46%), Positives = 97/188 (51%), Gaps = 23/188 (12%)
 Frame = -3

Query: 495 PPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHY--- 325
           P  SP P    PV+ P P   P  SP P   P    P  +   PP    PP++P+H+   
Sbjct: 394 PSKSPSPVPTRPVHKPQP---PKESPQPND-PYNQSPVKFRRSPP----PPQQPHHHVVH 445

Query: 324 -----SSPP--PPVYSPPPPYHYSSPP---PPPKKPY-------KYSSPPPPEHHVSPKP 196
                SSPP  PPV+S P P H   PP   P P  PY       + S PPPP H   P  
Sbjct: 446 SPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPS 505

Query: 195 YYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPP---KKPYYYHSPPPPVYSPPPPY 25
             HSPPPP  P Y   PPPPVYSPPPP    SPPPPP     P   HSPPPPV+SPPPP 
Sbjct: 506 PIHSPPPP--PVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPV 563

Query: 24  HYTSPPPP 1
           H  SPPPP
Sbjct: 564 H--SPPPP 569

 Score =  133 bits (335), Expect = 1e-29
 Identities = 88/182 (48%), Positives = 101/182 (55%), Gaps = 11/182 (6%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVY---PPV-SPPPKVY-PPVS 391
            P + S    ++S PPP       SPPP   PPV+SPPP V+   PPV SPPP VY PP  
Sbjct: 568  PPVHSPPPPVHSPPPPV-----YSPPP---PPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 619

Query: 390  PPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHH 211
            PP H  SPPPPV+SPP  P H  SPPPPVYSPPPP  YS PPPP K P     PPPP + 
Sbjct: 620  PPVH--SPPPPVFSPP-PPVH--SPPPPVYSPPPPV-YSPPPPPVKSP-----PPPPVYS 668

Query: 210  VSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPP------PPKKPYYYHSPPPP 49
                P   S PP + P   +SPPP      P     +PPP      PP   + Y SPPPP
Sbjct: 669  PPLLPPKMSSPPTQTP--VNSPPPRT----PSQTVEAPPPSEEFIIPPFIGHQYASPPPP 722

Query: 48   VY 43
            ++
Sbjct: 723  MF 724

 Score = 95.1 bits (235), Expect = 4e-18
 Identities = 60/131 (45%), Positives = 68/131 (51%), Gaps = 27/131 (20%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY---PPVYSPPPKVYPPVSPPPKVYPPVSPP 385
           P + S    +YS PPPP V+   SPPP V+   PPV+SPPP VY   SPPP VY P  PP
Sbjct: 604 PPVHSPPPPVYSPPPPPPVH---SPPPPVFSPPPPVHSPPPPVY---SPPPPVYSPPPPP 657

Query: 384 YHYSSPPPPVYSPPKKPYHYSSPPP--PVYSPPPP----------------------YHY 277
              S PPPPVYSPP  P   SSPP   PV SPPP                       + Y
Sbjct: 658 VK-SPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPSEEFIIPPFIGHQY 716

Query: 276 SSPPPPPKKPY 244
           +SPPPP  + Y
Sbjct: 717 ASPPPPMFQGY 727

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 45/119 (37%), Positives = 57/119 (47%), Gaps = 11/119 (9%)
 Frame = -3

Query: 324 SSPPPPVYSPPP-PYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYY-- 154
           SS   P  SP P P      P PPK+    S  P   ++ SP  +  SPPPP++P+++  
Sbjct: 389 SSQATPSKSPSPVPTRPVHKPQPPKE----SPQPNDPYNQSPVKFRRSPPPPQQPHHHVV 444

Query: 153 HSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPP--PYHYT------SPPPP 1
           HSPPP    P  P  +S+P P        H P PP  SP P  PY  +      SPPPP
Sbjct: 445 HSPPPASSPPTSPPVHSTPSP-------VHKPQPPKESPQPNDPYDQSPVKFRRSPPPP 496

[44][TOP]
>UniRef100_Q2A9D3 Extensin, putative n=1 Tax=Brassica oleracea RepID=Q2A9D3_BRAOL
          Length = 509

 Score =  200 bits (509), Expect = 7e-50
 Identities = 115/238 (48%), Positives = 122/238 (51%), Gaps = 61/238 (25%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS-------PPPKVY-----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           Y+Y+SPPPP  Y P         PPP VY     PP YSP PKV     PPP VY    P
Sbjct: 145 YVYNSPPPPPYYSPSPKVEYKSPPPPYVYSSPPLPPYYSPSPKVDYKSPPPPYVYSSPPP 204

Query: 387 PYHYSSPPPPVYSPPKKPYHYSS-PPPPVYSPPPPYHYSSPPPP--------------PK 253
           P +YS  P   Y  P  PY YSS PPPP YSP P   Y SPPPP              P 
Sbjct: 205 PPYYSPSPKVDYKSPPPPYVYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEYNSPP 264

Query: 252 KPYKYSSPPPPEHH-VSPKPYYHSPPPPKKPYYYHSPPPPVY----------SPPPPYHY 106
            PY YSSPPPP ++  SPK  Y SPPP   PY Y+SPPPP Y          SPPPPY Y
Sbjct: 265 PPYVYSSPPPPPYYSPSPKVEYKSPPP---PYVYNSPPPPPYYFPSPKVDYKSPPPPYVY 321

Query: 105 SSPPPP-------------PKKPYYYHSPPPPVY----------SPPPPYHYTSPPPP 1
           SSPPPP             P  PY Y SPPPP Y          SPPPPY Y+SPPPP
Sbjct: 322 SSPPPPPYYSPSPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPPPP 379

 Score =  198 bits (503), Expect = 3e-49
 Identities = 120/233 (51%), Positives = 126/233 (54%), Gaps = 58/233 (24%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY-PPVSPPYH-------YSS 370
           Y+SPPPP VY   SPPP   PP YSP PKV     PPP VY  P  PPY+       Y S
Sbjct: 260 YNSPPPPYVYS--SPPP---PPYYSPSPKVEYKSPPPPYVYNSPPPPPYYFPSPKVDYKS 314

Query: 369 PPPP-VYSPPKKPYHYSSPPPPVY--SPPPPYHYSSPPPP-------------PKKPYKY 238
           PPPP VYS P  P +Y SP P VY  SPPPPY YSSPPPP             P  PY Y
Sbjct: 315 PPPPYVYSSPPPPPYY-SPSPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPPYVY 373

Query: 237 SSPPPPEHH-VSPKPYYHSPPPPKKPYYYHSPPPPVY----------SPPPPYHYSSPPP 91
           SSPPPP ++  SPK  Y  PPP   PY Y SPPPP Y          SPPPPY YSSPPP
Sbjct: 374 SSPPPPPYYSPSPKVNYKYPPP---PYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPP 430

Query: 90  P-------------PKKPYYYHSPPPPVY----------SPPPPYHYTSPPPP 1
           P             P  PY Y SPPPP Y          SPPPPY Y+SPPPP
Sbjct: 431 PQFYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 483

 Score =  198 bits (503), Expect = 3e-49
 Identities = 111/215 (51%), Positives = 117/215 (54%), Gaps = 38/215 (17%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS-------PPPKVY-----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           Y+Y+SPPPP  Y P         PPP VY     PP YSP PKVY    PPP VY    P
Sbjct: 293 YVYNSPPPPPYYFPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPPP 352

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVY----------SPPPPYHYSSPPPP------- 259
           P +YS  P  VY  P  PY YSSPPPP Y           PPPPY YSSPPPP       
Sbjct: 353 PPYYSPSPKMVYKSPPPPYVYSSPPPPPYYSPSPKVNYKYPPPPYVYSSPPPPPYYSPSP 412

Query: 258 ------PKKPYKYSSPPPPE-HHVSPKPYYHSPPPPKKPYYYHS-PPPPVYSPPPPYHYS 103
                 P  PY YSSPPPP+ +  SPK  Y SPPP   PY Y S PPPP YSP P   Y 
Sbjct: 413 KVNYKSPPPPYVYSSPPPPQFYSPSPKAEYKSPPP---PYVYSSPPPPPYYSPSPKVDYK 469

Query: 102 SPPPPPKKPYYYHS-PPPPVYSPPPPYHYTSPPPP 1
           SPPP    PY Y S PPPP YSP P  +Y SPPPP
Sbjct: 470 SPPP----PYVYSSPPPPPYYSPSPKVYYKSPPPP 500

 Score =  197 bits (501), Expect = 6e-49
 Identities = 120/254 (47%), Positives = 128/254 (50%), Gaps = 77/254 (30%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS-------PPPKVY-----PPVYSPPPKV-YPPVSPPPKVYPPVS 391
           Y+YSSPPPP  Y P         PPP +Y     PP YSP P+V Y    PPP  Y P  
Sbjct: 75  YIYSSPPPPSYYSPSPKVEYKSPPPPYIYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSP 134

Query: 390 --------PPYHYSSPPPP-VYSP--------PKKPYHYSSPPPPVY----------SPP 292
                   PPY Y+SPPPP  YSP        P  PY YSSPP P Y          SPP
Sbjct: 135 KVEYKSPPPPYVYNSPPPPPYYSPSPKVEYKSPPPPYVYSSPPLPPYYSPSPKVDYKSPP 194

Query: 291 PPYHYSSPPPP-------------PKKPYKYSS-PPPPEHHVSPKPYYHSPPPPKKPYYY 154
           PPY YSSPPPP             P  PY YSS PPPP +  SP+  Y SPPPP  PYY 
Sbjct: 195 PPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSLPPPPYYSPSPEVDYKSPPPP-PPYYS 253

Query: 153 HSPPPPVYSPPPPYHYSSPPPP-------------PKKPYYYHSPPPPVY---------- 43
            SP     SPPPPY YSSPPPP             P  PY Y+SPPPP Y          
Sbjct: 254 PSPKVEYNSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYFPSPKVDYK 313

Query: 42  SPPPPYHYTSPPPP 1
           SPPPPY Y+SPPPP
Sbjct: 314 SPPPPYVYSSPPPP 327

 Score =  177 bits (450), Expect = 5e-43
 Identities = 119/275 (43%), Positives = 131/275 (47%), Gaps = 84/275 (30%)
 Frame = -3

Query: 573 LVSLTLPSLISANSYLYSSPPPPKVYPPV--------------------SPPPKV--YPP 460
           +V + + S I A +Y Y SPP  + YPPV                    SPPP+     P
Sbjct: 7   MVYVVVFSAIVAAAYPYESPPTTQKYPPVHKTKSPYQPKKNSPYYSAPPSPPPQYRRQGP 66

Query: 459 VYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPP-VYSP-PKKPYH-------YSSPPPP 307
            Y+P PK Y   SPPP  Y   SP   Y SPPPP +YS  P  PY+       Y SPPPP
Sbjct: 67  KYTPHPKPYIYSSPPPPSYYSPSPKVEYKSPPPPYIYSSLPPPPYYSPSPEVDYKSPPPP 126

Query: 306 -----------VYSPPPPYHYSSPPPP-------------PKKPYKYSSPP-PPEHHVSP 202
                        SPPPPY Y+SPPPP             P  PY YSSPP PP +  SP
Sbjct: 127 PPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKVEYKSPPPPYVYSSPPLPPYYSPSP 186

Query: 201 KPYYHSPPPPKKPYYYHSPPPPVY----------SPPPPYHYSSPPPPPKKPYY------ 70
           K  Y SPPP   PY Y SPPPP Y          SPPPPY YSS PPP   PYY      
Sbjct: 187 KVDYKSPPP---PYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSLPPP---PYYSPSPEV 240

Query: 69  -YHSPPPP-----------VYSPPPPYHYTSPPPP 1
            Y SPPPP             SPPPPY Y+SPPPP
Sbjct: 241 DYKSPPPPPPYYSPSPKVEYNSPPPPYVYSSPPPP 275

 Score =  158 bits (400), Expect = 3e-37
 Identities = 88/159 (55%), Positives = 93/159 (58%), Gaps = 6/159 (3%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
           +Y SPPPP VY    PPP    P YSP PKV     PPP VY    PP +YS  P   Y 
Sbjct: 363 VYKSPPPPYVYSS-PPPP----PYYSPSPKVNYKYPPPPYVYSSPPPPPYYSPSPKVNYK 417

Query: 348 PPKKPYHYSSPPPP-VYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHH-VSPKPYYHSPPP 175
            P  PY YSSPPPP  YSP P   Y SPPP    PY YSSPPPP ++  SPK  Y SPPP
Sbjct: 418 SPPPPYVYSSPPPPQFYSPSPKAEYKSPPP----PYVYSSPPPPPYYSPSPKVDYKSPPP 473

Query: 174 PKKPYYYHS-PPPPVYSPPPPYHYSSPPPPP---KKPYY 70
              PY Y S PPPP YSP P  +Y SPPPPP   K PYY
Sbjct: 474 ---PYVYSSPPPPPYYSPSPKVYYKSPPPPPYVYKMPYY 509

 Score =  105 bits (263), Expect = 2e-21
 Identities = 67/138 (48%), Positives = 69/138 (50%), Gaps = 42/138 (30%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPP-------VSPPPKVY-----PPVYSPPPKVYPPVSPPPKVY---PP 397
           Y+YSSPPPP  Y P         PPP VY     PP YSP PKV     PPP VY   PP
Sbjct: 371 YVYSSPPPPPYYSPSPKVNYKYPPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPP 430

Query: 396 VS--------------PPYHYSSPPPP-VYSP--------PKKPYHYSS-PPPPVYSPPP 289
                           PPY YSSPPPP  YSP        P  PY YSS PPPP YSP P
Sbjct: 431 PQFYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSP 490

Query: 288 PYHYSSPPPPP---KKPY 244
             +Y SPPPPP   K PY
Sbjct: 491 KVYYKSPPPPPYVYKMPY 508

 Score = 84.0 bits (206), Expect = 9e-15
 Identities = 51/92 (55%), Positives = 54/92 (58%), Gaps = 8/92 (8%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPV------SPPPKVYPPVYSPPPKVYPPVSPPPKV-YPPVSPPYHYS 373
           Y+YSSPPPP+ Y P       SPPP   P VYS PP   P  SP PKV Y    PPY YS
Sbjct: 423 YVYSSPPPPQFYSPSPKAEYKSPPP---PYVYSSPPPP-PYYSPSPKVDYKSPPPPYVYS 478

Query: 372 SPPPP-VYSPPKKPYHYSSPPPPVYSPPPPYH 280
           SPPPP  YSP  K Y Y SPPPP Y    PY+
Sbjct: 479 SPPPPPYYSPSPKVY-YKSPPPPPYVYKMPYY 509

[45][TOP]
>UniRef100_Q41120 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q41120_PHAVU
          Length = 154

 Score =  200 bits (508), Expect = 9e-50
 Identities = 91/142 (64%), Positives = 95/142 (66%), Gaps = 10/142 (7%)
 Frame = -3

Query: 396 VSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPP 226
           V PPY+Y SPPPP  SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPP
Sbjct: 1   VKPPYYYKSPPPPSPSPP-PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPP 59

Query: 225 PPEHHVSPKPYYHSPPPPK----KPYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYY 67
           PP     P  YYHSPPPP      PYYY SPPPP   PPPPYHY SPPPP   P  PYYY
Sbjct: 60  PPSPSPPPPYYYHSPPPPSPTPHPPYYYKSPPPPTSYPPPPYHYVSPPPPSPSPPPPYYY 119

Query: 66  HSPPPPVYSPPPPYHYTSPPPP 1
            SPPPP  +P P Y Y SPPPP
Sbjct: 120 KSPPPPSPAPAPKYIYKSPPPP 141

 Score =  185 bits (469), Expect = 3e-45
 Identities = 98/183 (53%), Positives = 105/183 (57%), Gaps = 6/183 (3%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVY 352
           Y Y SPPPP      SP         SPPP  Y    PPP   PP  PPY+Y SPPPP  
Sbjct: 5   YYYKSPPPP------SP---------SPPPPYYYKSPPPPSPSPP--PPYYYKSPPPPSP 47

Query: 351 SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSP 181
           SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP  +         P
Sbjct: 48  SPPP-PYYYKSPPPPSPSPPPPYYYHSPPPPSPTPHPPYYYKSPPPPTSY---------P 97

Query: 180 PPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSP 10
           PP   PY+Y SPPPP  SPPPPY+Y SPPPP   P   Y Y SPPPP Y       Y+SP
Sbjct: 98  PP---PYHYVSPPPPSPSPPPPYYYKSPPPPSPAPAPKYIYKSPPPPAYI------YSSP 148

Query: 9   PPP 1
           PPP
Sbjct: 149 PPP 151

 Score =  184 bits (466), Expect = 7e-45
 Identities = 93/163 (57%), Positives = 99/163 (60%), Gaps = 12/163 (7%)
 Frame = -3

Query: 471 VYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPP 292
           V PP Y   P       PPP   PP  PPY+Y SPPPP  SPP  PY+Y SPPPP  SPP
Sbjct: 1   VKPPYYYKSP-------PPPSPSPP--PPYYYKSPPPPSPSPPP-PYYYKSPPPPSPSPP 50

Query: 291 PPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPV 133
           PPY+Y SPPPP   P  PY Y SPPPP     P  YY SPPPP      PY+Y SPPPP 
Sbjct: 51  PPYYYKSPPPPSPSPPPPYYYHSPPPPSPTPHPPYYYKSPPPPTSYPPPPYHYVSPPPPS 110

Query: 132 YSPPPPYHYSSPPPPPKKP---YYYHSPPPP--VYSPPPPYHY 19
            SPPPPY+Y SPPPP   P   Y Y SPPPP  +YS PPP  Y
Sbjct: 111 PSPPPPYYYKSPPPPSPAPAPKYIYKSPPPPAYIYSSPPPPIY 153

 Score =  159 bits (402), Expect = 2e-37
 Identities = 83/150 (55%), Positives = 87/150 (58%), Gaps = 8/150 (5%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP   PP  P
Sbjct: 13  PSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP--P 67

Query: 387 PYHYSSPPPPVYSP-PKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPP 220
           PY+Y SPPPP  SP P  PY+Y SPPPP   PPPPYHY SPPPP   P  PY Y SPPPP
Sbjct: 68  PYYYHSPPPP--SPTPHPPYYYKSPPPPTSYPPPPYHYVSPPPPSPSPPPPYYYKSPPPP 125

Query: 219 EHHVSPKPYYHSPPPPKKPYYYHSPPPPVY 130
               +PK  Y SPPPP   Y Y SPPPP+Y
Sbjct: 126 SPAPAPKYIYKSPPPP--AYIYSSPPPPIY 153

[46][TOP]
>UniRef100_B9GU80 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9GU80_POPTR
          Length = 153

 Score =  199 bits (507), Expect = 1e-49
 Identities = 104/167 (62%), Positives = 108/167 (64%), Gaps = 5/167 (2%)
 Frame = -3

Query: 486 SPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPP 307
           SPPP    P  SPPP  Y    PPP   PP  PPYHY SPPPP  SPP  PY+Y SPPPP
Sbjct: 1   SPPP----PSPSPPPPYYYKSPPPPSPSPP--PPYHYKSPPPPSPSPPP-PYYYKSPPPP 53

Query: 306 VYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYS 127
             SPPPPY+Y SPPPP        SPPPP ++ SP P   SPPPP   YYY SPPPP  S
Sbjct: 54  SPSPPPPYYYKSPPPPSP------SPPPPYYYKSPPPPSPSPPPP---YYYKSPPPPSSS 104

Query: 126 PPPPYHYSSPPPP---PKKPYYYH-SPPPPVYSPPPP-YHYTSPPPP 1
           PPPPY Y SPPPP   P  PYYY  SPPPPV SPPPP Y Y SPPPP
Sbjct: 105 PPPPYVYKSPPPPSPSPPPPYYY-HSPPPPVKSPPPPVYIYASPPPP 150

 Score =  183 bits (464), Expect = 1e-44
 Identities = 92/156 (58%), Positives = 97/156 (62%), Gaps = 12/156 (7%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVY 352
           SPPPP    P  PPP  Y    PP  SPPP  +    PPP   PP  PPY+Y SPPPP  
Sbjct: 1   SPPPPS---PSPPPPYYYKSPPPPSPSPPPPYHYKSPPPPSPSPP--PPYYYKSPPPPSP 55

Query: 351 SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSP 181
           SPP  PY+Y SPPPP  SPPPPY+Y SPPPP   P  PY Y SPPPP     P   Y SP
Sbjct: 56  SPPP-PYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSSSPPPPYVYKSP 114

Query: 180 PPPKK----PYYYHSPPPPVYSPPPP-YHYSSPPPP 88
           PPP      PYYYHSPPPPV SPPPP Y Y+SPPPP
Sbjct: 115 PPPSPSPPPPYYYHSPPPPVKSPPPPVYIYASPPPP 150

[47][TOP]
>UniRef100_Q9T0L0 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0L0_ARATH
          Length = 429

 Score =  199 bits (506), Expect = 2e-49
 Identities = 122/255 (47%), Positives = 130/255 (50%), Gaps = 78/255 (30%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS-------PPPKVY-----PPVYSPPPKVYPPVSPPPKVY--PPV 394
           Y+YSSPPPP  Y P         PPP VY     PP YSP PKV     PPP VY  PP 
Sbjct: 154 YIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPP 213

Query: 393 SP---------------PYHYSSPPPP-VYSP--------PKKPYHYSSPPPPVY----- 301
            P               PY YSSPPPP  YSP        P  PY YSSPPPP Y     
Sbjct: 214 PPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSPK 273

Query: 300 ----SPPPPYHYSSPPPP-------------PKKPYKYSSPPPPEHH-VSPKPYYHSPPP 175
               SPPPPY Y+SPPPP             P  PY YSSPPPP ++  SP+  Y SPPP
Sbjct: 274 VEFKSPPPPYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPP 333

Query: 174 P------KKPYYYHS-PPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY--------- 43
           P        PY Y+S PPPP YSP P  +Y SPPP    PY Y+SPPPP Y         
Sbjct: 334 PYVYNSLPPPYVYNSPPPPPYYSPSPTVNYKSPPP----PYVYNSPPPPPYYSPFPKVEY 389

Query: 42  -SPPPPYHYTSPPPP 1
            SPPPPY Y SPPPP
Sbjct: 390 KSPPPPYIYNSPPPP 404

 Score =  196 bits (497), Expect = 2e-48
 Identities = 112/241 (46%), Positives = 120/241 (49%), Gaps = 65/241 (26%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
           +Y+SPPPP +Y   SPPP   PP YSP PKV     PPP VY    PP +YS  P   Y 
Sbjct: 146 IYNSPPPPYIYS--SPPP---PPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYK 200

Query: 348 PPKKPYHYSSPPPPVY----------SPPPPYHYSSPPPP-------------PKKPYKY 238
            P  PY YS PPPP Y          SPP PY YSSPPPP             P  PY Y
Sbjct: 201 SPPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVY 260

Query: 237 SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY----------SPPPPYHYSSPPPP 88
           SSPPPP +  SPK  + SPPP   PY Y+SPPPP Y          SPPPPY YSSPPPP
Sbjct: 261 SSPPPPPYSPSPKVEFKSPPP---PYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPP 317

Query: 87  P----------------------KKPYYYHSPPPPVY----------SPPPPYHYTSPPP 4
                                    PY Y+SPPPP Y          SPPPPY Y SPPP
Sbjct: 318 TYYSPSPRVDYKSPPPPYVYNSLPPPYVYNSPPPPPYYSPSPTVNYKSPPPPYVYNSPPP 377

Query: 3   P 1
           P
Sbjct: 378 P 378

 Score =  191 bits (485), Expect = 4e-47
 Identities = 110/229 (48%), Positives = 120/229 (52%), Gaps = 56/229 (24%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP VY     PP++Y   YSP PKV     PPP VY  + P  +YS  P  +Y+ P 
Sbjct: 97  SPPPPSVY--TFSPPQLY---YSPSPKVEYKSPPPPYVYSSLPPLTYYSPSPKVIYNSPP 151

Query: 339 KPYHYSSPPPPVY----------SPPPPYHYSSPPPP-------------PKKPYKYSSP 229
            PY YSSPPPP Y          SPPPPY YSSPPPP             P  PY YS P
Sbjct: 152 PPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFP 211

Query: 228 PPPEHH-VSPKPYYHSPPPPKKPYYYHSPPPPVY----------SPPPPYHYSSPPPP-- 88
           PPP ++  SPK  Y SPP    PY Y SPPPP Y          SPPPPY YSSPPPP  
Sbjct: 212 PPPPYYSPSPKVGYKSPP---APYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPY 268

Query: 87  ----------PKKPYYYHSPPPPVY----------SPPPPYHYTSPPPP 1
                     P  PY Y+SPPPP Y          SPPPPY Y+SPPPP
Sbjct: 269 SPSPKVEFKSPPPPYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPP 317

 Score =  186 bits (471), Expect = 2e-45
 Identities = 118/251 (47%), Positives = 127/251 (50%), Gaps = 77/251 (30%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS-------PPPKVY-----PPVYSPPPKV---YPPV-----SPPP 412
           Y+YSSPPPP  Y P         PPP VY     PP YSP PKV    PP      SPPP
Sbjct: 180 YVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPP 239

Query: 411 KVY----PPVS-----PPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVY------ 301
             Y    P V+     PPY YSSPPPP YSP        P  PY Y+SPPPP Y      
Sbjct: 240 PPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSPK 299

Query: 300 ----SPPPPYHYSSPPPP-------------PKKPYKYSSPPPPEHHVSPKPY-YHSPPP 175
               SPPPPY YSSPPPP             P  PY Y+S PPP  + SP P  Y+SP P
Sbjct: 300 IDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPPPYVYNSPPPPPYYSPSP 359

Query: 174 ------PKKPYYYHSPPPPVY----------SPPPPYHYSSPPPPPKKPYYYHSPPPPVY 43
                 P  PY Y+SPPPP Y          SPPPPY Y+SPPPP   PYY  SP     
Sbjct: 360 TVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPP---PYYSPSPKITYK 416

Query: 42  SPPPPYHYTSP 10
           SPPPPY Y +P
Sbjct: 417 SPPPPYIYKTP 427

 Score =  178 bits (452), Expect = 3e-43
 Identities = 105/201 (52%), Positives = 115/201 (57%), Gaps = 24/201 (11%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS-------PPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPP 385
           Y+YSSPPPP  Y P         PPP VY    PP YSP PKV     PPP +Y    PP
Sbjct: 232 YVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPP 291

Query: 384 YHYS--------SPPPP-VYSPPKKPYHYSSPPPPVY-SPPPPYHYSSPPPPPKKPYKYS 235
            +YS        SPPPP VYS P  P +YS  P   Y SPPPPY Y+S PP    PY Y+
Sbjct: 292 SYYSPSPKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPP----PYVYN 347

Query: 234 SPPPPEHH-VSPKPYYHSPPPPKKPYYYHS-PPPPVYSPPPPYHYSSPPPPPKKPYYYHS 61
           SPPPP ++  SP   Y SPPP   PY Y+S PPPP YSP P   Y SPPP    PY Y+S
Sbjct: 348 SPPPPPYYSPSPTVNYKSPPP---PYVYNSPPPPPYYSPFPKVEYKSPPP----PYIYNS 400

Query: 60  -PPPPVYSPPPPYHYTSPPPP 1
            PPPP YSP P   Y SPPPP
Sbjct: 401 PPPPPYYSPSPKITYKSPPPP 421

 Score =  164 bits (416), Expect = 4e-39
 Identities = 102/235 (43%), Positives = 111/235 (47%), Gaps = 60/235 (25%)
 Frame = -3

Query: 525 YSSPPPPKVYPPV---SPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSP-PYHYSSPPPP 358
           Y+SP PPK Y P    SPPP   PP Y      Y P  P P VY   +P PY++  P   
Sbjct: 38  YTSPYPPKNYSPYLSESPPPP--PPQYRRQEPKYTP-HPEPNVYDSPTPLPYYFPFPKLD 94

Query: 357 VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP----------------------PKKPY 244
           + SPP    +  SPP   YSP P   Y SPPPP                      P  PY
Sbjct: 95  IKSPPPPSVYTFSPPQLYYSPSPKVEYKSPPPPYVYSSLPPLTYYSPSPKVIYNSPPPPY 154

Query: 243 KYSSPPPPEHH-VSPKPYYHSPPPPKKPYYYHSPPPPVY----------SPPPPYHYSSP 97
            YSSPPPP ++  SPK  Y SPPP   PY Y SPPPP Y          SPPPPY YS P
Sbjct: 155 IYSSPPPPPYYSPSPKVDYKSPPP---PYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFP 211

Query: 96  PPP-------------PKKPYYYHSPPPPVY----------SPPPPYHYTSPPPP 1
           PPP             P  PY Y SPPPP Y          SPPPPY Y+SPPPP
Sbjct: 212 PPPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPP 266

 Score =  104 bits (259), Expect = 7e-21
 Identities = 70/163 (42%), Positives = 77/163 (47%), Gaps = 45/163 (27%)
 Frame = -3

Query: 354 YSPPKKPYHYSSP-PPPVYSPPPPYHYSSPPPPP----KKPYKYSSPPPPEHHVSPK--P 196
           Y  P     Y+SP PP  YS   PY   SPPPPP    ++  KY+  P P  + SP   P
Sbjct: 29  YDSPSSTPQYTSPYPPKNYS---PYLSESPPPPPPQYRRQEPKYTPHPEPNVYDSPTPLP 85

Query: 195 YY--------HSPPPP-----KKPYYYHSPPPPV--YSPPPPYHYSSPPP---------- 91
           YY         SPPPP       P  Y+SP P V   SPPPPY YSS PP          
Sbjct: 86  YYFPFPKLDIKSPPPPSVYTFSPPQLYYSPSPKVEYKSPPPPYVYSSLPPLTYYSPSPKV 145

Query: 90  ---PPKKPYYYHSPPPPVY----------SPPPPYHYTSPPPP 1
               P  PY Y SPPPP Y          SPPPPY Y+SPPPP
Sbjct: 146 IYNSPPPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 188

 Score =  100 bits (249), Expect = 1e-19
 Identities = 63/128 (49%), Positives = 67/128 (52%), Gaps = 5/128 (3%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPP-VY- 352
           Y SPPPP VY  + PPP VY              SPPP  Y   SP  +Y SPPPP VY 
Sbjct: 328 YKSPPPPYVYNSL-PPPYVYN-------------SPPPPPYYSPSPTVNYKSPPPPYVYN 373

Query: 351 SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP 172
           SPP  PY+   P     SPPPPY Y+SPPPPP     Y SP       SPK  Y SPPPP
Sbjct: 374 SPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPP-----YYSP-------SPKITYKSPPPP 421

Query: 171 ---KKPYY 157
              K PYY
Sbjct: 422 YIYKTPYY 429

[48][TOP]
>UniRef100_Q2A9D1 Extensin-like region containing protein n=1 Tax=Brassica oleracea
           RepID=Q2A9D1_BRAOL
          Length = 543

 Score =  199 bits (506), Expect = 2e-49
 Identities = 108/201 (53%), Positives = 117/201 (58%), Gaps = 24/201 (11%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS-------PPPKVY-----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           Y+Y+SPPPP  Y P         PPP VY     PP YSP PKVY    PPP VY    P
Sbjct: 327 YVYNSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPPP 386

Query: 387 PYHYSSPPPPVYSPPKKPYHYSS-PPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHH 211
           P +YS  P  VY  P  PY YSS PPPP YSP P  +Y SPPP    PY YSSPPPP ++
Sbjct: 387 PPYYSPSPKMVYKSPPPPYVYSSPPPPPYYSPSPKVNYKSPPP----PYVYSSPPPPPYY 442

Query: 210 -VSPKPYYHSPPPPKKPYYYHSPPPPVY----------SPPPPYHYSSPPPPPKKPYYYH 64
             SPK  Y SPPP   PY + SPPPP +          SPPPPY YSSPPPP   PYY  
Sbjct: 443 SPSPKVNYKSPPP---PYVHSSPPPPPFYSPSPKAEYKSPPPPYVYSSPPPP---PYYSP 496

Query: 63  SPPPPVYSPPPPYHYTSPPPP 1
           SP     SPPPPY Y+SPPPP
Sbjct: 497 SPKVDYKSPPPPYVYSSPPPP 517

 Score =  197 bits (502), Expect = 4e-49
 Identities = 112/229 (48%), Positives = 119/229 (51%), Gaps = 52/229 (22%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS-------PPPKVY-----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           Y+YSSPPP   Y P         PPP VY     PP YSP PKV     PPP VY    P
Sbjct: 75  YIYSSPPPSSYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPP 134

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVY----------SPPPPYHYSSPPPP------- 259
           P +YS  P   Y  P  PY Y+SPPPP Y          SPPPPY YSSPPPP       
Sbjct: 135 PPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSP 194

Query: 258 ------PKKPYKYSSPPPPEHH-VSPKPYYHSPPPPKKPYYYHSPPPPVY---------- 130
                 P+ PY YSSPPPP ++  SPK  Y SPPP   PY Y SPPPP Y          
Sbjct: 195 KVEYKSPQPPYVYSSPPPPPYYSPSPKVDYKSPPP---PYVYSSPPPPPYYSPSPKVDYK 251

Query: 129 SPPPPYHYSSPPPP------PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           SPPPPY  SSPPPP      PK  Y    PPPP YSP P + Y SPPPP
Sbjct: 252 SPPPPYVCSSPPPPPYYSPSPKVDYKSPPPPPPYYSPSPKFEYKSPPPP 300

 Score =  196 bits (497), Expect = 2e-48
 Identities = 116/238 (48%), Positives = 122/238 (51%), Gaps = 61/238 (25%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPV------SP-PPKVY-----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           Y+YSSPPPP  Y P       SP PP VY     PP YSP PKV     PPP VY    P
Sbjct: 179 YVYSSPPPPPYYSPSPKVEYKSPQPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPP 238

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPP-VYSPPPPYHYSSPPPP--------------PK 253
           P +YS  P   Y  P  PY  SSPPPP  YSP P   Y SPPPP              P 
Sbjct: 239 PPYYSPSPKVDYKSPPPPYVCSSPPPPPYYSPSPKVDYKSPPPPPPYYSPSPKFEYKSPP 298

Query: 252 KPYKYSSPPPPEHH-VSPKPYYHSPPPPKKPYYYHSPPPPVY----------SPPPPYHY 106
            PY YSSPPPP ++  SPK  Y SPPP   PY Y+SPPPP Y          SPPPPY Y
Sbjct: 299 PPYVYSSPPPPPYYSPSPKVEYKSPPP---PYVYNSPPPPPYYSPSPKVDYKSPPPPYVY 355

Query: 105 SSPPPP-------------PKKPYYYHSPPPPVY----------SPPPPYHYTSPPPP 1
           SSPPPP             P  PY Y SPPPP Y          SPPPPY Y+SPPPP
Sbjct: 356 SSPPPPPYYSPSPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPPPP 413

 Score =  188 bits (478), Expect = 3e-46
 Identities = 113/239 (47%), Positives = 125/239 (52%), Gaps = 48/239 (20%)
 Frame = -3

Query: 573 LVSLTLPSLISANSYLYSSPPPPKVYPPV--------------------SPPPKV--YPP 460
           +V + + S I A +Y Y SPP  + YPPV                    SPPP+     P
Sbjct: 7   MVYVVVFSAIVAAAYPYESPPTTQKYPPVHKTKSPYPPKMNSPYYSAPPSPPPQYRRQGP 66

Query: 459 VYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPP-VY-SPPKKPYHYSSPPPPVYSPPPP 286
            Y+P PK Y   SPPP  Y   SP   Y SPPPP VY SPP  PY+  SP     SPPPP
Sbjct: 67  KYTPHPKPYIYSSPPPSSYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPP 126

Query: 285 YHYSSPPPP-------------PKKPYKYSSPPPPEHH-VSPKPYYHSPPPPKKPYYYHS 148
           Y YSSPPPP             P  PY Y+SPPPP ++  SPK  Y SPPP   PY Y S
Sbjct: 127 YVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKAEYKSPPP---PYVYSS 183

Query: 147 PPPPVY----------SPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           PPPP Y          SP PPY YSSPPPP   PYY  SP     SPPPPY Y+SPPPP
Sbjct: 184 PPPPPYYSPSPKVEYKSPQPPYVYSSPPPP---PYYSPSPKVDYKSPPPPYVYSSPPPP 239

 Score =  177 bits (449), Expect = 6e-43
 Identities = 98/179 (54%), Positives = 104/179 (58%), Gaps = 4/179 (2%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           Y SPPPP VY    PPP    P YSP PK+     PPP VY    PP +YS  P   Y  
Sbjct: 372 YKSPPPPYVYSS-PPPP----PYYSPSPKMVYKSPPPPYVYSSPPPPPYYSPSPKVNYKS 426

Query: 345 PKKPYHYSS-PPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPE-HHVSPKPYYHSPPPP 172
           P  PY YSS PPPP YSP P  +Y SPPP    PY +SSPPPP  +  SPK  Y SPPP 
Sbjct: 427 PPPPYVYSSPPPPPYYSPSPKVNYKSPPP----PYVHSSPPPPPFYSPSPKAEYKSPPP- 481

Query: 171 KKPYYYHS-PPPPVYSPPPPYHYSSPPPPPKKPYYYHS-PPPPVYSPPPPYHYTSPPPP 1
             PY Y S PPPP YSP P   Y SPPP    PY Y S PPPP YSP P  +Y SPPPP
Sbjct: 482 --PYVYSSPPPPPYYSPSPKVDYKSPPP----PYVYSSPPPPPYYSPSPKVYYKSPPPP 534

 Score =  126 bits (316), Expect = 2e-27
 Identities = 70/129 (54%), Positives = 73/129 (56%), Gaps = 2/129 (1%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           Y SPPPP VY    PPP    P YSP PKV     PPP V+    PP  YS  P   Y  
Sbjct: 424 YKSPPPPYVYSS-PPPP----PYYSPSPKVNYKSPPPPYVHSSPPPPPFYSPSPKAEYKS 478

Query: 345 PKKPYHYSS-PPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHH-VSPKPYYHSPPPP 172
           P  PY YSS PPPP YSP P   Y SPPP    PY YSSPPPP ++  SPK YY SPPPP
Sbjct: 479 PPPPYVYSSPPPPPYYSPSPKVDYKSPPP----PYVYSSPPPPPYYSPSPKVYYKSPPPP 534

Query: 171 KKPYYYHSP 145
             PY Y  P
Sbjct: 535 --PYVYKMP 541

 Score =  103 bits (257), Expect = 1e-20
 Identities = 56/112 (50%), Positives = 60/112 (53%), Gaps = 16/112 (14%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS-------PPPKVY-----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           Y+YSSPPPP  Y P         PPP V+     PP YSP PK      PPP VY    P
Sbjct: 431 YVYSSPPPPPYYSPSPKVNYKSPPPPYVHSSPPPPPFYSPSPKAEYKSPPPPYVYSSPPP 490

Query: 387 PYHYSSPPPPVYSPPKKPYHYSS-PPPPVYSPPPPYHYSSPPPPP---KKPY 244
           P +YS  P   Y  P  PY YSS PPPP YSP P  +Y SPPPPP   K PY
Sbjct: 491 PPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPPYVYKMPY 542

[49][TOP]
>UniRef100_B9GWA6 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9GWA6_POPTR
          Length = 202

 Score =  199 bits (506), Expect = 2e-49
 Identities = 114/222 (51%), Positives = 130/222 (58%), Gaps = 20/222 (9%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPP 427
           ++ T+  L V+  +++LP+  ++   L++SP        VSP P+    VY  PP     
Sbjct: 1   ISPTSIHLQVSTSTISLPA--TSIPLLFTSPAKE-----VSPTPRY---VYKSPP----- 45

Query: 426 VSPPPKVYPPVSPPYHYSSPPPP-VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP--- 259
              PP   PP  PPYHYSSPPPP +   P   Y Y SPPPP  SPPPPYHYSSPPPP   
Sbjct: 46  ---PPSPSPP--PPYHYSSPPPPPLKKSPPPSYVYKSPPPPSPSPPPPYHYSSPPPPKKS 100

Query: 258 PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPP 91
           P  PY Y SPPPP   +SP  +Y SPPPPKK    PY Y SPPPP  SPPPPYHYSSP P
Sbjct: 101 PPPPYVYKSPPPPSPSLSPPYHYSSPPPPKKSPPPPYIYKSPPPPSPSPPPPYHYSSPSP 160

Query: 90  PPKKP---YYYHSPPPP-------VY--SPPPPYHYTSPPPP 1
           P K P   Y Y SPPPP        Y  SPPPP H  SPPPP
Sbjct: 161 PKKSPPPLYIYKSPPPPSPSPPPPYYYKSPPPPTH--SPPPP 200

 Score =  171 bits (432), Expect = 6e-41
 Identities = 94/195 (48%), Positives = 107/195 (54%), Gaps = 35/195 (17%)
 Frame = -3

Query: 588 TLLVALVSLTLPSLISANS--------YLYSSPPPPKVYPPV-----SPPPKVYPPVYSP 448
           T  ++L + ++P L ++ +        Y+Y SPPPP   PP      SPPP   PP+   
Sbjct: 12  TSTISLPATSIPLLFTSPAKEVSPTPRYVYKSPPPPSPSPPPPYHYSSPPP---PPLKKS 68

Query: 447 PPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP---------------KKPYHYSSPP 313
           PP  Y   SPPP   P   PPYHYSSPPPP  SPP                 PYHYSSPP
Sbjct: 69  PPPSYVYKSPPPPS-PSPPPPYHYSSPPPPKKSPPPPYVYKSPPPPSPSLSPPYHYSSPP 127

Query: 312 PPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK----PYYY 154
           PP  SPPPPY Y SPPPP   P  PY YSSP PP+    P   Y SPPPP      PYYY
Sbjct: 128 PPKKSPPPPYIYKSPPPPSPSPPPPYHYSSPSPPKKSPPPLYIYKSPPPPSPSPPPPYYY 187

Query: 153 HSPPPPVYSPPPPYH 109
            SPPPP +SPPPPY+
Sbjct: 188 KSPPPPTHSPPPPYY 202

[50][TOP]
>UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH
          Length = 760

 Score =  198 bits (503), Expect = 3e-49
 Identities = 115/209 (55%), Positives = 121/209 (57%), Gaps = 20/209 (9%)
 Frame = -3

Query: 567  SLTLPSLISANSYLYSSPPPPKVYPPV-----SPPPKVYPPVYSPPPKVYPPVSPPPKVY 403
            +LT P   S    +YS PPPP   PPV      PPP   PPVYSPPP   PP  PPP VY
Sbjct: 422  TLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP-PPPPPPPPVY 480

Query: 402  --PPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKK---PYKY 238
              PP SPP     PPPPVYSPP  P     PPPPVYSPPPP  YSSPPPPP     P   
Sbjct: 481  SPPPPSPP----PPPPPVYSPPPPPP--PPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYC 534

Query: 237  SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPP---PPYHYSSPPP------PP 85
            + PPPP  H  P P + SPPPP+ PYYY SPPPP  SPP   PP  +S PPP      PP
Sbjct: 535  TRPPPPPPHSPPPPQF-SPPPPE-PYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPP 592

Query: 84   KKPYYYHSPPP-PVYSPPPPYHYTSPPPP 1
              P    SPPP PVYSPPPP     PPPP
Sbjct: 593  PPPTPVSSPPPTPVYSPPPPPPCIEPPPP 621

 Score =  195 bits (495), Expect = 3e-48
 Identities = 108/199 (54%), Positives = 118/199 (59%), Gaps = 22/199 (11%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP-PV 355
            Y YSSPPPP      SPPP   PP +SPPP +YP +SPPP       PP   SSPPP PV
Sbjct: 558  YYYSSPPPPHS----SPPPHSPPPPHSPPPPIYPYLSPPP-------PPTPVSSPPPTPV 606

Query: 354  YSPPKKPYHYSSPPPP---VYSPPPP---YHYSSPPPPPKKPYKYSSPPPPEHHVSPKPY 193
            YSPP  P     PPPP    YSPPPP    HYSSPPPP   P  YSSPPPP       P 
Sbjct: 607  YSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPP---PVYYSSPPPP-------PV 656

Query: 192  YHSPPPPKKPYYYHSPPPP---VYSPPP-PYHYSSPPPPPK---------KPYYYHSPPP 52
            Y+S PPP  P +Y SPPPP    +SPPP P HYSSPPPPP           P  +HSPPP
Sbjct: 657  YYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPP 716

Query: 51   PV--YSPPPPYHYTSPPPP 1
            P+  +SPPPP  + SPPPP
Sbjct: 717  PMVHHSPPPPVIHQSPPPP 735

 Score =  186 bits (472), Expect = 1e-45
 Identities = 103/193 (53%), Positives = 110/193 (56%), Gaps = 19/193 (9%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPP----PKVYPPVYSPPPKVY--PPVSPPPKVYPPVSPPYHYSSPPP 361
           S  P P V  P+ PP    P    P++S PP +   PP SPPP VY P  PP     PPP
Sbjct: 391 SVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPP----PPPP 446

Query: 360 PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSP 181
           PVYSPP  P     PPPPVYSPPPP     PPPPP  P  Y SPPPP     P P Y  P
Sbjct: 447 PVYSPPPPP--PPPPPPPVYSPPPP-----PPPPPPPPPVY-SPPPPSPPPPPPPVYSPP 498

Query: 180 PPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPK---KPYYY--------HSPPPPVYSPP 34
           PPP  P     PPPPVYSPPPP  YSSPPPPP     P Y         HSPPPP +SPP
Sbjct: 499 PPPPPP-----PPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPP 553

Query: 33  P--PYHYTSPPPP 1
           P  PY+Y+SPPPP
Sbjct: 554 PPEPYYYSSPPPP 566

 Score =  186 bits (472), Expect = 1e-45
 Identities = 104/199 (52%), Positives = 111/199 (55%), Gaps = 23/199 (11%)
 Frame = -3

Query: 528 LYSSPPPPKVY--PPV---SPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           L S PPP  ++  PP     PPP   PPVYSPPP   PP  PPP   PP  PP     PP
Sbjct: 407 LPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPP---PPPPPPPVYSPPPPPP---PPPP 460

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPP---------YHYSSPPPPPKKPYKYSSPPPPEH- 214
           PPVYSPP  P     PPPPVYSPPPP         Y    PPPPP  P  YS PPPP + 
Sbjct: 461 PPVYSPPPPPPP-PPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYS 519

Query: 213 ------HVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPP--PYHYSSPPPPPKKPYYYHSP 58
                   +P P Y + PPP  P   HSPPPP +SPPP  PY+YSSPPPP   P   HSP
Sbjct: 520 SPPPPPSPAPTPVYCTRPPPPPP---HSPPPPQFSPPPPEPYYYSSPPPPHSSP-PPHSP 575

Query: 57  PPPVYSPPPPYHYTSPPPP 1
           PPP   PPP Y Y SPPPP
Sbjct: 576 PPPHSPPPPIYPYLSPPPP 594

 Score =  151 bits (381), Expect = 5e-35
 Identities = 84/167 (50%), Positives = 92/167 (55%), Gaps = 21/167 (12%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKV-YPPVSPPPKVY---PPVSPPYHYSSPPPPV 355
            SSPPP  VY P  PPP + PP   PPP + Y P  PPP V+   PP  P Y+ S PPPPV
Sbjct: 599  SSPPPTPVYSPPPPPPCIEPP--PPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPV 656

Query: 354  Y---SPPKKPYHYSSPPPP---VYSPPP-PYHYSSPPPPPKKPYK----------YSSPP 226
            Y    PP  P HYSSPPPP    +SPPP P HYSSPPPPP  P +          +S PP
Sbjct: 657  YYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPP 716

Query: 225  PPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPP 85
            P  HH  P P  H  PPP  P  Y  P PPV        Y+SPPPPP
Sbjct: 717  PMVHHSPPPPVIHQSPPPPSP-EYEGPLPPVIG----VSYASPPPPP 758

 Score =  139 bits (350), Expect = 2e-31
 Identities = 79/164 (48%), Positives = 86/164 (52%), Gaps = 9/164 (5%)
 Frame = -3

Query: 465 PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP-PVYSPPKKPYHYSSPPPPVYSPPP 289
           PPV          VSP P V  P+ PP   S PPP P++S P      +SPPPP  SPPP
Sbjct: 379 PPVNCGSFSCGRSVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPT---LTSPPPP--SPPP 433

Query: 288 PYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYH 109
           P  YS PPPPP  P  YS PPPP            PPPP  P Y   PPPP   PPPP +
Sbjct: 434 PV-YSPPPPPPPPPPVYSPPPPP------------PPPPPPPVYSPPPPPPPPPPPPPVY 480

Query: 108 YSSPPPPPKKPYYYHS--------PPPPVYSPPPPYHYTSPPPP 1
              PP PP  P   +S        PPPPVYSPPPP  Y+SPPPP
Sbjct: 481 SPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPP 524

 Score =  122 bits (307), Expect = 2e-26
 Identities = 76/164 (46%), Positives = 83/164 (50%), Gaps = 31/164 (18%)
 Frame = -3

Query: 528  LYSSPPPPKVYPPVSPPPKVY------PPV--YS--PPPKVYPPVSPPPKVY---PPVSP 388
            +YS PPPP    P  PPP +       PPV  YS  PPP VY    PPP VY   PP  P
Sbjct: 606  VYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPP 665

Query: 387  PYHYSSPPPP---VYSPPKKPYHYSSPPPP--------------VY-SPPPPYHYSSPPP 262
            P HYSSPPPP    +SPP  P HYSSPPPP              V+ SPPPP  + SPPP
Sbjct: 666  PVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPP 725

Query: 261  PPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY 130
                P  + SPPP      P P Y  P PP     Y SPPPP +
Sbjct: 726  ----PVIHQSPPP------PSPEYEGPLPPVIGVSYASPPPPPF 759

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 37/94 (39%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = -3

Query: 534 SYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPV 355
           S ++ S PPP   PP +P  +      SPPP      SPPP       P  H+S PPP +
Sbjct: 685 SPVHYSSPPP---PPSAPCEE------SPPPAPVVHHSPPP-------PMVHHSPPPPVI 728

Query: 354 Y-SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPP 256
           + SPP     Y  P PPV        Y+SPPPPP
Sbjct: 729 HQSPPPPSPEYEGPLPPVIG----VSYASPPPPP 758

[51][TOP]
>UniRef100_Q9SPM1 Extensin-like protein n=1 Tax=Solanum lycopersicum
           RepID=Q9SPM1_SOLLC
          Length = 711

 Score =  196 bits (499), Expect = 1e-48
 Identities = 109/185 (58%), Positives = 119/185 (64%), Gaps = 12/185 (6%)
 Frame = -3

Query: 519 SPPPPKVYPP----VSPPPKVY----PPVYSPPPKVY---PPV-SPPPKVYPPVSPPYHY 376
           SPPPPK  PP     SPPP V+    PPV SPPP V+   PPV SPPP V+ P  PP   
Sbjct: 421 SPPPPKTLPPPPPKTSPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPPV-- 478

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
           +SPPPPV+SPP      +SPPPPV+SPPPP H  SPPPP       +SPPPP H  SP P
Sbjct: 479 ASPPPPVHSPPPP---VASPPPPVHSPPPPVH--SPPPP------VASPPPPVH--SPPP 525

Query: 195 YYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYT 16
             HSPPPP      HSPPPPV+SPPPP H S PPP    P   HSPPPPV+SPPPP H  
Sbjct: 526 PVHSPPPP-----VHSPPPPVHSPPPPVH-SPPPPVASPPPPVHSPPPPVHSPPPPVH-- 577

Query: 15  SPPPP 1
           SPPPP
Sbjct: 578 SPPPP 582

 Score =  195 bits (496), Expect = 2e-48
 Identities = 115/200 (57%), Positives = 124/200 (62%), Gaps = 24/200 (12%)
 Frame = -3

Query: 528 LYSSPPPPKVYPP----------VSPPPKVY----PPVYSPPPKVY---PPV-SPPPKVY 403
           ++S PPPP   PP           SPPP V+    PPV SPPP V+   PPV SPPP V+
Sbjct: 441 VHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVH 500

Query: 402 ---PPV-SPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYS 235
              PPV SPP   +SPPPPV+SPP  P H  SPPPPV+SPPPP H S PPP    P   +
Sbjct: 501 SPPPPVHSPPPPVASPPPPVHSPP-PPVH--SPPPPVHSPPPPVH-SPPPPVHSPPPPVA 556

Query: 234 SPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPP--KKPYYYHS 61
           SPPPP H  SP P  HSPPPP      HSPPPPV SPPPP H S PPPPP    P   HS
Sbjct: 557 SPPPPVH--SPPPPVHSPPPP-----VHSPPPPVASPPPPVH-SPPPPPPVASPPPPVHS 608

Query: 60  PPPPVYSPPPPYHYTSPPPP 1
           PPPPV SPPPP H  SPPPP
Sbjct: 609 PPPPVASPPPPVH--SPPPP 626

 Score =  193 bits (490), Expect = 1e-47
 Identities = 111/194 (57%), Positives = 119/194 (61%), Gaps = 21/194 (10%)
 Frame = -3

Query: 519  SPPPPKVYPP---VSPPPKVY---PPVYSPPPKVY---PPV-SPPPKVY---PPV-SPPY 382
            SPPPP   PP    SPPP V+   PPV+SPPP V+   PPV SPPP V+   PPV SPP 
Sbjct: 501  SPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVASPPP 560

Query: 381  HYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHH--- 211
               SPPPPV+SPP  P H  SPPPPV SPPPP H  SPPPPP      +SPPPP H    
Sbjct: 561  PVHSPPPPVHSPPP-PVH--SPPPPVASPPPPVH--SPPPPPP----VASPPPPVHSPPP 611

Query: 210  --VSPKPYYHSPPPP--KKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY 43
               SP P  HSPPPP    P   HSPPPPV+SPPPP H   PP     P    SPPPPV+
Sbjct: 612  PVASPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPPVASPPPALVFSPPPPVH 671

Query: 42   SPPPPYHYTSPPPP 1
            SPPPP    SPPPP
Sbjct: 672  SPPPPAPVMSPPPP 685

 Score =  191 bits (486), Expect = 3e-47
 Identities = 111/207 (53%), Positives = 119/207 (57%), Gaps = 22/207 (10%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPV---SPPPKVY---PPVYSPPPKVYPPVSPPPKVYPPV 394
            P + S    ++S PPPP   PP    SPPP V    PPV+SPPP V+ P  PPP   PP 
Sbjct: 461  PPVASPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPVHSP--PPPVASPP- 517

Query: 393  SPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEH 214
             PP H  SPPPPV+SPP  P H  SPPPPV+SPPPP H S PPP    P    SPPPP H
Sbjct: 518  -PPVH--SPPPPVHSPPP-PVH--SPPPPVHSPPPPVH-SPPPPVASPPPPVHSPPPPVH 570

Query: 213  H------------VSPKPYYHSPPPP----KKPYYYHSPPPPVYSPPPPYHYSSPPPPPK 82
                          SP P  HSPPPP      P   HSPPPPV SPPPP H S PPP   
Sbjct: 571  SPPPPVHSPPPPVASPPPPVHSPPPPPPVASPPPPVHSPPPPVASPPPPVH-SPPPPVAS 629

Query: 81   KPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             P   HSPPPPV+SPPPP H  SPPPP
Sbjct: 630  PPPPVHSPPPPVHSPPPPVH--SPPPP 654

 Score =  182 bits (461), Expect = 3e-44
 Identities = 98/176 (55%), Positives = 106/176 (60%), Gaps = 6/176 (3%)
 Frame = -3

Query: 510 PPKVYPPVSPPPKVYPPVYSPPPKVYPP----VSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
           PPK   P +P P   PP    PPK  PP     SPPP V+ P  PP   +SPPPPV+SPP
Sbjct: 407 PPKPSTPTTPKPNPSPP----PPKTLPPPPPKTSPPPPVHSPPPPP--VASPPPPVHSPP 460

Query: 342 KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP--K 169
                 +SPPPPV+SPPPP   S PPP    P   +SPPPP H  SP P  HSPPPP   
Sbjct: 461 PP---VASPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVH--SPPPPVHSPPPPVAS 515

Query: 168 KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            P   HSPPPPV+SPPPP H S PPP    P   HSPPPPV SPPPP H  SPPPP
Sbjct: 516 PPPPVHSPPPPVHSPPPPVH-SPPPPVHSPPPPVHSPPPPVASPPPPVH--SPPPP 568

 Score =  166 bits (420), Expect = 1e-39
 Identities = 95/176 (53%), Positives = 101/176 (57%), Gaps = 17/176 (9%)
 Frame = -3

Query: 519  SPPPPKVYPP---VSPPPKVY---PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPP 358
            SPPPP   PP    SPPP V+   PPV+SPPP V+ P  PPP   PP  PP H   PPPP
Sbjct: 543  SPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSP--PPPVASPP--PPVHSPPPPPP 598

Query: 357  VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPP 178
            V SPP  P H  SPPPPV SPPPP H S PPP    P    SPPPP H  SP P  HSPP
Sbjct: 599  VASPPP-PVH--SPPPPVASPPPPVH-SPPPPVASPPPPVHSPPPPVH--SPPPPVHSPP 652

Query: 177  PP---KKPYYYHSPPPPVYSPPPPYHYSSPPP--------PPKKPYYYHSPPPPVY 43
            PP     P    SPPPPV+SPPPP    SPPP        PP     Y SPPPP++
Sbjct: 653  PPVASPPPALVFSPPPPVHSPPPPAPVMSPPPPTFEDVALPPTLGSLYASPPPPIF 708

 Score =  151 bits (382), Expect = 4e-35
 Identities = 83/156 (53%), Positives = 90/156 (57%), Gaps = 8/156 (5%)
 Frame = -3

Query: 444 PKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPP 265
           PK  P    PPK   P +P  +  SPPPP   PP  P   +SPPPPV+SPPPP   S PP
Sbjct: 398 PKDPPKTVTPPKPSTPTTPKPN-PSPPPPKTLPPPPPK--TSPPPPVHSPPPPPVASPPP 454

Query: 264 PPPKKPYKYSSPPPPEHH------VSPKPYYHSPPPP--KKPYYYHSPPPPVYSPPPPYH 109
           P    P   +SPPPP H        SP P  HSPPPP    P   HSPPPPV+SPPPP  
Sbjct: 455 PVHSPPPPVASPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPV- 513

Query: 108 YSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            S PPP    P   HSPPPPV+SPPPP H  SPPPP
Sbjct: 514 ASPPPPVHSPPPPVHSPPPPVHSPPPPVH--SPPPP 547

 Score =  124 bits (311), Expect = 6e-27
 Identities = 72/148 (48%), Positives = 79/148 (53%), Gaps = 3/148 (2%)
 Frame = -3

Query: 435 YPPVSPP---PKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPP 265
           +P VS P    K +  VS        PP   +PPK     S+P  P  +P PP   + PP
Sbjct: 375 FPVVSKPVDCSKGHCGVSREGQSPKDPPKTVTPPKP----STPTTPKPNPSPPPPKTLPP 430

Query: 264 PPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPP 85
           PPPK     +SPPPP H   P P   SPPPP      HSPPPPV SPPPP H   PPP  
Sbjct: 431 PPPK-----TSPPPPVHSPPPPP-VASPPPP-----VHSPPPPVASPPPPVHSPPPPPVA 479

Query: 84  KKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             P   HSPPPPV SPPPP H  SPPPP
Sbjct: 480 SPPPPVHSPPPPVASPPPPVH--SPPPP 505

[52][TOP]
>UniRef100_Q9LJ64 Extensin protein-like n=1 Tax=Arabidopsis thaliana RepID=Q9LJ64_ARATH
          Length = 956

 Score =  196 bits (499), Expect = 1e-48
 Identities = 114/192 (59%), Positives = 125/192 (65%), Gaps = 16/192 (8%)
 Frame = -3

Query: 528  LYSSPPPPKVY---PPV-SPPPKVY---PPVYSPPPKVY----PPV-SPPPKVY---PPV 394
            ++S PPPP V+   PPV SPPP ++   PPVYSPPP V+    PPV SPPP V+   PPV
Sbjct: 644  VHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPV 703

Query: 393  -SPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPE 217
             SPP    SPPPPV+SPP  P H  SPPPPV SPPPP  +S PPP P     YS PPPP 
Sbjct: 704  HSPPPPVHSPPPPVHSPPP-PVH--SPPPPVQSPPPPPVFSPPPPAPI----YSPPPPPV 756

Query: 216  HHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSP 37
            H  SP P  HSPPPP      HSPPPPV+SPPPP H  SPPPP       HSPPPPV+SP
Sbjct: 757  H--SPPPPVHSPPPPP----VHSPPPPVHSPPPPVH--SPPPP------VHSPPPPVHSP 802

Query: 36   PPPYHYTSPPPP 1
            PPP    SPPPP
Sbjct: 803  PPPSPIYSPPPP 814

 Score =  179 bits (453), Expect = 2e-43
 Identities = 102/187 (54%), Positives = 112/187 (59%), Gaps = 15/187 (8%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPV-SPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            PP P      +  P+  PPV+SPPP   PPV SPPP V+ P  PP H  SPPPPVYSPP 
Sbjct: 626  PPSPSTEETKTTSPQS-PPVHSPPPP--PPVHSPPPPVFSP-PPPMH--SPPPPVYSPP- 678

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPP-PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK- 166
             P  +S PPPPV+SPPPP H  SPPPP    P    SPPPP H  SP P  HSPPPP + 
Sbjct: 679  -PPVHSPPPPPVHSPPPPVH--SPPPPVHSPPPPVHSPPPPVH--SPPPPVHSPPPPVQS 733

Query: 165  ----PYY--------YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYH 22
                P +        Y  PPPPV+SPPPP H   PPP    P   HSPPPPV+SPPPP H
Sbjct: 734  PPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVH 793

Query: 21   YTSPPPP 1
              SPPPP
Sbjct: 794  --SPPPP 798

 Score =  177 bits (449), Expect = 6e-43
 Identities = 104/186 (55%), Positives = 113/186 (60%), Gaps = 15/186 (8%)
 Frame = -3

Query: 519  SPPPPKVYPP---VSPPPKVY----PPVYSPPPKVY---PPV-SPPPKVY---PPV-SPP 385
            SPPPP   PP    SPPP V+    PPV+SPPP V+   PPV SPPP V+   PPV SPP
Sbjct: 662  SPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 721

Query: 384  YHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVS 205
                SPPPPV SPP  P     PP P+YSPPPP  +S PPP       +S PPPP H  S
Sbjct: 722  PPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPP------VHSPPPPPVH--S 773

Query: 204  PKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPY 25
            P P  HSPPPP      HSPPPPV+SPPPP H  SPPPP   P Y  SPPPPV+SPPP  
Sbjct: 774  PPPPVHSPPPP-----VHSPPPPVHSPPPPVH--SPPPP--SPIY--SPPPPVFSPPPKP 822

Query: 24   HYTSPP 7
                PP
Sbjct: 823  VTPLPP 828

 Score =  166 bits (419), Expect = 2e-39
 Identities = 98/197 (49%), Positives = 105/197 (53%), Gaps = 26/197 (13%)
 Frame = -3

Query: 513  PPPKVYPPVSPPPKV-YPPVYSPPP---------KVYPPVSPPP-----KVYPPVSPPYH 379
            PP +  PP +  PK+  PP+ SP P         K   P  P P     K   P SPP H
Sbjct: 586  PPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVH 645

Query: 378  YSSPPPPVYSPP----KKPYHYSSPPPPVYSPPPPYH------YSSPPPP-PKKPYKYSS 232
               PPPPV+SPP      P    SPPPPVYSPPPP H        SPPPP    P    S
Sbjct: 646  SPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHS 705

Query: 231  PPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPP 52
            PPPP H  SP P  HSPPPP      HSPPPPV SPPPP  +S PPP P     Y  PPP
Sbjct: 706  PPPPVH--SPPPPVHSPPPP-----VHSPPPPVQSPPPPPVFSPPPPAP----IYSPPPP 754

Query: 51   PVYSPPPPYHYTSPPPP 1
            PV+SPPPP H  SPPPP
Sbjct: 755  PVHSPPPPVH--SPPPP 769

 Score =  146 bits (368), Expect = 2e-33
 Identities = 88/194 (45%), Positives = 98/194 (50%), Gaps = 23/194 (11%)
 Frame = -3

Query: 513  PPPKVYPPVSPPPKVYPPVYSPPPKVYPP-VSPPPKVYPPVSPPYHYSS-----PPPPVY 352
            PP +  P     PK  PP    PPK   P +  PP   P  + PY  S      P PP  
Sbjct: 570  PPKQETPKPEESPKPQPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQPPSP 629

Query: 351  SP-------PKKPYHYSSPPPPVYSPPPPYHYSSPPP---PPKKPYK-----YSSPPPPE 217
            S        P+ P  +S PPPP    PPP  +S PPP   PP   Y      +S PPPP 
Sbjct: 630  STEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPV 689

Query: 216  HHVSPKPYYHSPPPP--KKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY 43
            H  SP P  HSPPPP    P   HSPPPPV+SPPPP H  SPPPP + P     PPPPV+
Sbjct: 690  H--SPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVH--SPPPPVQSP-----PPPPVF 740

Query: 42   SPPPPYHYTSPPPP 1
            SPPPP    SPPPP
Sbjct: 741  SPPPPAPIYSPPPP 754

 Score =  140 bits (354), Expect = 6e-32
 Identities = 85/194 (43%), Positives = 96/194 (49%), Gaps = 22/194 (11%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYP-PVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            PP P+  P   PP +  P P  SP P+     +P P+  P   PP   +  P P  SP  
Sbjct: 527  PPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQET--PKPEESPKP 584

Query: 339  KPYHYSSPP---------PPVYSPPP--PYHYS-------SPPPPPKKPYKYSSPP-PPE 217
            +P     PP         PP+ SP P  PY  S        PP P  +  K +SP  PP 
Sbjct: 585  QPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPV 644

Query: 216  HHVSPKPYYHSPPPP--KKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY 43
            H   P P  HSPPPP    P   HSPPPPVYSPPPP H   PPP    P   HSPPPPV+
Sbjct: 645  HSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVH 704

Query: 42   SPPPPYHYTSPPPP 1
            SPPPP H  SPPPP
Sbjct: 705  SPPPPVH--SPPPP 716

 Score =  102 bits (253), Expect = 3e-20
 Identities = 80/228 (35%), Positives = 87/228 (38%), Gaps = 56/228 (24%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYP--PVYSPPPKVYP-PVSPPPKVYPPVSPPYHYSS--PPPPVY 352
            P  PK   P +  PK  P  P    P +  P P  P PK   P SP    S   PP P  
Sbjct: 465  PESPKQESPKTEQPKPKPESPKQESPKQEAPKPEQPKPK---PESPKQESSKQEPPKPEE 521

Query: 351  SP---PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPK---KPYKYSSP-------PPPEHH 211
            SP   P KP     P PP    P P     P PP +   KP +   P       P PE  
Sbjct: 522  SPKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEES 581

Query: 210  VSPKPYYHSPPPPKKPYYYHSPP------------------------------------- 142
              P+P     PP  +     SPP                                     
Sbjct: 582  PKPQPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQPPSPSTEETKTTSPQS 641

Query: 141  PPVYSPPPPYHYSSPPPPP-KKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            PPV+SPPPP    SPPPP    P   HSPPPPVYSPPPP H  SPPPP
Sbjct: 642  PPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVH--SPPPP 687

 Score = 97.4 bits (241), Expect = 8e-19
 Identities = 80/212 (37%), Positives = 96/212 (45%), Gaps = 36/212 (16%)
 Frame = -3

Query: 528  LYSSPPPPKVYPPV---SPPPKVYPPVYSPPPKVY---PPV-SPPPKVYPPVSPPYHYSS 370
            +YS PPPP   PP    SPPP   PPV+SPPP V+   PPV SPPP V+ P  PP H  S
Sbjct: 748  IYSPPPPPVHSPPPPVHSPPP---PPVHSPPPPVHSPPPPVHSPPPPVHSP-PPPVH--S 801

Query: 369  PPP--PVYSPPKKPYHYSSPPPPVYSPPPPYH--YSSPPPPPKKPYKYSSP-----PPPE 217
            PPP  P+YSPP  P  +S PP PV   PP      ++P P   +  + S+P     P  E
Sbjct: 802  PPPPSPIYSPP--PPVFSPPPKPVTPLPPATSPMANAPTPSSSESGEISTPVQAPTPDSE 859

Query: 216  HHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPP-----P 52
               +P    HSP     P       P V +P P        P   +     SPP     P
Sbjct: 860  DIEAPSDSNHSPVFKSSPAPSPDSEPEVEAPVPSSEPEVEAPKQSEATPSSSPPSSNPSP 919

Query: 51   PVYSPP------------PP---YHYTSPPPP 1
             V +PP            PP   + Y SPPPP
Sbjct: 920  DVTAPPSEDNDDGDNFILPPNIGHQYASPPPP 951

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 80/248 (32%), Positives = 87/248 (35%), Gaps = 74/248 (29%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPP----PKVYPPVSPPPKVYPPV---------SPPY 382
            S P P +   P  P PK   P + P     PK   P    PK   P          SP  
Sbjct: 433  SKPKPEESPKPQQPSPKPETPSHEPSNPKEPKPESPKQESPKTEQPKPKPESPKQESPKQ 492

Query: 381  HYSSPPPPVYSP--PKKPYHYSSPPPPVYSP---PPPYHYSSPPPPPK----KPYKYSSP 229
                P  P   P  PK+      PP P  SP   PP    S  P PPK    KP +   P
Sbjct: 493  EAPKPEQPKPKPESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKP 552

Query: 228  PPPEHHVSPKPYYH-SPPPPK----KPYYYHSPPPPVYSPPP------------------ 118
             PP+   +PKP     P PPK    KP     P PP    PP                  
Sbjct: 553  QPPKQ-ETPKPEESPKPQPPKQETPKPEESPKPQPPKQEQPPKTEAPKMGSPPLESPVPN 611

Query: 117  -PYHYS----------------------------SPPPPPKKPYYYHSPPPPVYSPPPPY 25
             PY  S                            SPPPPP      HSPPPPV+SPPPP 
Sbjct: 612  DPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPP----VHSPPPPVFSPPPPM 667

Query: 24   HYTSPPPP 1
            H  SPPPP
Sbjct: 668  H--SPPPP 673

 Score = 71.2 bits (173), Expect = 6e-11
 Identities = 59/185 (31%), Positives = 67/185 (36%), Gaps = 11/185 (5%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPK--VYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
           S+P P     P +P PK  + PP    P K  P  SP P+   P         P  P + 
Sbjct: 405 SNPSPKPTPTPKAPEPKKEINPPNLEEPSKPKPEESPKPQQPSP--------KPETPSHE 456

Query: 348 P--PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPP 175
           P  PK+P     P  P    P        P  PK+       P PE    PKP    P  
Sbjct: 457 PSNPKEP----KPESPKQESPKTEQPKPKPESPKQESPKQEAPKPEQ---PKP---KPES 506

Query: 174 PKKPYYYHSPPPPVYSP---PPPYHYSSPPPPPK----KPYYYHSPPPPVYSPPPPYHYT 16
           PK+      PP P  SP   PP    S  P PPK    KP     P PP    P P    
Sbjct: 507 PKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESP 566

Query: 15  SPPPP 1
            P PP
Sbjct: 567 KPQPP 571

 Score = 71.2 bits (173), Expect = 6e-11
 Identities = 57/175 (32%), Positives = 72/175 (41%), Gaps = 16/175 (9%)
 Frame = -3

Query: 519  SPPPPKVYPPV---SPPPKVYPP-----VYSPPPKVY-PPVSP----PPKVYPPVSPPYH 379
            SPPPP   PP    SPPP V+ P     +YSPPP V+ PP  P    PP   P  + P  
Sbjct: 780  SPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAPTP 839

Query: 378  YSSPPPPVYSPPKKPYHYSSP-PPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSP 202
             SS    + +P + P   S     P  S   P   SSP P P    +  +P P       
Sbjct: 840  SSSESGEISTPVQAPTPDSEDIEAPSDSNHSPVFKSSPAPSPDSEPEVEAPVPSSEPEVE 899

Query: 201  KPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPP--PPPKKPYYYHSPPPPVY 43
             P      P   P    +P P V +PP   +        PP   + Y SPPPP++
Sbjct: 900  APKQSEATPSSSP-PSSNPSPDVTAPPSEDNDDGDNFILPPNIGHQYASPPPPMF 953

[53][TOP]
>UniRef100_Q2A9D2 Extensin-like region containing protein n=1 Tax=Brassica oleracea
           RepID=Q2A9D2_BRAOL
          Length = 347

 Score =  196 bits (499), Expect = 1e-48
 Identities = 111/223 (49%), Positives = 118/223 (52%), Gaps = 46/223 (20%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPV-------SPPPKVY-----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           Y+YSSPPPP  Y P         PPP +Y     PP YSP PK      PPP VY    P
Sbjct: 105 YVYSSPPPPPYYSPSLKVEYKSPPPPYLYNSPPPPPYYSPSPKAEYKSPPPPYVYSYPPP 164

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVY----------SPPPPYHYSSPPPPP------ 256
           P +YS  P   Y  P  PY YSSPPPP Y          S PPPY Y+SPPPPP      
Sbjct: 165 PPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSQPPPYVYNSPPPPPYYSPLP 224

Query: 255 -------KKPYKYSSPPPPEHHV-SPKPYYHSPPPPKKPYYYHSPPPPVY---------- 130
                    PY YSSPPPP ++  SPK  Y SPPPP   Y Y SPPPP Y          
Sbjct: 225 KVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPP---YVYSSPPPPPYYSPSPKVDYK 281

Query: 129 SPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           SPPPPY YSSPPPPP   YY  SP     SPPPPY Y+SPPPP
Sbjct: 282 SPPPPYVYSSPPPPP---YYSPSPKVDYKSPPPPYVYSSPPPP 321

 Score =  189 bits (481), Expect = 1e-46
 Identities = 108/216 (50%), Positives = 115/216 (53%), Gaps = 39/216 (18%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS-------PPPKVY-----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           YLY+SPPPP  Y P         PPP VY     PP YSP PKV     PPP VY    P
Sbjct: 131 YLYNSPPPPPYYSPSPKAEYKSPPPPYVYSYPPPPPYYSPSPKVEYKSPPPPYVYSSPPP 190

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVY----------SPPPPYHYSSPPPPP------ 256
           P +YS  P   Y     PY Y+SPPPP Y          SPPPPY YSSPPPPP      
Sbjct: 191 PPYYSPSPKVEYKSQPPPYVYNSPPPPPYYSPLPKVEYKSPPPPYVYSSPPPPPYYSPSP 250

Query: 255 -------KKPYKYSSPPPPEHHV-SPKPYYHSPPPPKKPYYYHS--PPPPVYSPPPPYHY 106
                    PY YSSPPPP ++  SPK  Y SPPPP    Y +S  PPPP YSP P   Y
Sbjct: 251 KVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPP----YVYSSPPPPPYYSPSPKVDY 306

Query: 105 SSPPPPPKKPYYYHS-PPPPVYSPPPPYHYTSPPPP 1
            SPPP    PY Y S PPPP YSP P  +Y SPPPP
Sbjct: 307 KSPPP----PYVYSSPPPPPYYSPSPKVYYKSPPPP 338

 Score =  181 bits (459), Expect = 4e-44
 Identities = 107/234 (45%), Positives = 114/234 (48%), Gaps = 57/234 (24%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVY 352
           Y+YSSPP               PP YSP PKV     PPP VY    PP +YS      Y
Sbjct: 79  YVYSSPP--------------LPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSLKVEY 124

Query: 351 SPPKKPYHYSSPPPPVY----------SPPPPYHYSSPPPP-------------PKKPYK 241
             P  PY Y+SPPPP Y          SPPPPY YS PPPP             P  PY 
Sbjct: 125 KSPPPPYLYNSPPPPPYYSPSPKAEYKSPPPPYVYSYPPPPPYYSPSPKVEYKSPPPPYV 184

Query: 240 YSSPPPPEHH-VSPKPYYHSPPPPKKPYYYHSPPPPVY----------SPPPPYHYSSPP 94
           YSSPPPP ++  SPK  Y S PP   PY Y+SPPPP Y          SPPPPY YSSPP
Sbjct: 185 YSSPPPPPYYSPSPKVEYKSQPP---PYVYNSPPPPPYYSPLPKVEYKSPPPPYVYSSPP 241

Query: 93  PP-------------PKKPYYYHSPPPPVY----------SPPPPYHYTSPPPP 1
           PP             P  PY Y SPPPP Y          SPPPPY Y+SPPPP
Sbjct: 242 PPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 295

 Score =  125 bits (313), Expect = 4e-27
 Identities = 68/139 (48%), Positives = 73/139 (52%), Gaps = 25/139 (17%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS-------PPPKVY-----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           Y+Y+SPPPP  Y P+        PPP VY     PP YSP PKV     PPP VY    P
Sbjct: 209 YVYNSPPPPPYYSPLPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPP 268

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVY----------SPPPPYHYSSPPPPP---KKP 247
           P +YS  P   Y  P  PY YSSPPPP Y          SPPPPY YSSPPPPP     P
Sbjct: 269 PPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSP 328

Query: 246 YKYSSPPPPEHHVSPKPYY 190
             Y   PPP  +V  KPYY
Sbjct: 329 KVYYKSPPPPPYVYKKPYY 347

[54][TOP]
>UniRef100_Q39600 Extensin n=1 Tax=Catharanthus roseus RepID=Q39600_CATRO
          Length = 217

 Score =  196 bits (498), Expect = 1e-48
 Identities = 118/220 (53%), Positives = 132/220 (60%), Gaps = 31/220 (14%)
 Frame = -3

Query: 585 LLVALVSLTLPSLISANSYLYSSPPPPKVY----PPV-SPPPKVYPPVYS-----PPPKV 436
           L++ALV+L LPS  +A+ Y YSSPPPP  Y    PPV SPPP   PPVY      PPP +
Sbjct: 8   LVIALVALCLPSQTTAD-YKYSSPPPPYHYSSPPPPVHSPPP---PPVYKYKSPPPPPPI 63

Query: 435 YPPVSPPPKVY---PPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPP--VYSPPPPYHYSS 271
           +    PPP VY   PP  P Y Y SPPPP       PY Y SPPPP  +Y  PPP  Y S
Sbjct: 64  HKSPPPPPYVYKSPPPPPPVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIYKSPPPPVYKS 123

Query: 270 PPPPPKKPYKYSSPPPPE------HHV-SPKPY-YHSPPPPKKPYYYHSPPPPVY-SPPP 118
           PPPP K PY Y SPPPP       HH+   KPY Y SPPPP  P+ + SPPPPVY SPPP
Sbjct: 124 PPPP-KNPYVYKSPPPPPPVYKYLHHLHQKKPYVYKSPPPP--PFVHKSPPPPVYKSPPP 180

Query: 117 P---YHYSSPPPPPKKPYYYHSPPPPVY----SPPPPYHY 19
           P   Y Y SPPPPP     + SPPPP +    SPPPP+HY
Sbjct: 181 PKKPYVYKSPPPPPP---IHKSPPPPYHYYYSSPPPPHHY 217

 Score =  147 bits (372), Expect = 5e-34
 Identities = 83/139 (59%), Positives = 85/139 (61%), Gaps = 11/139 (7%)
 Frame = -3

Query: 384 YHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPP--YHYSSPPPPPKKPYKYSSPPPPEHH 211
           Y YSSPPPP        YHYSSPPPPV+SPPPP  Y Y SPPPPP     + SPPPP   
Sbjct: 25  YKYSSPPPP--------YHYSSPPPPVHSPPPPPVYKYKSPPPPPPI---HKSPPPP--- 70

Query: 210 VSPKPY-YHSPPPPKKPYYYHSPPPPVYSPP----PPYHYSSPPPPPKKPYYYHSPPPPV 46
               PY Y SPPPP   Y Y SPPPP   PP    PPY Y SPPPPP     Y SPPPPV
Sbjct: 71  ----PYVYKSPPPPPPVYKYKSPPPP---PPVHKYPPYIYKSPPPPPP---IYKSPPPPV 120

Query: 45  Y-SPPP---PYHYTSPPPP 1
           Y SPPP   PY Y SPPPP
Sbjct: 121 YKSPPPPKNPYVYKSPPPP 139

 Score =  109 bits (273), Expect = 2e-22
 Identities = 58/110 (52%), Positives = 61/110 (55%), Gaps = 21/110 (19%)
 Frame = -3

Query: 267 PPPPKKPYKYSSPPPPEHHVSPKPYYHSPP---------PPKKPYYYHSPPPPVY---SP 124
           P      YKYSSPPPP H+ SP P  HSPP         PP  P  + SPPPP Y   SP
Sbjct: 18  PSQTTADYKYSSPPPPYHYSSPPPPVHSPPPPPVYKYKSPPPPPPIHKSPPPPPYVYKSP 77

Query: 123 PPP---YHYSSPPPPPK----KPYYYHS--PPPPVYSPPPPYHYTSPPPP 1
           PPP   Y Y SPPPPP      PY Y S  PPPP+Y  PPP  Y SPPPP
Sbjct: 78  PPPPPVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIYKSPPPPVYKSPPPP 127

[55][TOP]
>UniRef100_Q9STN0 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STN0_ARATH
          Length = 437

 Score =  195 bits (495), Expect = 3e-48
 Identities = 116/225 (51%), Positives = 122/225 (54%), Gaps = 40/225 (17%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSP-----PPKVYPPVYSPPPKVYPPVSPPPKVYPPVS 391
           P +  +  Y+YSSPPP    PP SP     PP VY    SPPP  Y   SPPP  Y   S
Sbjct: 54  PYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYS---SPPPYAY---SPPPSPYVYKS 107

Query: 390 PPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPP----PPKKPYKYSSPP- 226
           PPY YSSPPP  YSPP  PY Y SPP  VYS PPPY YSSPPP    PP  PY YS PP 
Sbjct: 108 PPYVYSSPPPYAYSPPPSPYVYKSPPY-VYSSPPPYVYSSPPPYAYSPP--PYAYSPPPS 164

Query: 225 ------PPEHHVSPKPYYHSPPP-----PKKPYYYHSPPPPVYSPP-------------- 121
                 PP  + SP PY +SPPP        PY Y SPPP  YSPP              
Sbjct: 165 PYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPYAYSPPPSPYVYK 224

Query: 120 -PPYHYSSPPP----PPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            PPY YSSPPP    PP  PY Y S PP VYS PPPY Y+ PP P
Sbjct: 225 SPPYVYSSPPPYAYSPPPSPYVYKS-PPYVYSSPPPYAYSPPPSP 268

 Score =  194 bits (494), Expect = 4e-48
 Identities = 120/235 (51%), Positives = 124/235 (52%), Gaps = 50/235 (21%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVY--PPV---SPPPKVYPP-----VYSPPPKVY---PPV--S 421
           P   S   Y YS PP P VY  PP    SPPP  Y P     VY  PP VY   PP   S
Sbjct: 204 PYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYS 263

Query: 420 PPPKVYPPVSPPYHYSSPPPPVYSPP-------KKPYHYSSPPPPVYSPP--------PP 286
           PPP  Y   SPPY YSSPPP  YSPP         PY YSSPPP  YSPP        PP
Sbjct: 264 PPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPP 323

Query: 285 YHYSSPPP----PPKKPYKYSSPPPPEHHVSPKPYYHSPPP-----PKKPYYYHSPPPPV 133
           Y YSSPPP    PP  PY Y S  PP  + SP PY +SPPP        PY Y SPPP  
Sbjct: 324 YVYSSPPPYAYSPPPSPYVYKS--PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYT 381

Query: 132 YSPPPPYHYSSPPPPP----KKPYYYHSPPPPVYSPP-------PPYHYTSPPPP 1
           YS PPPY YS PPP P      PY Y SPPP VY+PP       P Y Y+SPPPP
Sbjct: 382 YS-PPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPPSPSYSYSSPPPP 435

 Score =  189 bits (479), Expect = 2e-46
 Identities = 118/244 (48%), Positives = 124/244 (50%), Gaps = 59/244 (24%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSP-----PPKVY----PPVYSPPPKVYPPVSPPPKVY 403
           P +  +  Y+YSSPPP    PP SP     PP VY    P  YSPPP  Y   SPP    
Sbjct: 78  PYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYS 137

Query: 402 PPVSPPYHYSSPPPPVYSPP--------------KKPYHYSSPPPPVYSPPP-------- 289
            P  PPY YSSPPP  YSPP                PY YSSPPP  YSPPP        
Sbjct: 138 SP--PPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSP 195

Query: 288 PYHYSSPPP----PPKKPYKYSSPP-------PPEHHVSPKPYYHSPPP-----PKKPYY 157
           PY YSSPPP    PP  PY YS PP       PP  + SP PY +SPPP        PY 
Sbjct: 196 PYVYSSPPPYAYSPP--PYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYV 253

Query: 156 YHSPPPPVYSPP--------PPYHYSSPPP----PPKKPYYYHSPPPPVYSPPPPYHYTS 13
           Y SPPP  YSPP        PPY YSSPPP    PP  PY Y S PP VYS PPPY Y+ 
Sbjct: 254 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKS-PPYVYSSPPPYAYSP 312

Query: 12  PPPP 1
           PP P
Sbjct: 313 PPSP 316

 Score =  187 bits (476), Expect = 5e-46
 Identities = 120/236 (50%), Positives = 126/236 (53%), Gaps = 51/236 (21%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSP-----PPKVY----PPVYSPPPKVY-PPVSP---- 418
           P +  +  Y+YSSPPP    PP SP     PP VY    P  YSPPP  Y PP SP    
Sbjct: 165 PYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPYAYSPPPSPYVYK 224

Query: 417 -PPKVYPPVSPPYHYSSPPPP-VYSPPKKPYHYSSPPPPVYSPP--------PPYHYSSP 268
            PP VY    PPY YS PP P VY  P  PY YSSPPP  YSPP        PPY YSSP
Sbjct: 225 SPPYVYSS-PPPYAYSPPPSPYVYKSP--PYVYSSPPPYAYSPPPSPYVYKSPPYVYSSP 281

Query: 267 PP----PPKKPYKYSSPPPPEHHVSPKPYYHSPPP-----PKKPYYYHSPPPPVYSPP-- 121
           PP    PP  PY Y S  PP  + SP PY +SPPP        PY Y SPPP  YSPP  
Sbjct: 282 PPYAYSPPPSPYVYKS--PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPS 339

Query: 120 ------PPYHYSSPPP----PPKKPYYYHSPPPPVYSPPPPYHYT------SPPPP 1
                 PPY YSSPPP    PP  PY Y S PP VYS PPPY Y+      SPPPP
Sbjct: 340 PYVYKSPPYVYSSPPPYAYSPPPSPYVYKS-PPYVYSSPPPYTYSPPPYAYSPPPP 394

 Score =  185 bits (470), Expect = 2e-45
 Identities = 99/172 (57%), Positives = 102/172 (59%), Gaps = 6/172 (3%)
 Frame = -3

Query: 498 YPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSS 319
           Y P SPPP VY    SPPP  Y   SPPP  Y   SPPY YSSPPP  YSPP  PY Y S
Sbjct: 30  YSPPSPPPYVYS---SPPPYTY---SPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKS 83

Query: 318 PPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHS 148
            PP VYS PPPY YS PP P      PY YSSPPP  +   P PY +  P    PY Y S
Sbjct: 84  -PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSP----PYVYSS 138

Query: 147 PPPPVYSPPPPYHYSSPP---PPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           PPP VYS PPPY YS PP    PP  PY Y S PP VYS PPPY Y+ PP P
Sbjct: 139 PPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKS-PPYVYSSPPPYAYSPPPSP 189

 Score =  183 bits (465), Expect = 9e-45
 Identities = 104/199 (52%), Positives = 111/199 (55%), Gaps = 28/199 (14%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSP-----PPKVY----PPVYSPPPKVY---------- 433
           P +  +  Y+YSSPPP    PP SP     PP VY    P  YSPPP  Y          
Sbjct: 244 PYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYS 303

Query: 432 --PPV--SPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPP 265
             PP   SPPP  Y   SPPY YSSPPP  YSPP  PY Y S PP VYS PPPY YS PP
Sbjct: 304 SPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKS-PPYVYSSPPPYAYSPPP 362

Query: 264 PP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPP 94
            P      PY YSSPPP  +  SP PY +SPPPP    Y   PPP VYS PPPY Y+ PP
Sbjct: 363 SPYVYKSPPYVYSSPPP--YTYSPPPYAYSPPPPCPDVY--KPPPYVYSSPPPYVYNPPP 418

Query: 93  --PPPKKPYYYHSPPPPVY 43
             PPP   Y Y SPPPP+Y
Sbjct: 419 SSPPPSPSYSYSSPPPPIY 437

 Score =  182 bits (461), Expect = 3e-44
 Identities = 113/216 (52%), Positives = 117/216 (54%), Gaps = 39/216 (18%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSP-----PPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYH 379
           Y+YSSPPP    PP SP     PP VY    P  YSPPP  Y   SPP     P  PPY 
Sbjct: 38  YVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSP--PPYA 95

Query: 378 YSSPPPP-VYSPPKKPYHYSSPPPPVYSPPP-PYHYSSPP----PPPKKPYKYSSPPPPE 217
           YS PP P VY  P  PY YSSPPP  YSPPP PY Y SPP     PP  PY YSSPPP  
Sbjct: 96  YSPPPSPYVYKSP--PYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPP--PYVYSSPPP-- 149

Query: 216 HHVSPKPYYHSPPP-----PKKPYYYHSPPPPVYSPP--------PPYHYSSPPP----- 91
           +  SP PY +SPPP        PY Y SPPP  YSPP        PPY YSSPPP     
Sbjct: 150 YAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSP 209

Query: 90  ------PPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                 PP  PY Y S PP VYS PPPY Y+ PP P
Sbjct: 210 PPYAYSPPPSPYVYKS-PPYVYSSPPPYAYSPPPSP 244

 Score =  180 bits (456), Expect = 1e-43
 Identities = 112/224 (50%), Positives = 123/224 (54%), Gaps = 28/224 (12%)
 Frame = -3

Query: 588 TLLVALVSLTLPSLISANSYLYSSP-PPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPP 412
           +LL+ +++L   +  ++  Y YS P PPP VY   SPPP  Y    SPPP  Y   SPP 
Sbjct: 9   SLLMVILALYAVAAHTSAQYPYSPPSPPPYVYS--SPPPYTY----SPPPSPYVYKSPPY 62

Query: 411 KVYPPVSPPYHYSSPPPP-VYSPPKKPYHYSSPPPPVYSPP--------PPYHYSSPPP- 262
               P  PPY YS PP P VY  P  PY YSSPPP  YSPP        PPY YSSPPP 
Sbjct: 63  VYSSP--PPYAYSPPPSPYVYKSP--PYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPY 118

Query: 261 ---PPKKPYKYSSP------PPPEHHVSPKPYYHSPP-----PPKKPYYYHSPPPPVYSP 124
              PP  PY Y SP      PPP  + SP PY +SPP     PP  PY Y S PP VYS 
Sbjct: 119 AYSPPPSPYVYKSPPYVYSSPPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKS-PPYVYSS 177

Query: 123 PPPYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           PPPY YS PP P      PY Y SPPP  YS PPPY Y+ PP P
Sbjct: 178 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYS-PPPYAYSPPPSP 220

[56][TOP]
>UniRef100_Q8LK15 Extensin n=1 Tax=Brassica napus RepID=Q8LK15_BRANA
          Length = 259

 Score =  194 bits (494), Expect = 4e-48
 Identities = 130/259 (50%), Positives = 137/259 (52%), Gaps = 55/259 (21%)
 Frame = -3

Query: 612 SLMASTTFTLLVALVSLTLPSLISANSYLYSSPPPP-KVYPPVSPPPKVY----PPVYS- 451
           S +AS   +LLV  +S       S  +Y YSSPPPP K Y   SPPP V     P VY  
Sbjct: 3   SPVASFAASLLVLTISPLTSVYQSTANYFYSSPPPPVKHYEYKSPPPPVMHYSLPQVYHS 62

Query: 450 -PPPKVY-----PPVSPPPKVYPPV---SPP-----YHYSSPPPPV--YS--PPKKPYHY 325
            PPPK +     PP  PP K Y P    SPP     Y Y SPPPPV  YS  PP K Y Y
Sbjct: 63  PPPPKKHTVNKSPP--PPVKQYSPPWLRSPPPPRKDYVYKSPPPPVKQYSSPPPNKYYVY 120

Query: 324 SSPPPPV---------YSPPPP---YHYSSPPPP--------------PKKPYKYSSPPP 223
            SPPPPV         +SPPPP   Y Y SPPPP              PKK Y Y SPPP
Sbjct: 121 QSPPPPVKHYSPPSVYHSPPPPKNQYVYKSPPPPVKHYTPPVYHSGPPPKKHYMYKSPPP 180

Query: 222 PEHHVSPKPYYHSPPPPKKPYYYHSPPPPV--YSPPPPYHYSSPPPPPKKPYYYHSPPPP 49
           P  H S    YHSPPPPKK Y Y SPPPPV  YSP   YH    PPPPKK Y Y SPPPP
Sbjct: 181 PVMHYSLPQVYHSPPPPKKHYVYKSPPPPVKHYSPRLVYH---SPPPPKKKYVYKSPPPP 237

Query: 48  VYSPPPPYH---YTSPPPP 1
           V    PP+H   Y SPPPP
Sbjct: 238 VRHYFPPHHLYLYKSPPPP 256

 Score =  162 bits (411), Expect = 2e-38
 Identities = 93/173 (53%), Positives = 97/173 (56%), Gaps = 18/173 (10%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY---PPVSPPYHYSSPPP 361
           Y+Y SPPPP V    SPPP  Y    SPPP V      PP VY   PP    Y Y SPPP
Sbjct: 97  YVYKSPPPP-VKQYSSPPPNKYYVYQSPPPPVKH--YSPPSVYHSPPPPKNQYVYKSPPP 153

Query: 360 PVYS----------PPKKPYHYSSPPPPV--YSPPPPYHYSSPPPPPKKPYKYSSPPPPE 217
           PV            PPKK Y Y SPPPPV  YS P  YH    PPPPKK Y Y SPPPP 
Sbjct: 154 PVKHYTPPVYHSGPPPKKHYMYKSPPPPVMHYSLPQVYH---SPPPPKKHYVYKSPPPPV 210

Query: 216 HHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYH---YSSPPPPPKKPYYY 67
            H SP+  YHSPPPPKK Y Y SPPPPV    PP+H   Y SPPP    PY+Y
Sbjct: 211 KHYSPRLVYHSPPPPKKKYVYKSPPPPVRHYFPPHHLYLYKSPPP----PYHY 259

[57][TOP]
>UniRef100_Q38913 Extensin-1 n=1 Tax=Arabidopsis thaliana RepID=EXTN1_ARATH
          Length = 373

 Score =  194 bits (494), Expect = 4e-48
 Identities = 107/202 (52%), Positives = 112/202 (55%), Gaps = 26/202 (12%)
 Frame = -3

Query: 528 LYSSPPPPKVY---PPV--SPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           +Y SPPPP  +   PPV  SPPP V     PPVY  PP      SPPP    P  P  HY
Sbjct: 126 VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVKHY 185

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPY-HYSSP-----PPPPKKPYK----YSSPP 226
           S  PPPVY  P  P  Y SPPP   SPPPP  HYS P     PPPP K Y     Y SPP
Sbjct: 186 S--PPPVYKSPPPPVKYYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPP 243

Query: 225 PPEHHVSPKPYYHSPPPP----KKPYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYY 67
           PP H+  P   YHSPPPP      P  YHSPPPPV+  PPP  Y SPPPP      P  Y
Sbjct: 244 PPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVY 303

Query: 66  HSPPPPVYSPPPPYHYTSPPPP 1
           HSPPPPV+  PPP  Y SPPPP
Sbjct: 304 HSPPPPVHYSPPPVVYHSPPPP 325

 Score =  192 bits (489), Expect = 1e-47
 Identities = 125/240 (52%), Positives = 130/240 (54%), Gaps = 45/240 (18%)
 Frame = -3

Query: 588 TLLVALVSLTLPSLISANSYLYSSPPPPKVY---PPV--SPPPKVY----PPVYSPPPKV 436
           + LV   SL   S  +AN Y YSSPPPP  +   PPV  SPPP V     PPVY  PP  
Sbjct: 3   SFLVLAFSLAFVSQTTAN-YFYSSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 61

Query: 435 YPPVSPPPKVY----PPV---SPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPY-H 280
               SPPP VY    PPV   SPP  Y SPPPPVY  P  P  + SPPP   SPPPP  H
Sbjct: 62  VKHYSPPP-VYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKH 120

Query: 279 YSSPP-----PPPKKPYK----YSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYS 127
           YS PP     PPP K Y     Y SPPPP  H SP P Y SPPPP K   Y+SPPP   S
Sbjct: 121 YSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVK---YYSPPPVYKS 177

Query: 126 PPPPY-HYSSPP----PPPKKPYY-----YHSPPPPV--------Y-SPPPPYHYTSPPP 4
           PPPP  HYS PP    PPP   YY     Y SPPPPV        Y SPPPP  Y SPPP
Sbjct: 178 PPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPP 237

 Score =  191 bits (485), Expect = 4e-47
 Identities = 114/216 (52%), Positives = 116/216 (53%), Gaps = 40/216 (18%)
 Frame = -3

Query: 528 LYSSPPPPKVY---PPV--SPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           +Y SPPPP  Y   PPV  SPPP V     PPVY  PP      SPPP    P  P  HY
Sbjct: 158 VYKSPPPPVKYYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVKHY 217

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPP------PPP----KKPYKYSSPP 226
           S  PPPVY  P  P  Y SPPP   SPPPP HYS PP      PPP      P  Y SPP
Sbjct: 218 S--PPPVYKSPPPPVKYYSPPPVYKSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPP 275

Query: 225 PPEHHVSPKPYYHSPPPP----KKPYYYHSPPPPV--------Y-SPPPP---YHYSSPP 94
           PP H+  P   YHSPPPP      P  YHSPPPPV        Y SPPPP   Y Y SPP
Sbjct: 276 PPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPKKHYEYKSPP 335

Query: 93  PPP--KKPYYYHSPPPPV--YSPP-PPYHYTSPPPP 1
           PP     P  YHSPPPPV  YSPP  PY Y SPPPP
Sbjct: 336 PPVHYSPPTVYHSPPPPVHHYSPPHQPYLYKSPPPP 371

 Score =  189 bits (481), Expect = 1e-46
 Identities = 115/216 (53%), Positives = 120/216 (55%), Gaps = 40/216 (18%)
 Frame = -3

Query: 528 LYSSPPPPKVY---PPV--SPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           +Y SPPPP  +   PPV  SPPP V     PPVY  PP      SPPP VY    PP  Y
Sbjct: 142 VYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVKHYSPPP-VYKSPPPPVKY 200

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVY-SPPPPY-HYSSPP----PPP-----KKPYKYSSP 229
            SPPP   SPP    HYS  PPPVY SPPPP  +YS PP    PPP       P  Y SP
Sbjct: 201 YSPPPVYKSPPPPVKHYS--PPPVYKSPPPPVKYYSPPPVYKSPPPPVHYSPPPVVYHSP 258

Query: 228 PPPEHHVSPKPYYHSPPPP----KKPYYYHSPPPPV---------YSPPPPYHYSSP--- 97
           PPP H+  P   YHSPPPP      P  YHSPPPPV         +SPPPP HYS P   
Sbjct: 259 PPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVV 318

Query: 96  ---PPPPKKPYYYHSPPPPV-YSPPPPYHYTSPPPP 1
              PPPPKK Y Y SPPPPV YSPP  YH  SPPPP
Sbjct: 319 YHSPPPPKKHYEYKSPPPPVHYSPPTVYH--SPPPP 352

 Score =  186 bits (472), Expect = 1e-45
 Identities = 104/188 (55%), Positives = 108/188 (57%), Gaps = 26/188 (13%)
 Frame = -3

Query: 528 LYSSPPPPKVY---PPV--SPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           +Y SPPPP  Y   PPV  SPPP V     PPVY  PP      SPPP VY    PP HY
Sbjct: 190 VYKSPPPPVKYYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPP-VYKSPPPPVHY 248

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPP------PPP----KKPYKYSSPP 226
           S PPP VY  P  P HYS PP   +SPPPP HYS PP      PPP      P  Y SPP
Sbjct: 249 S-PPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPP 307

Query: 225 PPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV-YSPPPPYHYSSPPP------PPKKPYYY 67
           PP H+  P   YHSPPPPKK Y Y SPPPPV YSPP  YH  SPPP      PP +PY Y
Sbjct: 308 PPVHYSPPPVVYHSPPPPKKHYEYKSPPPPVHYSPPTVYH--SPPPPVHHYSPPHQPYLY 365

Query: 66  HSPPPPVY 43
            SPPPP Y
Sbjct: 366 KSPPPPHY 373

 Score =  142 bits (359), Expect = 2e-32
 Identities = 86/142 (60%), Positives = 87/142 (61%), Gaps = 14/142 (9%)
 Frame = -3

Query: 384 YHYSSPPPPV--YSPPKKPYHYSSPPPPV--YSPPPPYHYSSPPPPPKK---PYKYSSPP 226
           Y YSSPPPPV  YSPP     Y SPPPPV  YSPPP Y   SPPPP K    P  Y SPP
Sbjct: 21  YFYSSPPPPVKHYSPPPV---YKSPPPPVKHYSPPPVY--KSPPPPVKHYSPPPVYKSPP 75

Query: 225 PPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV--YSPPPPYHYSSPPPPPK---KPYYYHS 61
           PP  + SP P Y SPPPP     Y SPPPPV  YSPPP   Y SPPPP K    P  Y S
Sbjct: 76  PPVKYYSPPPVYKSPPPP----VYKSPPPPVKHYSPPPV--YKSPPPPVKHYSPPPVYKS 129

Query: 60  PPPPV--YSPPPPYHYTSPPPP 1
           PPPPV  YSPPP   Y SPPPP
Sbjct: 130 PPPPVKHYSPPPV--YKSPPPP 149

[58][TOP]
>UniRef100_Q94ES8 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES8_PEA
          Length = 195

 Score =  193 bits (490), Expect = 1e-47
 Identities = 111/220 (50%), Positives = 123/220 (55%), Gaps = 15/220 (6%)
 Frame = -3

Query: 615 RSLMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKV 436
           RSLMAS + TL +A++  + PS ISAN Y YSSPPPP               V+SPPP  
Sbjct: 2   RSLMASASLTLALAILFFSFPSEISANQYSYSSPPPP---------------VHSPPP-- 44

Query: 435 YPPVSPPPKVYPPVSPPYHYSSPPPP---VYSPPKKPYHYSSPPPPVYS---PPPPYHYS 274
                  PK       PYHYSSPPPP    Y  P   YH  SPPPPV++   P P YH  
Sbjct: 45  -------PK------DPYHYSSPPPPPVHTYPHPHPVYH--SPPPPVHTYPHPHPVYHSP 89

Query: 273 SPPPPPKKPYKYSSPPPPEHHVSPKPY--YHSPPPP-KKPYYYHSPPPP---VYSPPPPY 112
            PP P KKPYKY SPPPP  H  P P+  YHSPPPP KKPY Y SPPPP    Y  P P 
Sbjct: 90  PPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPV 149

Query: 111 HYSSPPPPPKKPY---YYHSPPPPVYSPPPPYHYTSPPPP 1
           ++S PPP    P+    YHSPPPP      PY Y SPPPP
Sbjct: 150 YHSPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPP 189

[59][TOP]
>UniRef100_P13983 Extensin n=1 Tax=Nicotiana tabacum RepID=EXTN_TOBAC
          Length = 620

 Score =  191 bits (486), Expect = 3e-47
 Identities = 101/189 (53%), Positives = 109/189 (57%), Gaps = 14/189 (7%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVY--PPVYSPPPKVYPPV------SPPPKVYPPVSPPYHYSS 370
           YS  PPP   P  SPPP  Y  PP YSPPP  Y P+      SPPP VY P  PP +  S
Sbjct: 305 YSPSPPPTPTPTFSPPPPAYSPPPTYSPPPPTYLPLPSSPIYSPPPPVYSPPPPPSY--S 362

Query: 369 PPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPP---PPEHHVSPK 199
           PPPP Y PP  P   SSPPPP +SPPPP +  SPPPPP       +PP   PP    SP 
Sbjct: 363 PPPPTYLPPPPP---SSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPPTYSPPPPTYSPP 419

Query: 198 PYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPP---PPKKPYYYHSPPPPVYSPPPP 28
           P  ++ PPP  P Y  SPPPP YSPPPP  YS PPP   PP   Y    PPPP YSPPPP
Sbjct: 420 PPTYAQPPPLPPTY--SPPPPAYSPPPPPTYSPPPPTYSPPPPAYAQPPPPPPTYSPPPP 477

Query: 27  YHYTSPPPP 1
            +  SPPPP
Sbjct: 478 AY--SPPPP 484

 Score =  181 bits (459), Expect = 4e-44
 Identities = 98/186 (52%), Positives = 104/186 (55%), Gaps = 13/186 (6%)
 Frame = -3

Query: 519 SPPPPKVYP----PV-SPPPKVY----PPVYSPPPKVY----PPVSPPPKVYPPVSPPYH 379
           SPPPP   P    P+ SPPP VY    PP YSPPP  Y    PP SPPP  + P  P Y 
Sbjct: 331 SPPPPTYLPLPSSPIYSPPPPVYSPPPPPSYSPPPPTYLPPPPPSSPPPPSFSPPPPTYE 390

Query: 378 YSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPK 199
            S PPPP YSPP       SPPPP YSPPPP +   PP PP     YS PPP        
Sbjct: 391 QSPPPPPAYSPPLPAPPTYSPPPPTYSPPPPTYAQPPPLPP----TYSPPPPA------- 439

Query: 198 PYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHY 19
              +SPPPP  P Y  SPPPP YSPPPP +   PPPPP      +SPPPP YSPPPP   
Sbjct: 440 ---YSPPPP--PTY--SPPPPTYSPPPPAYAQPPPPPPT-----YSPPPPAYSPPPPSPI 487

Query: 18  TSPPPP 1
            SPPPP
Sbjct: 488 YSPPPP 493

 Score =  181 bits (458), Expect = 6e-44
 Identities = 102/211 (48%), Positives = 111/211 (52%), Gaps = 36/211 (17%)
 Frame = -3

Query: 525 YSSPPP-----PKVYPPVSPPPKVYPP-----VYSPPPKVY---PPVSPPPKVYPP---V 394
           YS PPP     P+  P  SPPP  Y P     +YSPPP  Y   PP +P P   PP    
Sbjct: 265 YSPPPPAYAQSPQPSPTYSPPPPTYSPPPPSPIYSPPPPAYSPSPPPTPTPTFSPPPPAY 324

Query: 393 SPPYHYSSPPP--------PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKY 238
           SPP  YS PPP        P+YSPP  P  YS PPPP YSPPPP +   PPP    P  +
Sbjct: 325 SPPPTYSPPPPTYLPLPSSPIYSPP--PPVYSPPPPPSYSPPPPTYLPPPPPSSPPPPSF 382

Query: 237 SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYH---------YSSPPP-- 91
           S PPP      P P  +SPP P  P Y  SPPPP YSPPPP +         YS PPP  
Sbjct: 383 SPPPPTYEQSPPPPPAYSPPLPAPPTY--SPPPPTYSPPPPTYAQPPPLPPTYSPPPPAY 440

Query: 90  -PPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            PP  P Y  SPPPP YSPPPP +   PPPP
Sbjct: 441 SPPPPPTY--SPPPPTYSPPPPAYAQPPPPP 469

 Score =  175 bits (444), Expect = 2e-42
 Identities = 93/197 (47%), Positives = 99/197 (50%), Gaps = 24/197 (12%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVY---PPVYSPPPKVY-------PPVSPPPKVYPPVSPPYHYSS 370
           SPPPP  Y P  P P  Y   PP YSPPP  Y       P  SPPP  Y P  PP +  S
Sbjct: 392 SPPPPPAYSPPLPAPPTYSPPPPTYSPPPPTYAQPPPLPPTYSPPPPAYSPPPPPTY--S 449

Query: 369 PPPPVYSPPKKPYHYS-------SPPPPVYSPPPPYHYSSPPPPPKKPY--KYSSPPPPE 217
           PPPP YSPP   Y          SPPPP YSPPPP    SPPPP  +P    +S PPP  
Sbjct: 450 PPPPTYSPPPPAYAQPPPPPPTYSPPPPAYSPPPPSPIYSPPPPQVQPLPPTFSPPPPRR 509

Query: 216 HHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP-----PKKPYYYHSPPP 52
            H+ P P  H  P P  P Y   P PP +SPPPP    SPPPP        P Y   P P
Sbjct: 510 IHLPPPP--HRQPRPPTPTYGQPPSPPTFSPPPPRQIHSPPPPHWQPRTPTPTYGQPPSP 567

Query: 51  PVYSPPPPYHYTSPPPP 1
           P +S PPP    SPPPP
Sbjct: 568 PTFSAPPPRQIHSPPPP 584

 Score =  163 bits (413), Expect = 9e-39
 Identities = 94/208 (45%), Positives = 104/208 (50%), Gaps = 33/208 (15%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVY-----------------PPVYSPPPKVYPPVSP----PPK 409
           YS PPP  V P  SPP + +                 PP + P P  + P SP     P 
Sbjct: 204 YSPPPPTHVQPTPSPPSRGHQPQPPTHRHAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPP 263

Query: 408 VYPPVSPPYHYS-------SPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKK 250
            Y P  P Y  S       SPPPP YSPP        PP P+YSPPPP +  SPPP P  
Sbjct: 264 TYSPPPPAYAQSPQPSPTYSPPPPTYSPP--------PPSPIYSPPPPAYSPSPPPTPTP 315

Query: 249 PYKYSSPPPPEHHVSPKPYYHSPPP-----PKKPYYYHSPPPPVYSPPPPYHYSSPPPPP 85
            +   SPPPP +  SP P Y  PPP     P  P Y  SPPPPVYSPPPP  YS PPP  
Sbjct: 316 TF---SPPPPAY--SPPPTYSPPPPTYLPLPSSPIY--SPPPPVYSPPPPPSYSPPPPTY 368

Query: 84  KKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             P    SPPPP +SPPPP +  SPPPP
Sbjct: 369 LPPPPPSSPPPPSFSPPPPTYEQSPPPP 396

 Score =  162 bits (409), Expect = 3e-38
 Identities = 97/212 (45%), Positives = 102/212 (48%), Gaps = 42/212 (19%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVY-------PPVSPPPKVYPPVSPPYHYSSPPPPV 355
           P P  + P SP  +  PP YSPPP  Y       P  SPPP  Y P  PP    SPPPP 
Sbjct: 246 PSPLRHLPPSPRRQPQPPTYSPPPPAYAQSPQPSPTYSPPPPTYSP-PPPSPIYSPPPPA 304

Query: 354 YSP--PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYK-----------YSSPPPPEH 214
           YSP  P  P    SPPPP YSPPP Y   SPPPP   P             YS PPPP +
Sbjct: 305 YSPSPPPTPTPTFSPPPPAYSPPPTY---SPPPPTYLPLPSSPIYSPPPPVYSPPPPPSY 361

Query: 213 HVSPKPYYHSPPPPKKPYYYHSPPPPVY--SPPPPYHYS---------SPPPP---PKKP 76
              P  Y   PPP   P    SPPPP Y  SPPPP  YS         SPPPP   P  P
Sbjct: 362 SPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPPTYSPPPPTYSPPPP 421

Query: 75  YY--------YHSPPPPVYSPPPPYHYTSPPP 4
            Y         +SPPPP YSPPPP  Y+ PPP
Sbjct: 422 TYAQPPPLPPTYSPPPPAYSPPPPPTYSPPPP 453

 Score =  161 bits (408), Expect = 4e-38
 Identities = 92/193 (47%), Positives = 103/193 (53%), Gaps = 19/193 (9%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPP-VYSPPPK--VYPPVSPPPKVYPPVSPPYHYSSPPPPV 355
           Y+ PPP  +Y   SP P+V PP  YSPPP   V P  SPP + + P  PP H  +PP   
Sbjct: 183 YAQPPPTPIY---SPSPQVQPPPTYSPPPPTHVQPTPSPPSRGHQP-QPPTHRHAPPTHR 238

Query: 354 YSPPKK---------PYHYSSPPPPVYSPPPPYHYSSPPPPP--KKPYKYSSPPPPEHHV 208
           ++PP           P     P PP YSPPPP +  SP P P    P    SPPPP    
Sbjct: 239 HAPPTHQPSPLRHLPPSPRRQPQPPTYSPPPPAYAQSPQPSPTYSPPPPTYSPPPPSPIY 298

Query: 207 SPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP-----PKKPYYYHSPPPPVY 43
           SP P  +SP PP  P    SPPPP YSPPP Y   SPPPP     P  P Y  SPPPPVY
Sbjct: 299 SPPPPAYSPSPPPTPTPTFSPPPPAYSPPPTY---SPPPPTYLPLPSSPIY--SPPPPVY 353

Query: 42  SPPPPYHYTSPPP 4
           SPPPP  Y+ PPP
Sbjct: 354 SPPPPPSYSPPPP 366

 Score =  144 bits (363), Expect = 6e-33
 Identities = 90/226 (39%), Positives = 96/226 (42%), Gaps = 38/226 (16%)
 Frame = -3

Query: 564  LTLPSLISANSYLYSSPPPPKVYPP-----VSPPPKVY----PPVYSPPPKVYPPVSPPP 412
            L  P   S     YS PPP    PP      SPPP  Y    PP YSPPP  Y P  PPP
Sbjct: 403  LPAPPTYSPPPPTYSPPPPTYAQPPPLPPTYSPPPPAYSPPPPPTYSPPPPTYSP--PPP 460

Query: 411  KVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPP------PVYSPPPPYHYSSPPPP--- 259
                P  PP  YS PPPP YSPP     YS PPP      P +SPPPP     PPPP   
Sbjct: 461  AYAQPPPPPPTYS-PPPPAYSPPPPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQ 519

Query: 258  ------------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV 133
                              P  P +  SPPPP          H  P    P Y   P PP 
Sbjct: 520  PRPPTPTYGQPPSPPTFSPPPPRQIHSPPPP----------HWQPRTPTPTYGQPPSPPT 569

Query: 132  YSPPPPYHYSSPPPPPKKPYYYHSPPPPVYS--PPPPYHYTSPPPP 1
            +S PPP    SPPPP ++P     PP P Y   P PP  Y+ P PP
Sbjct: 570  FSAPPPRQIHSPPPPHRQP----RPPTPTYGQPPSPPTTYSPPSPP 611

 Score =  124 bits (310), Expect = 8e-27
 Identities = 87/243 (35%), Positives = 110/243 (45%), Gaps = 45/243 (18%)
 Frame = -3

Query: 600 STTFTLLVALVSLTLPSLISANS------YL----YSSPPP------PKVYPPVSPPPK- 472
           ST F L++ L S  + SL++A +      YL     S PPP      P   P  +PP + 
Sbjct: 4   STLFALVLLLQSTAILSLVAAEATTQYGGYLPPPVTSQPPPSSIGLSPPSAPTTTPPSRG 63

Query: 471 -VYPPVYSPPPKVYPPVS----PPPKVYPP-----VSPPYHYSSPPPPVYSPPKKPYHYS 322
            V  P ++PP   YPP S    PP    PP     + P   ++ PP PV SP   P  Y 
Sbjct: 64  HVPSPRHAPPRHAYPPPSHGHLPPSVGGPPPHRGHLPPSRGFNPPPSPVISPSHPPPSYG 123

Query: 321 SPPP-------PVYS--PPPPYHYSSP------PPPPKKPYKYSSPPPPEHHVSPKPYYH 187
           +PPP       P +   PP P H  +P      PP  + P  +  P PP  H  P P  +
Sbjct: 124 APPPSHGPGHLPSHGQRPPSPSHGHAPPSGGHTPPRGQHPPSHRRPSPPSRHGHPPPPTY 183

Query: 186 SPPPPKKPYYYHSP---PPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYT 16
           + PPP  P Y  SP   PPP YSPPPP H    P PP +    H P PP +   PP H  
Sbjct: 184 AQPPP-TPIYSPSPQVQPPPTYSPPPPTHVQPTPSPPSRG---HQPQPPTHRHAPPTHRH 239

Query: 15  SPP 7
           +PP
Sbjct: 240 APP 242

 Score =  113 bits (282), Expect = 1e-23
 Identities = 62/158 (39%), Positives = 74/158 (46%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           YS PPP  +Y P  P  +  PP +SPP        PP +++ P  PP+    PP P Y  
Sbjct: 479 YSPPPPSPIYSPPPPQVQPLPPTFSPP--------PPRRIHLP-PPPHRQPRPPTPTYGQ 529

Query: 345 PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
           P        P PP +SPPPP    SPPPP  +P      P P +   P P   S PPP++
Sbjct: 530 P--------PSPPTFSPPPPRQIHSPPPPHWQP----RTPTPTYGQPPSPPTFSAPPPRQ 577

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPP 52
               HSPPPP   P PP      PP P   Y   SPPP
Sbjct: 578 ---IHSPPPPHRQPRPPTPTYGQPPSPPTTYSPPSPPP 612

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 42/106 (39%), Positives = 48/106 (45%), Gaps = 2/106 (1%)
 Frame = -3

Query: 315 PPPVYSPPPPYHYS-SPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPP 139
           PPPV S PPP     SPP  P      ++PP   H  SP+   H+PP    P   H   P
Sbjct: 35  PPPVTSQPPPSSIGLSPPSAPT-----TTPPSRGHVPSPR---HAPPRHAYPPPSHGHLP 86

Query: 138 PVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPP-PPYHYTSPPP 4
           P    PPP+    PP     P     PP PV SP  PP  Y +PPP
Sbjct: 87  PSVGGPPPHRGHLPPSRGFNP-----PPSPVISPSHPPPSYGAPPP 127

[60][TOP]
>UniRef100_Q8H9E1 Extensin (Fragment) n=1 Tax=Solanum tuberosum RepID=Q8H9E1_SOLTU
          Length = 152

 Score =  189 bits (481), Expect = 1e-46
 Identities = 102/179 (56%), Positives = 108/179 (60%), Gaps = 4/179 (2%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           Y SPPPP    P  PPP VY    SPPP   P  SPPP        PY+Y SPPPP  SP
Sbjct: 1   YKSPPPPS---PSLPPPYVYK---SPPP---PSPSPPP--------PYYYKSPPPPSPSP 43

Query: 345 PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
           P  PY+Y SPPPP  SPPPPY+Y SPPPPP     Y SPPPP +       Y SPPPP  
Sbjct: 44  PP-PYYYKSPPPPSPSPPPPYYYKSPPPPPPV---YKSPPPPVYK------YKSPPPPVY 93

Query: 165 PYYYHSPPPPVY---SPPPP-YHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            Y    PPPPVY   SPPPP Y Y SPPPP    Y Y SPPPPV+  P PY+YTSPPPP
Sbjct: 94  KYKSPPPPPPVYKYKSPPPPVYKYKSPPPPV---YKYKSPPPPVHKSPAPYYYTSPPPP 149

 Score =  159 bits (401), Expect = 2e-37
 Identities = 86/156 (55%), Positives = 92/156 (58%), Gaps = 8/156 (5%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           Y+Y SPPPP    P  PPP  Y    PP  SPPP  Y    PPP   PP  PPY+Y SPP
Sbjct: 15  YVYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPP--PPYYYKSPP 69

Query: 363 PPVYSPPKKPYHYSSPPPPVY---SPPPP-YHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
           PP       P  Y SPPPPVY   SPPPP Y Y SPPPPP   YKY SPPPP +      
Sbjct: 70  PP-------PPVYKSPPPPVYKYKSPPPPVYKYKSPPPPP-PVYKYKSPPPPVYK----- 116

Query: 195 YYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP 88
            Y SPPPP   Y Y SPPPPV+  P PY+Y+SPPPP
Sbjct: 117 -YKSPPPP--VYKYKSPPPPVHKSPAPYYYTSPPPP 149

 Score =  123 bits (309), Expect = 1e-26
 Identities = 74/135 (54%), Positives = 76/135 (56%), Gaps = 20/135 (14%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVY---PPVSPPPKVYPP 397
           PS      Y Y SPPPP    P  PPP  Y    PP  SPPP  Y   PP  PPP VY  
Sbjct: 23  PSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPP--PPPPVYKS 77

Query: 396 VSPP-YHYSSPPPPVY---SPPKKP--YHYSSPPPPVY---SPPPP-YHYSSPPPPPKK- 250
             PP Y Y SPPPPVY   SPP  P  Y Y SPPPPVY   SPPPP Y Y SPPPP  K 
Sbjct: 78  PPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKS 137

Query: 249 --PYKYSSPPPPEHH 211
             PY Y+SPPPP H+
Sbjct: 138 PAPYYYTSPPPPSHY 152

[61][TOP]
>UniRef100_B9GF15 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GF15_POPTR
          Length = 152

 Score =  189 bits (479), Expect = 2e-46
 Identities = 100/175 (57%), Positives = 106/175 (60%), Gaps = 5/175 (2%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
           +Y SPPPP   PP   PP +Y    SPPP   PP SPPP         Y Y SPPPP  S
Sbjct: 1   MYKSPPPPSTSPP---PPYIYK---SPPPP--PPSSPPP---------YIYKSPPPPSPS 43

Query: 348 PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
           PP  PY Y SPPPP  SPPPPY Y SPPPPP  P    SPPPP  + SP P   SPPP  
Sbjct: 44  PPP-PYVYMSPPPPSPSPPPPYIYKSPPPPPPPP--SPSPPPPYVYKSPPPPSPSPPP-- 98

Query: 168 KPYYYHSPPPPVYSPPPPYHYSSPPPPPKK-----PYYYHSPPPPVYSPPPPYHY 19
            PY Y+SPPPP  SPPPPY Y+SPPPPP       PY Y SPPPP  SPPPP +Y
Sbjct: 99  -PYVYNSPPPPSPSPPPPYVYNSPPPPPSSPSPPPPYIYKSPPPPSPSPPPPPYY 152

 Score =  179 bits (453), Expect = 2e-43
 Identities = 92/148 (62%), Positives = 94/148 (63%), Gaps = 8/148 (5%)
 Frame = -3

Query: 420 PPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKK 250
           PPP   PP  PPY Y SPPPP  S P  PY Y SPPPP  SPPPPY Y SPPPP   P  
Sbjct: 6   PPPSTSPP--PPYIYKSPPPPPPSSP-PPYIYKSPPPPSPSPPPPYVYMSPPPPSPSPPP 62

Query: 249 PYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP---PKK 79
           PY Y SPPPP     P P   SPPP   PY Y SPPPP  SPPPPY Y+SPPPP   P  
Sbjct: 63  PYIYKSPPPP-----PPPPSPSPPP---PYVYKSPPPPSPSPPPPYVYNSPPPPSPSPPP 114

Query: 78  PYYYHSPPPPVY--SPPPPYHYTSPPPP 1
           PY Y+SPPPP    SPPPPY Y SPPPP
Sbjct: 115 PYVYNSPPPPPSSPSPPPPYIYKSPPPP 142

 Score =  158 bits (399), Expect = 4e-37
 Identities = 86/160 (53%), Positives = 91/160 (56%), Gaps = 10/160 (6%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y+Y SPPPP   PP SPPP +Y    PP  SPPP       PPP   PP  P
Sbjct: 8   PSTSPPPPYIYKSPPPP---PPSSPPPYIYKSPPPPSPSPPPPYVYMSPPPPSPSPP--P 62

Query: 387 PYHYSSPPPPVYSP---PKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPP 226
           PY Y SPPPP   P   P  PY Y SPPPP  SPPPPY Y+SPPPP   P  PY Y+SPP
Sbjct: 63  PYIYKSPPPPPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYNSPPPPSPSPPPPYVYNSPP 122

Query: 225 PPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHY 106
           PP       P   SPPP   PY Y SPPPP  SPPPP +Y
Sbjct: 123 PP-------PSSPSPPP---PYIYKSPPPPSPSPPPPPYY 152

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 39/55 (70%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = -3

Query: 156 YHSPPPPVYSPPPPYHYSSPPP-PPKK--PYYYHSPPPPVYSPPPPYHYTSPPPP 1
           Y SPPPP  SPPPPY Y SPPP PP    PY Y SPPPP  SPPPPY Y SPPPP
Sbjct: 2   YKSPPPPSTSPPPPYIYKSPPPPPPSSPPPYIYKSPPPPSPSPPPPYVYMSPPPP 56

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 44/76 (57%), Positives = 45/76 (59%), Gaps = 12/76 (15%)
 Frame = -3

Query: 192 YHSPPPPKKPYYYHSPPPP-VY-SPPPPYH-------YSSPPPP---PKKPYYYHSPPPP 49
           Y SPPPP       SPPPP +Y SPPPP         Y SPPPP   P  PY Y SPPPP
Sbjct: 2   YKSPPPPST-----SPPPPYIYKSPPPPPPSSPPPYIYKSPPPPSPSPPPPYVYMSPPPP 56

Query: 48  VYSPPPPYHYTSPPPP 1
             SPPPPY Y SPPPP
Sbjct: 57  SPSPPPPYIYKSPPPP 72

[62][TOP]
>UniRef100_Q9LHS1 Genomic DNA, chromosome 5, TAC clone:K3D20 n=2 Tax=Arabidopsis
           thaliana RepID=Q9LHS1_ARATH
          Length = 334

 Score =  188 bits (478), Expect = 3e-46
 Identities = 114/236 (48%), Positives = 124/236 (52%), Gaps = 59/236 (25%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPPVY---SPPPKVYPPVSPPPKV-YPPVSPPYHYSSPP 364
           YL++SPPPP   P      K  PP Y   SPPP  Y   SP PKV Y    PPY Y+SPP
Sbjct: 83  YLFNSPPPPYYSPSPKEDYKSPPPPYVYNSPPPPYY---SPSPKVDYKSPPPPYVYNSPP 139

Query: 363 PPVYSP--------PKKPYHYSSPPPPVYS---------PPPPYHYSSPPPP-----PKK 250
           PP YSP        P  PY Y+SPPPP YS         PPPPY Y+SPPPP     PK 
Sbjct: 140 PPYYSPSPKVEYKSPPPPYVYNSPPPPYYSLSPKVDYKSPPPPYVYNSPPPPYYSPSPKV 199

Query: 249 PYKYSSPP-------PPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSP---------PP 118
            YK+S PP       PP +  SPK  Y SPPPP   Y Y+SPPPP +SP         PP
Sbjct: 200 DYKFSPPPYVYNSPSPPYYSPSPKVDYKSPPPP---YVYNSPPPPYFSPSPKVDYKSPPP 256

Query: 117 PYHYSSPPPPPKKPYY-------YHSPPPPVY----------SPPPPYHYTSPPPP 1
           PY YSSPPPP   PYY       Y SPPPP Y          SPPP + Y  PPPP
Sbjct: 257 PYVYSSPPPP---PYYSPSPEVSYKSPPPPPYYSPSLEVSYKSPPPLFVYNFPPPP 309

 Score =  186 bits (472), Expect = 1e-45
 Identities = 115/260 (44%), Positives = 134/260 (51%), Gaps = 69/260 (26%)
 Frame = -3

Query: 573 LVSLTLPSLISAN--SYLYSSPPPPKVYPPV-----SPPPKVYPPVYSPPPKVYPPVS-- 421
           +V + + S I+A   +Y YSS   P+   PV     S  PK Y P YS  P   PP+   
Sbjct: 13  MVYVVVLSAIAATVTAYPYSSHQTPQYNSPVHKHESSYSPKKYSPYYSASP--LPPLQYR 70

Query: 420 -PPPKVYPPVSPPYHYSSPPPPVYSP--------PKKPYHYSSPPPPVYSP--------- 295
              PK Y P   PY ++SPPPP YSP        P  PY Y+SPPPP YSP         
Sbjct: 71  RQGPK-YTPHPKPYLFNSPPPPYYSPSPKEDYKSPPPPYVYNSPPPPYYSPSPKVDYKSP 129

Query: 294 PPPYHYSSPPPP------------PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYH 151
           PPPY Y+SPPPP            P  PY Y+SPPPP + +SPK  Y SPPP   PY Y+
Sbjct: 130 PPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSLSPKVDYKSPPP---PYVYN 186

Query: 150 SPPPPVYSP---------PPPYHYSSPPPP------------PKKPYYYHSPPPPVY--- 43
           SPPPP YSP         PPPY Y+SP PP            P  PY Y+SPPPP +   
Sbjct: 187 SPPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYSPSPKVDYKSPPPPYVYNSPPPPYFSPS 246

Query: 42  ------SPPPPYHYTSPPPP 1
                 SPPPPY Y+SPPPP
Sbjct: 247 PKVDYKSPPPPYVYSSPPPP 266

 Score =  169 bits (428), Expect = 2e-40
 Identities = 104/232 (44%), Positives = 112/232 (48%), Gaps = 58/232 (25%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVS------PPPKVY----PPVYSPPPKVYPPVSPPPKVY----PPV 394
           Y+Y+SPPPP   P         PPP VY    PP YSP PKV     PPP VY    PP 
Sbjct: 108 YVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPY 167

Query: 393 ------------SPPYHYSSPPPPVYSPPKK--------PYHYSSPPPPVYSPPPPYHYS 274
                        PPY Y+SPPPP YSP  K        PY Y+SP PP YSP P   Y 
Sbjct: 168 YSLSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYSPSPKVDYK 227

Query: 273 SPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY-----------S 127
           SPPPP    Y Y+SPPPP    SPK  Y SPPPP   Y Y SPPPP Y            
Sbjct: 228 SPPPP----YVYNSPPPPYFSPSPKVDYKSPPPP---YVYSSPPPPPYYSPSPEVSYKSP 280

Query: 126 PPPPYH-------YSSPPP------PPKKPYYYHSPPPPVYSPPPPYHYTSP 10
           PPPPY+       Y SPPP      PP  P+Y  SP     SPP PY   +P
Sbjct: 281 PPPPYYSPSLEVSYKSPPPLFVYNFPPPPPFYSPSPKVSYKSPPAPYVSKTP 332

 Score =  147 bits (370), Expect = 9e-34
 Identities = 85/179 (47%), Positives = 93/179 (51%), Gaps = 25/179 (13%)
 Frame = -3

Query: 531 YLYSSPPPP------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
           Y+Y+SPPPP      KV     PPP VY    PP YSP PKV    SPPP VY   SPPY
Sbjct: 158 YVYNSPPPPYYSLSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKFSPPPYVYNSPSPPY 217

Query: 381 HYSSPPPPVYSPPKKPYHYSSPPPPVYSP---------PPPYHYSSPPPPP----KKPYK 241
            YS  P   Y  P  PY Y+SPPPP +SP         PPPY YSSPPPPP         
Sbjct: 218 -YSPSPKVDYKSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVS 276

Query: 240 YSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP--PKKPYY 70
           Y SPPPP ++       +  PPP   Y +  PPPP YSP P   Y SPP P   K P Y
Sbjct: 277 YKSPPPPPYYSPSLEVSYKSPPPLFVYNF-PPPPPFYSPSPKVSYKSPPAPYVSKTPNY 334

[63][TOP]
>UniRef100_Q40503 Extensin n=1 Tax=Nicotiana tabacum RepID=Q40503_TOBAC
          Length = 224

 Score =  188 bits (478), Expect = 3e-46
 Identities = 122/227 (53%), Positives = 129/227 (56%), Gaps = 25/227 (11%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKV-YPPVSPPPKVYPPVYSPPPK--V 436
           MAS   +LLV LVSL+L S  SAN Y YSSPPPPK  Y   SPPP V+  VY  PP   V
Sbjct: 4   MASLFASLLVVLVSLSLASESSAN-YQYSSPPPPKKPYLYKSPPPPVH--VYPSPPHHPV 60

Query: 435 YPPVSPPPKVYPPVSPPYH----YSSPPPPV--YSPPKKPYHYSSPPPPV--YSPPPPYH 280
           Y    PP K Y P   PYH    Y SPPPP   Y PP  P  Y SPPPP   YS P    
Sbjct: 61  YKSPPPPKKPYHPSPTPYHPVPVYKSPPPPKKPYYPPHPPV-YKSPPPPKKPYSLPHTPV 119

Query: 279 YSSPPPPPKKPYKYSSPPPPE--HHVSPKPYYHSPPPPKKPYYYHSPPPPVY-SPPPPYH 109
           Y SPPPP      Y SPPPP+  H+    P Y SPPPP KPYY   P  PVY SPPPP  
Sbjct: 120 YKSPPPPTPV---YKSPPPPKKPHYPPHTPIYKSPPPPNKPYY--PPHTPVYKSPPPPTP 174

Query: 108 YSSPPPPPKKPYY------YHSPPP--PVYSPPPPYH---YTSPPPP 1
               PPPPKKP+Y      Y SPPP  PVY  PPP+H   Y SPPPP
Sbjct: 175 VYKSPPPPKKPHYPPHTPVYKSPPPPTPVYKSPPPHHPYVYASPPPP 221

[64][TOP]
>UniRef100_Q40502 Extensin n=1 Tax=Nicotiana tabacum RepID=Q40502_TOBAC
          Length = 280

 Score =  187 bits (475), Expect = 6e-46
 Identities = 134/279 (48%), Positives = 140/279 (50%), Gaps = 77/279 (27%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKV-YPPVSPPPKVYPPVYSPPPK--V 436
           MAS   +LLV LVSL+L S  SAN Y YSSPPPPK  Y   SPPP V+  VY  PP   V
Sbjct: 4   MASLFASLLVVLVSLSLASESSAN-YQYSSPPPPKKPYLYKSPPPPVH--VYPSPPHHPV 60

Query: 435 YPPVSPPPKVYPPVSPPYH----YSSPPPP----------VYS---PPKKPYH------Y 325
           Y    PP K Y P   PYH    Y SPPPP          VY    PPKKPY       Y
Sbjct: 61  YKSPPPPKKPYHPSPTPYHPVPVYKSPPPPKKPYYPPHPPVYKSPPPPKKPYSLPHTPVY 120

Query: 324 SSPPPP--VY-SPPPPY--HYS------SPPPPPKKPYK----------------YSSPP 226
            SPPPP  VY SPPPP   HY         PPPP KPY                 Y SPP
Sbjct: 121 KSPPPPTPVYKSPPPPKKPHYPPHTPIYKSPPPPNKPYYPPHTPVYKSPPPPTPVYKSPP 180

Query: 225 PPE--HHVSPKPYYHSPPPPKKPYYYHSPPPPVY-SPPPPYHYSSPPPPPKKPYY----- 70
           PP+  H+    P Y SPPPPKKPYY   P  PVY SPPPP      PPP KKPYY     
Sbjct: 181 PPKKPHYPPHTPVYKSPPPPKKPYY--PPHTPVYKSPPPPTPVYKSPPPSKKPYYPPHTP 238

Query: 69  -YHSPPP------------PVYSPPPPYH---YTSPPPP 1
            Y SPPP            PVY  PPP+H   Y SPPPP
Sbjct: 239 VYKSPPPPTPVYKSPPPPTPVYKSPPPHHPYVYASPPPP 277

[65][TOP]
>UniRef100_Q6GUG3 Serine/proline-rich repeat protein n=2 Tax=Lupinus angustifolius
           RepID=Q6GUG3_LUPAN
          Length = 198

 Score =  187 bits (474), Expect = 8e-46
 Identities = 105/184 (57%), Positives = 106/184 (57%), Gaps = 6/184 (3%)
 Frame = -3

Query: 534 SYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPV 355
           SY Y SPPPP   P  SPPP   P VY  PP        PP   PP  PPY Y SPPPP 
Sbjct: 42  SYYYQSPPPPS--PSPSPPP---PYVYKSPP--------PPSPSPP--PPYAYKSPPPPS 86

Query: 354 YSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHS 184
            SPP  PY Y SPPPP  SPPPPY   SPPPP   P  PY Y SPPPP    SP P   S
Sbjct: 87  PSPPP-PYLYKSPPPPSPSPPPPYVNKSPPPPSSSPPPPYIYKSPPPPS--PSPPPPSPS 143

Query: 183 PPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYH---YTS 13
           PPPP       SPPPP  SPPPPY Y SPPPP        SPPPP  SPPPPYH   Y+S
Sbjct: 144 PPPPSP-----SPPPPSPSPPPPYVYKSPPPPSP------SPPPPSPSPPPPYHPYLYSS 192

Query: 12  PPPP 1
           PPPP
Sbjct: 193 PPPP 196

 Score =  165 bits (417), Expect = 3e-39
 Identities = 95/172 (55%), Positives = 96/172 (55%), Gaps = 1/172 (0%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           PS      Y+Y SPPPP    P  PPP  Y    SPPP   P  SPP        PPY Y
Sbjct: 53  PSPSPPPPYVYKSPPPPS---PSPPPPYAYK---SPPP---PSPSPP--------PPYLY 95

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP-PKKPYKYSSPPPPEHHVSPK 199
            SPPPP  SPP  PY   SPPPP  SPPPPY Y SPPPP P  P    SPPPP    SP 
Sbjct: 96  KSPPPPSPSPP-PPYVNKSPPPPSSSPPPPYIYKSPPPPSPSPPPPSPSPPPP----SPS 150

Query: 198 PYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY 43
           P   SP PP  PY Y SPPPP  SPPPP   S  PPPP  PY Y SPPPPVY
Sbjct: 151 PPPPSPSPP-PPYVYKSPPPPSPSPPPP---SPSPPPPYHPYLYSSPPPPVY 198

 Score =  164 bits (416), Expect = 4e-39
 Identities = 85/153 (55%), Positives = 87/153 (56%), Gaps = 8/153 (5%)
 Frame = -3

Query: 435 YPPVSPPPKVYPPVSPPYHYSSPPPPVYSP-PKKPYHYSSPPPPVYSPPPPYHYSSPPPP 259
           Y P +     Y    P Y+Y SPPPP  SP P  PY Y SPPPP  SPPPPY Y SPPPP
Sbjct: 26  YHPYNAGQPYYYYQPPSYYYQSPPPPSPSPSPPPPYVYKSPPPPSPSPPPPYAYKSPPPP 85

Query: 258 ---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSS 100
              P  PY Y SPPPP     P     SPPPP      PY Y SPPPP  SPPPP    S
Sbjct: 86  SPSPPPPYLYKSPPPPSPSPPPPYVNKSPPPPSSSPPPPYIYKSPPPPSPSPPPP----S 141

Query: 99  PPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           P PPP  P    SPPPP  SPPPPY Y SPPPP
Sbjct: 142 PSPPPPSP----SPPPPSPSPPPPYVYKSPPPP 170

[66][TOP]
>UniRef100_B9HRV2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HRV2_POPTR
          Length = 711

 Score =  187 bits (474), Expect = 8e-46
 Identities = 105/194 (54%), Positives = 118/194 (60%), Gaps = 5/194 (2%)
 Frame = -3

Query: 567 SLTLPSLISANSYLYSSPPPPKVYPPV---SPPPKVYPPVYSPPPKVYPPVSPPPKVYPP 397
           S +LP L+ +      SPPP   +PP    SPPP   PPV+SPPP +Y   SPPP VY P
Sbjct: 406 SQSLPPLVHSLPPPAHSPPPSIHFPPPPVHSPPP---PPVHSPPPPIY---SPPPLVYSP 459

Query: 396 VSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPP--KKPYKYSSPPP 223
             PP H  SPPPPV+SPP     +   PPPV+SPPPP H  SPPPPP    P    SPPP
Sbjct: 460 -PPPVH--SPPPPVHSPPPPVQSF---PPPVHSPPPPVH--SPPPPPVYSPPPPVHSPPP 511

Query: 222 PEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY 43
           P +  SP P   SPPPP      HSPPPP++SPPPP  YS PPP    P   HSPPPP+ 
Sbjct: 512 PVY--SPPPLVQSPPPP-----VHSPPPPLHSPPPPPVYSPPPPVHSPPPPVHSPPPPIQ 564

Query: 42  SPPPPYHYTSPPPP 1
           SPPPP H  SPPPP
Sbjct: 565 SPPPPVH--SPPPP 576

 Score =  181 bits (460), Expect = 3e-44
 Identities = 109/214 (50%), Positives = 123/214 (57%), Gaps = 31/214 (14%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPV--SPPPKVY---PPVYSPPPKVY----PPV-SPPPKV 406
            P + S    +YS PPP    PP   SPPP V    PPV+SPPP V+    PPV SPPP V
Sbjct: 447  PPIYSPPPLVYSPPPPVHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPVYSPPPPV 506

Query: 405  Y---PPV-SPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKY 238
            +   PPV SPP    SPPPPV+SPP  P  +S PPPPVYSPPPP H  SPPPP   P   
Sbjct: 507  HSPPPPVYSPPPLVQSPPPPVHSPP--PPLHSPPPPPVYSPPPPVH--SPPPPVHSPPPP 562

Query: 237  SSPPPPEHHVSPKPYYHSPPPPKK---PYYYHSPPPPVYSPPPPYH------------YS 103
               PPP  H  P P  HSPPPP +   P   +SP PPV+SPPPP H             +
Sbjct: 563  IQSPPPPVHSPPPPPIHSPPPPVQSLPPPPVNSPLPPVHSPPPPVHSPTSPIHSHPPPVN 622

Query: 102  SPPPPPKK--PYYYHSPPPPVYSPPPPYHYTSPP 7
            SPPPP +   P   +SPPPPV+SP PP H  SPP
Sbjct: 623  SPPPPVQSLPPPPVNSPPPPVHSPTPPIHSPSPP 656

 Score =  180 bits (456), Expect = 1e-43
 Identities = 104/185 (56%), Positives = 113/185 (61%), Gaps = 12/185 (6%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVY---PPVYSPPPKVY---PPV-SPPPKVYPPVSPPYHYSSPPP 361
            SPPPP VY   SPPP V+   PPVYSPPP V    PPV SPPP ++ P  PP +  SPPP
Sbjct: 493  SPPPPPVY---SPPPPVHSPPPPVYSPPPLVQSPPPPVHSPPPPLHSPPPPPVY--SPPP 547

Query: 360  PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPP---KKPYKYSSPPPPEHHVSPKPYY 190
            PV+SPP  P H  SPPPP+ SPPPP H  SPPPPP     P   S PPPP +  SP P  
Sbjct: 548  PVHSPPP-PVH--SPPPPIQSPPPPVH--SPPPPPIHSPPPPVQSLPPPPVN--SPLPPV 600

Query: 189  HSPPPP--KKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYT 16
            HSPPPP        HS PPPV SPPPP     PPP    P   HSP PP++SP PP H  
Sbjct: 601  HSPPPPVHSPTSPIHSHPPPVNSPPPPVQSLPPPPVNSPPPPVHSPTPPIHSPSPPLH-- 658

Query: 15   SPPPP 1
            SPPPP
Sbjct: 659  SPPPP 663

 Score =  164 bits (415), Expect = 5e-39
 Identities = 98/193 (50%), Positives = 107/193 (55%), Gaps = 17/193 (8%)
 Frame = -3

Query: 528  LYSSPPPPKVYPPV---SPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPP 358
            L  SPPPP   PP    SPPP   PPVYSPPP V+   SPPP V+   SPP    SPPPP
Sbjct: 519  LVQSPPPPVHSPPPPLHSPPP---PPVYSPPPPVH---SPPPPVH---SPPPPIQSPPPP 569

Query: 357  VYSPPKKPYH------YSSPPPPVYSPPPPYHYSSPPPPPKKPYK--------YSSPPPP 220
            V+SPP  P H       S PPPPV SP PP H  SPPPP   P           +SPPPP
Sbjct: 570  VHSPPPPPIHSPPPPVQSLPPPPVNSPLPPVH--SPPPPVHSPTSPIHSHPPPVNSPPPP 627

Query: 219  EHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYS 40
               + P P  +SPPPP      HSP PP++SP PP H  SPPPP        SPPPPV+S
Sbjct: 628  VQSLPPPP-VNSPPPP-----VHSPTPPIHSPSPPLH--SPPPP------IRSPPPPVFS 673

Query: 39   PPPPYHYTSPPPP 1
            PPP      PPPP
Sbjct: 674  PPPVIVSPPPPPP 686

 Score =  163 bits (413), Expect = 9e-39
 Identities = 93/176 (52%), Positives = 103/176 (58%), Gaps = 3/176 (1%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVY---PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
           SPPP       S PP V+   PP +SPPP ++    PPP V+ P  PP H  SPPPP+YS
Sbjct: 401 SPPPSSQ----SLPPLVHSLPPPAHSPPPSIH---FPPPPVHSPPPPPVH--SPPPPIYS 451

Query: 348 PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
           PP   Y   SPPPPV+SPPPP H  SPPPP +     S PPP           HSPPPP 
Sbjct: 452 PPPLVY---SPPPPVHSPPPPVH--SPPPPVQ-----SFPPP----------VHSPPPP- 490

Query: 168 KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               +  PPPPVYSPPPP H S PPP    P    SPPPPV+SPPPP H  SPPPP
Sbjct: 491 ---VHSPPPPPVYSPPPPVH-SPPPPVYSPPPLVQSPPPPVHSPPPPLH--SPPPP 540

 Score =  139 bits (349), Expect = 2e-31
 Identities = 81/163 (49%), Positives = 94/163 (57%), Gaps = 10/163 (6%)
 Frame = -3

Query: 459 VYSPPP--KVYPPVS---PPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSP 295
           V+SPPP  +  PP+    PPP   PP  P  H+  PPPPV+SPP  P H  SPPPP+YSP
Sbjct: 399 VHSPPPSSQSLPPLVHSLPPPAHSPP--PSIHF--PPPPVHSPPPPPVH--SPPPPIYSP 452

Query: 294 PPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPP 115
           PP  +               SPPPP H  SP P  HSPPPP + +     PPPV+SPPPP
Sbjct: 453 PPLVY---------------SPPPPVH--SPPPPVHSPPPPVQSF-----PPPVHSPPPP 490

Query: 114 YHYSSPPPPPKKPYYYHSPPPPVYSPPPPYH-----YTSPPPP 1
            H  SPPPPP      +SPPPPV+SPPPP +       SPPPP
Sbjct: 491 VH--SPPPPP-----VYSPPPPVHSPPPPVYSPPPLVQSPPPP 526

 Score =  117 bits (294), Expect = 6e-25
 Identities = 76/156 (48%), Positives = 87/156 (55%), Gaps = 12/156 (7%)
 Frame = -3

Query: 519 SPPPPKVY---PPVS--PPPKV---YPPVYSPPPKVYPPVSPPPKVYPPVS--PPYHYSS 370
           SPPPP ++   PPV   PPP V    PPV+SPPP V+ P SP     PPV+  PP   S 
Sbjct: 572 SPPPPPIHSPPPPVQSLPPPPVNSPLPPVHSPPPPVHSPTSPIHSHPPPVNSPPPPVQSL 631

Query: 369 PPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYY 190
           PPPPV SPP  P H  SP PP++SP PP H  SPPPP +      SPPPP    SP P  
Sbjct: 632 PPPPVNSPPP-PVH--SPTPPIHSPSPPLH--SPPPPIR------SPPPPV--FSPPPVI 678

Query: 189 HSPPPPKKPYYYHSPPPPVYSPPP--PYHYSSPPPP 88
            SPPPP        PP   +  PP   + Y+SPPPP
Sbjct: 679 VSPPPP--------PPEEDFILPPNLGFQYASPPPP 706

 Score =  106 bits (264), Expect = 2e-21
 Identities = 74/165 (44%), Positives = 82/165 (49%), Gaps = 44/165 (26%)
 Frame = -3

Query: 519  SPPPPKVYPPV---SPPPKVY----PPVYSPPPKVY-----------PPV-SPPPKVYPP 397
            SPPPP   PP    SPPP V+    PP++SPPP V            PPV SPPP V+ P
Sbjct: 551  SPPPPVHSPPPPIQSPPPPVHSPPPPPIHSPPPPVQSLPPPPVNSPLPPVHSPPPPVHSP 610

Query: 396  VSP----PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPP---PPPKKPYKY 238
             SP    P   +SPPPPV S P  P +  SPPPPV+SP PP H  SPP   PPP  P + 
Sbjct: 611  TSPIHSHPPPVNSPPPPVQSLPPPPVN--SPPPPVHSPTPPIHSPSPPLHSPPP--PIRS 666

Query: 237  SSPP---PPEHHVSPKP---------------YYHSPPPPKKPYY 157
              PP   PP   VSP P                Y SPPPP  P Y
Sbjct: 667  PPPPVFSPPPVIVSPPPPPPEEDFILPPNLGFQYASPPPPTFPGY 711

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 42/106 (39%), Positives = 55/106 (51%), Gaps = 21/106 (19%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPV----------SPPPKVY---PPVYSPPPKVY---PPV 424
           P + S  S ++S PPP    PP           SPPP V+   PP++SP P ++   PP+
Sbjct: 605 PPVHSPTSPIHSHPPPVNSPPPPVQSLPPPPVNSPPPPVHSPTPPIHSPSPPLHSPPPPI 664

Query: 423 -SPPPKVYPPVSPPYHYSSPPPPVYS----PPKKPYHYSSPPPPVY 301
            SPPP V+ P  PP   S PPPP       PP   + Y+SPPPP +
Sbjct: 665 RSPPPPVFSP--PPVIVSPPPPPPEEDFILPPNLGFQYASPPPPTF 708

[67][TOP]
>UniRef100_Q06802 Extensin n=1 Tax=Nicotiana tabacum RepID=Q06802_TOBAC
          Length = 318

 Score =  186 bits (472), Expect = 1e-45
 Identities = 142/299 (47%), Positives = 148/299 (49%), Gaps = 97/299 (32%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISAN-----------SYLYSSPPPP-KVYP-----PV--S 484
           MAS   +LLV LVSL+L S  SAN           SYLY SPPPP  VYP     PV  S
Sbjct: 4   MASLFASLLVVLVSLSLASESSANYQYSSPPPPKKSYLYKSPPPPVHVYPSPPHHPVYKS 63

Query: 483 PPPKVYP------PVYS------------PPPK--VYPPVS------PPPK--VYPPVSP 388
           PPP   P      PVY             PPPK   YPP +      PPPK   YPP +P
Sbjct: 64  PPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPKKPYYPPHTP 123

Query: 387 PYHYSSPPPPVYS---PPKKPYH------YSSPPP--PVYSPPPPYH--YSSP------- 268
            Y    PP PVY    PPKKPY+      Y SPPP  PVY  PPP+   Y  P       
Sbjct: 124 VYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPHKKPYYPPHTPVYKS 183

Query: 267 PPPPKKPY------KYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY-SPPPPYH 109
           PPPPKKPY       Y SPPP      P P Y SPPPPKKPYY   P  PVY SPPPP  
Sbjct: 184 PPPPKKPYYPPHTPVYKSPPP------PTPVYKSPPPPKKPYY--PPHTPVYKSPPPPTP 235

Query: 108 YSSPPPPPKKPYY------YHSPPP--PVY-SPPP----------PYH----YTSPPPP 1
               PPPPKKPYY      Y SPPP  PVY SPPP          PYH    Y SPPPP
Sbjct: 236 VYKSPPPPKKPYYPPYTPVYKSPPPPTPVYKSPPPPKKPYYPSPTPYHPAPVYKSPPPP 294

 Score =  155 bits (392), Expect = 3e-36
 Identities = 101/200 (50%), Positives = 106/200 (53%), Gaps = 30/200 (15%)
 Frame = -3

Query: 528 LYSSPPPPK--VYPPVSP----PPKVYPPVYSPPPK---VYPPVSP------PPK--VYP 400
           +Y SPPPPK   YPP +P    PP   P   SPPP     YPP +P      PPK   YP
Sbjct: 134 VYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPHKKPYYPPHTPVYKSPPPPKKPYYP 193

Query: 399 PVSPPYHYSSPPPPVYS---PPKKPYHYSSPPPPVY-SPPPPYHYSSPPPPPKKPY---- 244
           P +P Y    PP PVY    PPKKPY+   P  PVY SPPPP      PPPPKKPY    
Sbjct: 194 PHTPVYKSPPPPTPVYKSPPPPKKPYY--PPHTPVYKSPPPPTPVYKSPPPPKKPYYPPY 251

Query: 243 --KYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYY 70
              Y SPPP      P P Y SPPPPKKPYY   P P  Y P P   Y SPPPP   P Y
Sbjct: 252 TPVYKSPPP------PTPVYKSPPPPKKPYY---PSPTPYHPAPV--YKSPPPP--TPVY 298

Query: 69  YHSPP--PPVY-SPPPPYHY 19
              PP  P VY SPP PYHY
Sbjct: 299 KSPPPHHPYVYASPPSPYHY 318

[68][TOP]
>UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B501E
          Length = 406

 Score =  183 bits (465), Expect = 9e-45
 Identities = 90/184 (48%), Positives = 94/184 (51%), Gaps = 9/184 (4%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           Y  PPPP   PP  PPP   PP Y PPP   PP   PP   PP  PP  YS PPPP   P
Sbjct: 198 YGPPPPPAYGPPPPPPPPPPPPAYGPPP---PPAYGPPPPPPPPPPPPAYSPPPPP--PP 252

Query: 345 PKKPYHYSSPPPPVYSPPPP---------YHYSSPPPPPKKPYKYSSPPPPEHHVSPKPY 193
           P  P  Y  PPPP Y PPPP         Y Y  PPPPP        PPPP  +  P P 
Sbjct: 253 PPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPP-------PPPPPPAYSPPPPP 305

Query: 192 YHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTS 13
            + PPPP  P  Y  PPPP Y PP P     PPPPP  P Y   PPPP Y+PPPP    +
Sbjct: 306 AYGPPPPPPPPAYAPPPPPAYGPPAP-----PPPPPPPPAYAPPPPPPAYAPPPPPPAYA 360

Query: 12  PPPP 1
           PPPP
Sbjct: 361 PPPP 364

 Score =  181 bits (458), Expect = 6e-44
 Identities = 94/198 (47%), Positives = 102/198 (51%), Gaps = 10/198 (5%)
 Frame = -3

Query: 564 LTLPSLISANSYLYS------SPPPPKVYPP----VSPPPKVYPPVYSPPPKVYPPVSPP 415
           + LP+   A S +Y+       PPPP  Y      V  P K  PP Y+PPP VY P  PP
Sbjct: 35  IELPAARPAYSPVYAVVPAPQPPPPPPAYDDCDEIVLVPGKPAPPAYAPPPPVYAP-PPP 93

Query: 414 PKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYS 235
           P  Y P  PP  Y+ PPPP Y+PP  P     PPPP Y PPPP  Y  PPPPP       
Sbjct: 94  PPAYAPPPPPPAYAPPPPPAYAPPPPP--PPPPPPPSYGPPPPPAYGPPPPPP------P 145

Query: 234 SPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPP 55
            PPPP +   P P Y  PPPP  P     PPPP Y PPPP  Y  PPPPP        PP
Sbjct: 146 PPPPPAYGPPPPPAYGPPPPPPPP-----PPPPAYGPPPPPAYGPPPPPPP------PPP 194

Query: 54  PPVYSPPPPYHYTSPPPP 1
           PP Y PPPP  Y  PPPP
Sbjct: 195 PPAYGPPPPPAYGPPPPP 212

 Score =  180 bits (457), Expect = 7e-44
 Identities = 94/206 (45%), Positives = 97/206 (47%), Gaps = 31/206 (15%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           Y  PPPP   PP  PPP   PP Y PPP   PP   PP   PP  PP  Y  PPPP Y P
Sbjct: 152 YGPPPPPAYGPPPPPPPPPPPPAYGPPP---PPAYGPPPPPPPPPPPPAYGPPPPPAYGP 208

Query: 345 PKKPYH------YSSPPPPVYSPPPP---------YHYSSPPPPPKKPYKYSSPPPPEHH 211
           P  P        Y  PPPP Y PPPP         Y    PPPPP  P  Y  PPPP + 
Sbjct: 209 PPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYG 268

Query: 210 VSPKP--------YYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPP 55
             P P        Y + PPPP  P     PPPP YSPPPP  Y  PPPPP  P  Y  PP
Sbjct: 269 PPPPPPPPPPPAAYAYGPPPPPPP----PPPPPAYSPPPPPAYGPPPPPP--PPAYAPPP 322

Query: 54  PPVY--------SPPPPYHYTSPPPP 1
           PP Y         PPPP +   PPPP
Sbjct: 323 PPAYGPPAPPPPPPPPPAYAPPPPPP 348

 Score =  176 bits (445), Expect = 2e-42
 Identities = 92/204 (45%), Positives = 98/204 (48%), Gaps = 29/204 (14%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVY------PPVSPPPKVYPPVSPPYHYSSPP 364
           Y+ PPPP   PP  PPP   PP Y PPP         PP  PPP  Y P  PP +   PP
Sbjct: 106 YAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPP 165

Query: 363 PP------VYSPPKKPYH------YSSPPPPVYSPPPPYHYS--SPPPPPKKPYKYSSPP 226
           PP       Y PP  P +         PPPP Y PPPP  Y    PPPPP  P  Y  PP
Sbjct: 166 PPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPP 225

Query: 225 PPEHHVSPKPYYHSPPPPKKPYYYHSPPPP------VYSPPPPYHYSSPPPPPKKP---Y 73
           PP +   P P    PPPP  P Y   PPPP       Y PPPP  Y  PPPPP  P    
Sbjct: 226 PPAYGPPPPP----PPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAA 281

Query: 72  YYHSPPPPVYSPPPPYHYTSPPPP 1
           Y + PPPP   PPPP  Y+ PPPP
Sbjct: 282 YAYGPPPPPPPPPPPPAYSPPPPP 305

 Score =  175 bits (443), Expect = 3e-42
 Identities = 90/192 (46%), Positives = 97/192 (50%), Gaps = 16/192 (8%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPP---VYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPP 358
           +Y+ PPPP  Y P  PPP   PP    Y+PPP   PP  PPP  Y P  PP +   PPPP
Sbjct: 87  VYAPPPPPPAYAPPPPPPAYAPPPPPAYAPPPP--PPPPPPPPSYGPPPPPAYGPPPPPP 144

Query: 357 ------VYSPPKKPYH------YSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEH 214
                  Y PP  P +         PPPP Y PPPP  Y  PPPPP        PPPP +
Sbjct: 145 PPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPP------PPPPPPAY 198

Query: 213 HVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYS-SPPPPPKKPYYYHSPPPPVYSP 37
              P P Y  PPPP  P     PPPP Y PPPP  Y   PPPPP  P   +SPPPP   P
Sbjct: 199 GPPPPPAYGPPPPPPPP-----PPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPPPP 253

Query: 36  PPPYHYTSPPPP 1
           PPP  Y  PPPP
Sbjct: 254 PPPAAYGPPPPP 265

 Score =  171 bits (433), Expect = 4e-41
 Identities = 91/183 (49%), Positives = 94/183 (51%), Gaps = 8/183 (4%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           Y  PPPP   PP  PPP   PP YSPPP   PP  PPP  Y P  PP  Y  PPPP   P
Sbjct: 221 YGPPPPPAYGPPPPPPPPPPPPAYSPPPP--PPPPPPPAAYGPPPPPA-YGPPPPPPPPP 277

Query: 345 PKKPYHYSSPPPP-------VYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYH 187
           P   Y Y  PPPP        YSPPPP  Y  PPPPP   Y   +PPPP  +  P P   
Sbjct: 278 PPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPPPPPPPAY---APPPPPAYGPPAP--- 331

Query: 186 SPPPPKKPYYYHSPPPPVY-SPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSP 10
            PPPP  P Y   PPPP Y  PPPP  Y+ PPPPPK    Y   P  VY PP P     P
Sbjct: 332 PPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPK----YSPAPIVVYGPPAP-----P 382

Query: 9   PPP 1
           PPP
Sbjct: 383 PPP 385

 Score =  158 bits (400), Expect = 3e-37
 Identities = 84/182 (46%), Positives = 93/182 (51%), Gaps = 12/182 (6%)
 Frame = -3

Query: 510 PPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYP-----------PVSPPYHYSSPP 364
           P K+  P + P   Y PVY+  P   PP  PPP  Y            P  P Y   +PP
Sbjct: 32  PYKIELPAARP--AYSPVYAVVPAPQPP--PPPPAYDDCDEIVLVPGKPAPPAY---APP 84

Query: 363 PPVYSPPKKPYHYS-SPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYH 187
           PPVY+PP  P  Y+  PPPP Y+PPPP  Y+ PPPPP        PPPP +   P P Y 
Sbjct: 85  PPVYAPPPPPPAYAPPPPPPAYAPPPPPAYAPPPPPP------PPPPPPSYGPPPPPAYG 138

Query: 186 SPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPP 7
            PPPP  P     PPPP Y PPPP  Y  PPPPP        PPPP Y PPPP  Y  PP
Sbjct: 139 PPPPPPPP-----PPPPAYGPPPPPAYGPPPPPPP------PPPPPAYGPPPPPAYGPPP 187

Query: 6   PP 1
           PP
Sbjct: 188 PP 189

 Score =  142 bits (359), Expect = 2e-32
 Identities = 78/166 (46%), Positives = 81/166 (48%), Gaps = 19/166 (11%)
 Frame = -3

Query: 516 PPPPKVY-----PPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVY--------PPVSP 388
           PPPP  Y     PP  PPP  Y    PP Y PPP   PP  PPP  Y        PP  P
Sbjct: 238 PPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPP--PPPPPPPAAYAYGPPPPPPPPPP 295

Query: 387 PYHYSSPPPPVYSPPKKPYH--YSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEH 214
           P  YS PPPP Y PP  P    Y+ PPPP Y PP      +PPPPP  P  Y+ PPPP  
Sbjct: 296 PPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPP------APPPPPPPPPAYAPPPPP-- 347

Query: 213 HVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKP 76
                P Y  PPPP  P Y   PPPP YSP P   Y  P PPP  P
Sbjct: 348 -----PAYAPPPPP--PAYAPPPPPPKYSPAPIVVYGPPAPPPPPP 386

 Score =  116 bits (291), Expect = 1e-24
 Identities = 71/150 (47%), Positives = 76/150 (50%)
 Frame = -3

Query: 534 SYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPV 355
           +Y Y  PPPP   PP  PPP   PP YSPPP   PP   P    PP  PP  Y+ PPPP 
Sbjct: 281 AYAYGPPPPP---PP--PPP---PPAYSPPP---PPAYGP----PPPPPPPAYAPPPPPA 325

Query: 354 YSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPP 175
           Y PP       +PPPP   PPPP  Y+ PPPPP     Y+ PPPP       P Y  PPP
Sbjct: 326 YGPP-------APPPP---PPPPPAYAPPPPPP----AYAPPPPP-------PAYAPPPP 364

Query: 174 PKKPYYYHSPPPPVYSPPPPYHYSSPPPPP 85
           P K   Y   P  VY PP P     PPPPP
Sbjct: 365 PPK---YSPAPIVVYGPPAP-----PPPPP 386

 Score = 61.6 bits (148), Expect = 5e-08
 Identities = 30/74 (40%), Positives = 35/74 (47%), Gaps = 11/74 (14%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPK-----------VYPPVSPPPKVYPPVSPPYH 379
           Y+ PPPP   PP  PPP   PP Y+PPP             Y P  PPPK  P     Y 
Sbjct: 318 YAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPKYSPAPIVVYG 377

Query: 378 YSSPPPPVYSPPKK 337
             +PPPP  +P +K
Sbjct: 378 PPAPPPPPPAPKRK 391

[69][TOP]
>UniRef100_Q9STN1 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STN1_ARATH
          Length = 350

 Score =  183 bits (465), Expect = 9e-45
 Identities = 110/242 (45%), Positives = 129/242 (53%), Gaps = 47/242 (19%)
 Frame = -3

Query: 585 LLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKV 406
           L++A   + +P+         S PP P VY P  P P VY    SPPP  Y   SPPP  
Sbjct: 13  LVLAFYVVVVPTSAQCKYSPQSPPPQPYVYSPPLPSPYVYK---SPPPSPYLYSSPPPPP 69

Query: 405 Y----PPVSPPYHYSSPPPPVY---SPPKKPYHYSSPPPPVY---SPPPP---------- 286
           Y    PP  PPY Y+SPP P Y   SPP  P+ YSSPPPP Y   SPPPP          
Sbjct: 70  YVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRI 129

Query: 285 -YHYSSPPPP-------PKKPYKYSSPPPPEHHVSPKP----YYHSPPPPKKPYYYHSPP 142
            + YSSPPPP       P+ P+ YSSPPPP +  +  P     Y SPPPP  PY Y+SPP
Sbjct: 130 TFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVLFIYSSPPPP--PYVYNSPP 187

Query: 141 PPVY----SPPPPYHYSSPPPP-------PKKPYYYHSPPPPVY----SPPPPYHYTSPP 7
           PP Y     P  P+ YSSPPPP       P+ P+ Y SPPPP Y    +P  P+ Y+SPP
Sbjct: 188 PPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVPFIYSSPP 247

Query: 6   PP 1
           PP
Sbjct: 248 PP 249

 Score =  171 bits (432), Expect = 6e-41
 Identities = 106/232 (45%), Positives = 124/232 (53%), Gaps = 55/232 (23%)
 Frame = -3

Query: 531 YLYSSPP-PPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPP---YHYSSPP 364
           Y+Y+SPP PP VY    PPP VY    SPPP  Y   SPPP  Y   S P   + YSSPP
Sbjct: 81  YIYNSPPRPPYVYKSPPPPPFVYS---SPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPP 137

Query: 363 PPVY---SPPKKPYHYSSPPPPVY--------------SPPPPYHYSSPPPPP------- 256
           PP Y   S P+ P+ YSSPPPP Y               PPPPY Y+SPPPPP       
Sbjct: 138 PPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVLFIYSSPPPPPYVYNSPPPPPYVYESVP 197

Query: 255 KKPYKYSSPPPPEHHVSPKP----YYHSPPPP--------KKPYYYHSPPPPVYS----P 124
           + P+ YSSPPPP +  +  P     Y SPPPP        + P+ Y SPPPP Y     P
Sbjct: 198 RIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVP 257

Query: 123 PPPYHYSSPPPPP-------KKPYYYHSPPPP--VYSPPP--PYHYTSPPPP 1
             P+ YSSPPPPP       + P+ Y S PPP  VY+  P  P+ Y+SPPPP
Sbjct: 258 RIPFIYSSPPPPPYVYNSAPRIPFIYSSLPPPPYVYNSAPRVPFIYSSPPPP 309

 Score =  155 bits (393), Expect = 2e-36
 Identities = 105/237 (44%), Positives = 122/237 (51%), Gaps = 67/237 (28%)
 Frame = -3

Query: 531 YLYSSPPPPK-VYPPVSPPPKVYPPV------YS---PPPKVY------------PPVSP 418
           ++YSSPPPP  +Y    PPP VY  V      YS   PPP VY            PP  P
Sbjct: 101 FVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYNSAPRIPFIYSSPP--P 158

Query: 417 PPKVY-----------PPVSPPYHYSSPPPPVY---SPPKKPYHYSSPPPPVY----SPP 292
           PP VY            P  PPY Y+SPPPP Y   S P+ P+ YSSPPPP Y    +P 
Sbjct: 159 PPYVYNSAPRVLFIYSSPPPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPR 218

Query: 291 PPYHYSSPPPPP-------KKPYKYSSPPPPEHHVSPKP----YYHSPPPPKKPYYYHS- 148
            P+ YSSPPPPP       + P+ YSSPPPP +     P     Y SPPPP  PY Y+S 
Sbjct: 219 IPFIYSSPPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPP--PYVYNSA 276

Query: 147 -----------PPPPVYSPPP--PYHYSSPPPPPKKPYYYHSPP--PPVYSPPPPYH 22
                      PPP VY+  P  P+ YSSPPPP   PY Y+S P  P +YS PPP+H
Sbjct: 277 PRIPFIYSSLPPPPYVYNSAPRVPFIYSSPPPP---PYVYNSAPRIPFIYSSPPPHH 330

[70][TOP]
>UniRef100_Q06446 Extensin n=1 Tax=Solanum tuberosum RepID=Q06446_SOLTU
          Length = 291

 Score =  182 bits (463), Expect = 1e-44
 Identities = 136/286 (47%), Positives = 145/286 (50%), Gaps = 84/286 (29%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISANSYLYSSPPPP-KVYP-----PV--SPPPKVYPPVY- 454
           MAS   TLLV LVSL+L S  SAN Y YSSPPPP  VYP     PV  SPPP  + PVY 
Sbjct: 4   MASLVATLLVVLVSLSLASESSAN-YQYSSPPPPVHVYPSPPHHPVYKSPPPHHHHPVYK 62

Query: 453 SPPPKVYPPVSPPPKVYPPVSPPYH---YSSPPPP--VYS---PPKKPYH------YSSP 316
           SPPP   P   P   VY    P +H   Y SPPPP  VY    PPK P++      Y SP
Sbjct: 63  SPPPSEKPHYPPHTPVYKSPPPHHHHPVYKSPPPPTPVYKSPPPPKTPHYPPHTPVYKSP 122

Query: 315 PP----PVYS-PPPPYHYSSPPPPPKKP--------YK--------YSSPPPP----EHH 211
           PP    PVY  PPPP      PPPPK P        YK        Y SPPPP    +  
Sbjct: 123 PPHHHHPVYKFPPPPTPVYKSPPPPKDPHYPPHTPVYKSPPPPTPVYKSPPPPTPVYKSP 182

Query: 210 VSPKPYYHSPPPPKKPYY----YHSPPPP--VYSPPP--PYH----YSSPPPP------- 88
             P P Y SPPPP KPY+    Y SPPPP  VY  PP  PYH    Y SPPPP       
Sbjct: 183 PPPTPVYKSPPPPVKPYHPAPVYKSPPPPTPVYKSPPVKPYHPAPVYKSPPPPTPIYKSP 242

Query: 87  --PKKPYY-----------YHSPPPP--VYSPPPPYH--YTSPPPP 1
             P KPY+           Y SPPPP  VY  PPP H  Y+SPPPP
Sbjct: 243 PPPVKPYHPSPTPYHPKPVYKSPPPPTPVYKSPPPTHYVYSSPPPP 288

 Score = 73.9 bits (180), Expect = 1e-11
 Identities = 50/95 (52%), Positives = 52/95 (54%), Gaps = 11/95 (11%)
 Frame = -3

Query: 528 LYSSPPPPK-VYPPVSPPPKVY--PPVY-SPPPK--VYPPVSPPPKVYPPVSPPYHYSSP 367
           +Y SPPPP  VY   SPP K Y   PVY SPPP   +Y    PP K Y P   PYH    
Sbjct: 204 VYKSPPPPTPVYK--SPPVKPYHPAPVYKSPPPPTPIYKSPPPPVKPYHPSPTPYH---- 257

Query: 366 PPPVYS--PPKKPYHYSSPPPPVY---SPPPPYHY 277
           P PVY   PP  P  Y SPPP  Y   SPPPPYHY
Sbjct: 258 PKPVYKSPPPPTPV-YKSPPPTHYVYSSPPPPYHY 291

[71][TOP]
>UniRef100_Q94ES6 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES6_PEA
          Length = 181

 Score =  182 bits (461), Expect = 3e-44
 Identities = 107/219 (48%), Positives = 117/219 (53%), Gaps = 14/219 (6%)
 Frame = -3

Query: 615 RSLMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKV 436
           RSLMAS    L +A++ L+ PS ISAN Y YSSPPPP               V+SPPP  
Sbjct: 2   RSLMASAALILALAMLFLSFPSEISANQYSYSSPPPP---------------VHSPPP-- 44

Query: 435 YPPVSPPPKVYPPVSPPYHYSSPPPP---VYSPPKKPYHYSSPPPPVYS---PPPPYHYS 274
                  PK       P+HYSSPPPP    Y  P   YH  SPPPPV++   P P YH  
Sbjct: 45  -------PK------DPHHYSSPPPPPVHTYPHPHPVYH--SPPPPVHTYPHPHPVYHSP 89

Query: 273 SPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPP 94
            PP P KKPYKY SPPPP          H+ P P     YHSPPPP      PY Y SPP
Sbjct: 90  PPPTPHKKPYKYPSPPPPP--------VHTYPHPHP--VYHSPPPPPTPHKKPYKYPSPP 139

Query: 93  PPPKKPY-------YYHSPPPPVYSPPPP-YHYTSPPPP 1
           PPP   Y        YHSPPPP YSPPPP Y+Y SPPPP
Sbjct: 140 PPPAHTYPPHVPTPVYHSPPPPAYSPPPPAYYYKSPPPP 178

[72][TOP]
>UniRef100_Q94ES9 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES9_PEA
          Length = 183

 Score =  180 bits (456), Expect = 1e-43
 Identities = 109/199 (54%), Positives = 119/199 (59%), Gaps = 15/199 (7%)
 Frame = -3

Query: 615 RSLMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVY--PPVYSPPP 442
           RSLMAS    L +A++ L+ PS ISAN Y YSSPPPP   PP    P  Y  PP   PP 
Sbjct: 2   RSLMASAALILALAMLFLSFPSEISANQYSYSSPPPPVHSPPPPKDPHHYSSPPPPPPPV 61

Query: 441 KVYP---PV--SPPPKV--YPPVSPPYHYSSPPPPVYSPPKKPYHY-SSPPPPVYSPPPP 286
             YP   PV  SPPP V  YP   P YH  SPPPP  +P KKPY Y S PPPPV++ P P
Sbjct: 62  HTYPHPHPVYHSPPPPVHTYPHPHPVYH--SPPPP--TPHKKPYKYPSPPPPPVHTYPHP 117

Query: 285 YH-YSSPPPPP---KKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPP 118
           +  Y SPPPPP   KKPYKY SPPPP  H  P    H P P      YHSPPPP YSPPP
Sbjct: 118 HPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPP---HVPTP-----VYHSPPPPAYSPPP 169

Query: 117 P-YHYSSPPPPPKKPYYYH 64
           P Y+Y SPPPP     Y+H
Sbjct: 170 PAYYYKSPPPP-----YHH 183

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 49/122 (40%), Positives = 54/122 (44%), Gaps = 47/122 (38%)
 Frame = -3

Query: 225 PPEHHVSPKPYYHSPP------PPKKPYYYHSPPPP-------------VYSPPPPYH-- 109
           P E   +   Y   PP      PPK P++Y SPPPP              +SPPPP H  
Sbjct: 22  PSEISANQYSYSSPPPPVHSPPPPKDPHHYSSPPPPPPPVHTYPHPHPVYHSPPPPVHTY 81

Query: 108 ------YSSPPPPP--KKPYYYHSPPPP-----------VYSPPP-------PYHYTSPP 7
                 Y SPPPP   KKPY Y SPPPP            +SPPP       PY Y SPP
Sbjct: 82  PHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPP 141

Query: 6   PP 1
           PP
Sbjct: 142 PP 143

[73][TOP]
>UniRef100_B9RZI2 Protein binding protein, putative n=1 Tax=Ricinus communis
            RepID=B9RZI2_RICCO
          Length = 829

 Score =  179 bits (454), Expect = 2e-43
 Identities = 107/193 (55%), Positives = 114/193 (59%), Gaps = 20/193 (10%)
 Frame = -3

Query: 519  SPPPPKVYPP--VSPPPKVYPPVYSPPPKVYPPV--SPPPKVY--PPVSPPYHYSSPPPP 358
            SPPPP   PP  V+ PP   PPVYSPPP   PP   SPPP VY  PP SPP    SPPPP
Sbjct: 648  SPPPPTQSPPPPVNSPP---PPVYSPPPPSPPPPVHSPPPPVYSPPPPSPPPPVHSPPPP 704

Query: 357  VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPP---PPKKPYKYSSPPPPEHHVSPKPYYH 187
            V+SPP  P H  SPPPPVYSPPPP   S PPP   PP  P  YS PPPP    SP P  H
Sbjct: 705  VHSPPP-PVH--SPPPPVYSPPPPSPPSPPPPMHSPP--PPVYSPPPPPVR--SPPPPVH 757

Query: 186  SPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPP-PVYSPPPP------ 28
            SPPPP      HSPPPP+YSPPPP  +S PPP    P    SPPP P  + PPP      
Sbjct: 758  SPPPP-----VHSPPPPIYSPPPP-RFSPPPPRFSPPPPTSSPPPTPTVAAPPPEDFILP 811

Query: 27   ----YHYTSPPPP 1
                + Y+SPPPP
Sbjct: 812  PNIGFQYSSPPPP 824

 Score =  178 bits (452), Expect = 3e-43
 Identities = 100/180 (55%), Positives = 104/180 (57%), Gaps = 6/180 (3%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVY---PPV-SPPPKVY--PPVSPPYHYSSPPP 361
            S  PP +  PP +P     PP  SPPP      PPV SPPP VY  PP SPP    SPPP
Sbjct: 625  SPSPPGQSPPPTTPEQSPSPPGQSPPPPTQSPPPPVNSPPPPVYSPPPPSPPPPVHSPPP 684

Query: 360  PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSP 181
            PVYSPP       SPPPPV+SPPPP H  SPPPP   P      PPP    SP P  HSP
Sbjct: 685  PVYSPPPP-----SPPPPVHSPPPPVH--SPPPPVHSPPPPVYSPPPPSPPSPPPPMHSP 737

Query: 180  PPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            PPP     Y  PPPPV SPPPP H  SPPPP       HSPPPP+YSPPPP    SPPPP
Sbjct: 738  PPP----VYSPPPPPVRSPPPPVH--SPPPP------VHSPPPPIYSPPPPRF--SPPPP 783

 Score =  159 bits (401), Expect = 2e-37
 Identities = 92/182 (50%), Positives = 96/182 (52%), Gaps = 9/182 (4%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPP--PKVYPPVYSPPPKVY-----PPVSPPPKVYPPVSPPYHYSSPPP 361
            SP P     P SP   P    P+ SP          PP   PP   P  SP     SPPP
Sbjct: 592  SPTPSPESEPQSPTSTPSPESPLSSPTSPTLEQSPSPPGQSPPPTTPEQSPSPPGQSPPP 651

Query: 360  PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYK--YSSPPPPEHHVSPKPYYH 187
            P  SPP      +SPPPPVYSPPPP    SPPPP   P    YS PPP     SP P  H
Sbjct: 652  PTQSPPPP---VNSPPPPVYSPPPP----SPPPPVHSPPPPVYSPPPP-----SPPPPVH 699

Query: 186  SPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPP 7
            SPPPP      HSPPPPV+SPPPP +   PP PP  P   HSPPPPVYSPPPP    SPP
Sbjct: 700  SPPPP-----VHSPPPPVHSPPPPVYSPPPPSPPSPPPPMHSPPPPVYSPPPP-PVRSPP 753

Query: 6    PP 1
            PP
Sbjct: 754  PP 755

 Score =  155 bits (393), Expect = 2e-36
 Identities = 91/169 (53%), Positives = 103/169 (60%), Gaps = 12/169 (7%)
 Frame = -3

Query: 513  PPPKVY--PPVSPPPKVY---PPVYSPPPKVYPPVSPPPKVY--PPVSPPYHYSSPPPPV 355
            PPP VY  PP SPPP V+   PPV+SPPP V+   SPPP VY  PP SPP    SPPPP+
Sbjct: 682  PPPPVYSPPPPSPPPPVHSPPPPVHSPPPPVH---SPPPPVYSPPPPSPP----SPPPPM 734

Query: 354  YSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPP 175
            +SPP  P  YS PPPPV SPPPP H  SPPPP        SPPPP +  SP P   SPPP
Sbjct: 735  HSPP--PPVYSPPPPPVRSPPPPVH--SPPPP------VHSPPPPIY--SPPPPRFSPPP 782

Query: 174  PKKPYYYHSPPPPVYSPPPPYHYSSPPP-----PPKKPYYYHSPPPPVY 43
            P+      SPPPP  SPPP    ++PPP     PP   + Y SPPPP++
Sbjct: 783  PR-----FSPPPPTSSPPPTPTVAAPPPEDFILPPNIGFQYSSPPPPMF 826

 Score =  140 bits (354), Expect = 6e-32
 Identities = 85/177 (48%), Positives = 93/177 (52%), Gaps = 3/177 (1%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPP-KVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPV-YS 349
            S P  P   P  SP P +   P  SP P+ Y    P P   P   P    S+P P    S
Sbjct: 557  SEPTSPTTSPSPSPEPSEPTSPTTSPSPE-YNSSEPSPTPSPESEPQSPTSTPSPESPLS 615

Query: 348  PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYS-SPPPPEHHVSPKPYYHSPPPP 172
             P  P    SP PP  SPPP     SP PP + P   + SPPPP +  SP P  +SPPPP
Sbjct: 616  SPTSPTLEQSPSPPGQSPPPTTPEQSPSPPGQSPPPPTQSPPPPVN--SPPPPVYSPPPP 673

Query: 171  KKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              P   HSPPPPVYSPPPP    SPPPP       HSPPPPV+SPPPP H  SPPPP
Sbjct: 674  SPPPPVHSPPPPVYSPPPP----SPPPP------VHSPPPPVHSPPPPVH--SPPPP 718

 Score =  129 bits (325), Expect = 1e-28
 Identities = 81/173 (46%), Positives = 88/173 (50%), Gaps = 3/173 (1%)
 Frame = -3

Query: 510  PPKVYPPVSPPP-KVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYS--SPPPPVYSPPK 340
            PP   P +SP P +   P  SP P   P     P   P  SP Y+ S  SP P   S P+
Sbjct: 545  PPTTSPSLSPEPSEPTSPTTSPSPSPEPSEPTSPTTSP--SPEYNSSEPSPTPSPESEPQ 602

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
             P    SP  P+ SP  P    SP PP +      SPPP     SP P   SPPPP +  
Sbjct: 603  SPTSTPSPESPLSSPTSPTLEQSPSPPGQ------SPPPTTPEQSPSPPGQSPPPPTQ-- 654

Query: 159  YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               SPPPPV SPPPP  YS PPP P  P   HSPPPPVYSPPPP    SPPPP
Sbjct: 655  ---SPPPPVNSPPPPV-YSPPPPSPPPP--VHSPPPPVYSPPPP----SPPPP 697

 Score =  115 bits (289), Expect = 2e-24
 Identities = 82/201 (40%), Positives = 91/201 (45%), Gaps = 14/201 (6%)
 Frame = -3

Query: 561  TLPSLISANSYLYSSPPPPKVYP-PVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPP 385
            T P+   + S   S P PP   P P S P +   P  SP P   P  S PP   P +SP 
Sbjct: 496  TSPTTSPSPSPEPSEPTPPATSPSPSSEPSEPTSPTTSPSPSSEPLESTPPTTSPSLSP- 554

Query: 384  YHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPK---KPYKYSSPPPPEH 214
               S P  P  SP   P   S P  P  SP P Y+ S P P P    +P   +S P PE 
Sbjct: 555  -EPSEPTSPTTSPSPSP-EPSEPTSPTTSPSPEYNSSEPSPTPSPESEPQSPTSTPSPES 612

Query: 213  HVS----------PKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYH 64
             +S          P P   SPPP        SP PP  SPPPP    SPPPP       +
Sbjct: 613  PLSSPTSPTLEQSPSPPGQSPPPTTPE---QSPSPPGQSPPPPTQ--SPPPP------VN 661

Query: 63   SPPPPVYSPPPPYHYTSPPPP 1
            SPPPPVYSPPPP    SPPPP
Sbjct: 662  SPPPPVYSPPPP----SPPPP 678

 Score = 87.8 bits (216), Expect = 6e-16
 Identities = 56/116 (48%), Positives = 64/116 (55%), Gaps = 17/116 (14%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPV---SPPPKVY----PPVYSPPPKVY---PPV-SPPPK 409
            P + S    +YS PPP    PP    SPPP VY    PPV SPPP V+   PPV SPPP 
Sbjct: 710  PPVHSPPPPVYSPPPPSPPSPPPPMHSPPPPVYSPPPPPVRSPPPPVHSPPPPVHSPPPP 769

Query: 408  VYPP----VSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPP--PYHYSSPPPP 259
            +Y P     SPP    SPPPP  SPP  P   ++PPP  +  PP   + YSSPPPP
Sbjct: 770  IYSPPPPRFSPPPPRFSPPPPTSSPPPTP-TVAAPPPEDFILPPNIGFQYSSPPPP 824

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 64/198 (32%), Positives = 79/198 (39%), Gaps = 25/198 (12%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKV-YPPVYSPPPKV-YPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
           S+P  P+   P  P P   Y P  S PP   Y P    P V  P +P  +  +P  P  S
Sbjct: 401 STPSSPRPSTPSVPTPSTPYVPTPSTPPSTSYGPTPSTPYVPTPSTP--YVPTPSTPSPS 458

Query: 348 PPKK----PYHYSSPPPPVYSPPPPYHYSSPPPPPK--KPYKYSSPPPPEHHVS-PKPYY 190
           PP++    P   SS P   Y+P P  H  SP P P+  KP   ++ P P    S P P  
Sbjct: 459 PPQQEVPTPQTPSSEP---YNPSPGGHRESPTPSPEPSKPTSPTTSPSPSPEPSEPTPPA 515

Query: 189 HSPPPPKKPYYYHSP-------------PPPVYSP---PPPYHYSSPPPPPKKPYYYHSP 58
            SP P  +P    SP              PP  SP   P P   +SP   P        P
Sbjct: 516 TSPSPSSEPSEPTSPTTSPSPSSEPLESTPPTTSPSLSPEPSEPTSPTTSPSPSPEPSEP 575

Query: 57  PPPVYSPPPPYHYTSPPP 4
             P  SP P Y+ + P P
Sbjct: 576 TSPTTSPSPEYNSSEPSP 593

 Score = 71.2 bits (173), Expect = 6e-11
 Identities = 43/97 (44%), Positives = 55/97 (56%), Gaps = 12/97 (12%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPV---SPPPKVY---PPVYSPPPKVYPPVSPPPKVYPPV 394
            P + S    +YS PPPP   PP    SPPP V+   PP+YSPPP  + P  PPP+  PP 
Sbjct: 732  PPMHSPPPPVYSPPPPPVRSPPPPVHSPPPPVHSPPPPIYSPPPPRFSP--PPPRFSPPP 789

Query: 393  ---SPPYH--YSSPPPPVY-SPPKKPYHYSSPPPPVY 301
               SPP     ++PPP  +  PP   + YSSPPPP++
Sbjct: 790  PTSSPPPTPTVAAPPPEDFILPPNIGFQYSSPPPPMF 826

[74][TOP]
>UniRef100_Q76KW3 Hydroxyproline-rich glycoprotein-2 (Fragment) n=1 Tax=Pisum sativum
           RepID=Q76KW3_PEA
          Length = 155

 Score =  176 bits (447), Expect = 1e-42
 Identities = 94/176 (53%), Positives = 104/176 (59%), Gaps = 1/176 (0%)
 Frame = -3

Query: 546 ISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSP 367
           IS+++YLYSSPPPP                              PK       PY+Y SP
Sbjct: 26  ISSBNYLYSSPPPP------------------------------PK-------PYYYQSP 48

Query: 366 PPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEH-HVSPKPYY 190
           PPPV+SPP  PYHYSSPPPPV+SPPPPYHYSSPPPPPKK YKYSSPPPP + + SP P  
Sbjct: 49  PPPVHSPPP-PYHYSSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPV 107

Query: 189 HSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYH 22
           HSPPP   PY+Y SPPPP   P   Y YSSPPPP    Y Y SP   VY     +H
Sbjct: 108 HSPPP---PYHYSSPPPP---PKKSYKYSSPPPP---VYKYKSPHQQVYKYKSHHH 154

 Score =  135 bits (339), Expect = 4e-30
 Identities = 66/101 (65%), Positives = 70/101 (69%), Gaps = 6/101 (5%)
 Frame = -3

Query: 285 YHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY--SPPPP- 115
           Y YSSPPPPPK PY Y SPPPP H   P  +Y SPPPP      HSPPPP +  SPPPP 
Sbjct: 31  YLYSSPPPPPK-PYYYQSPPPPVHSPPPPYHYSSPPPP-----VHSPPPPYHYSSPPPPP 84

Query: 114 ---YHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              Y YSSPPPP    Y Y SPPPPV+SPPPPYHY+SPPPP
Sbjct: 85  KKSYKYSSPPPP---IYKYKSPPPPVHSPPPPYHYSSPPPP 122

[75][TOP]
>UniRef100_Q40402 Extensin (ext) n=1 Tax=Nicotiana plumbaginifolia RepID=Q40402_NICPL
          Length = 416

 Score =  176 bits (446), Expect = 1e-42
 Identities = 127/263 (48%), Positives = 136/263 (51%), Gaps = 61/263 (23%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVY-SPPPKVYP 430
           MAS   T LV LVSL+L S  SAN Y YSSPPPPK     SP P    PVY SPPP +  
Sbjct: 4   MASLFATFLVVLVSLSLASESSAN-YQYSSPPPPKKPYHPSPTPYYPAPVYKSPPPPIPV 62

Query: 429 PVSPPPK---VYPPVSPPYHYSSPPPPVYS---PPKKPYH------YSSPPPP--VYSPP 292
             SPPP     YPP +P Y    PP PVY    PPKKP++      Y SPPPP  VY  P
Sbjct: 63  YKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPTPVYKSP 122

Query: 291 P-------PYH---YSSPPPPPKKPYKYSSPPPPE--HHVSPKPYYHS----------PP 178
           P       P H   Y SPPPP      Y SPPPP+  H+    P Y S          PP
Sbjct: 123 PSPKKPHYPPHTPVYKSPPPPTPV---YKSPPPPKKPHYPPHTPVYKSPPPPTPVYKSPP 179

Query: 177 PPKKPYY------YHSPPP----------PVY-SPPPPYHYSSPPPPPKKPYY-----YH 64
           PPKKP+Y      Y SPPP          PVY SPPPP      PPPPKKPY+     YH
Sbjct: 180 PPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYH 239

Query: 63  SPPPPVY-SPPPPYH-YTSPPPP 1
             P PVY SPPPP   Y SPPPP
Sbjct: 240 --PSPVYKSPPPPTPVYKSPPPP 260

 Score =  168 bits (426), Expect = 3e-40
 Identities = 123/247 (49%), Positives = 128/247 (51%), Gaps = 71/247 (28%)
 Frame = -3

Query: 528 LYSSPPPPKV--YPPVSP------PPK--VYPP---VY-SPPPK--VYPPVSPPPKVYPP 397
           +Y SPPPPK   YPP +P      PPK   YPP   VY SPPP   VY    PP K Y P
Sbjct: 174 VYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYHP 233

Query: 396 VSPPYH----YSSPPPP--VYS---PPKKPYH-----------YSSPPPP--VY-SPPP- 289
              PYH    Y SPPPP  VY    PPKKPYH           Y SPPPP  VY SPPP 
Sbjct: 234 SPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPP 293

Query: 288 --PYH-----------YSSPPPPPKKPYKYSSPPPPE--HHVSPKPY-----YHSPPPPK 169
             PYH           Y SPPPP      Y SPPPP+  +H SP PY     Y SPPPP 
Sbjct: 294 KKPYHPSPTPYHPSPVYKSPPPPTP---VYKSPPPPKKPYHPSPTPYHPAPVYKSPPPPT 350

Query: 168 KPYYYHSPPPPV--YSP-PPPYH----YSSPPPPPKKPYYYHSPPP-PVYSPPPPYH--- 22
               Y SPPPPV  Y P P PYH    Y SPPPP   P Y   PPP PVY  PPP+H   
Sbjct: 351 P--VYKSPPPPVKPYHPSPTPYHPAPVYKSPPPP--TPVYKSPPPPTPVYKSPPPHHPYV 406

Query: 21  YTSPPPP 1
           Y SPPPP
Sbjct: 407 YASPPPP 413

 Score =  155 bits (391), Expect = 3e-36
 Identities = 101/210 (48%), Positives = 103/210 (49%), Gaps = 40/210 (19%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVY-SPPPK--VYPPVSPPPKVYPPVSPPYH----YSS 370
           +Y SPPPPK     SP P    PVY SPPP   VY    PP K Y P   PYH    Y S
Sbjct: 220 VYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSPVYKS 279

Query: 369 PPPP--VYS---PPKKPYHYSSPP---PPVY-SPPPPYHYSSPPPPPKKPYK-------- 241
           PPPP  VY    PPKKPYH S  P    PVY SPPPP      PPPPKKPY         
Sbjct: 280 PPPPTPVYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHP 339

Query: 240 ---YSSPPPPEHHVSPKPYYHSPPPPKKPYY-----------YHSPPPP--VYSPPPPYH 109
              Y SPPPP       P Y SPPPP KPY+           Y SPPPP  VY  PPP  
Sbjct: 340 APVYKSPPPPT------PVYKSPPPPVKPYHPSPTPYHPAPVYKSPPPPTPVYKSPPPPT 393

Query: 108 YSSPPPPPKKPYYYHSPPPPVYSPPPPYHY 19
                PPP  PY Y        SPPPPYHY
Sbjct: 394 PVYKSPPPHHPYVY-------ASPPPPYHY 416

[76][TOP]
>UniRef100_Q9ZWT0 Extensin n=1 Tax=Adiantum capillus-veneris RepID=Q9ZWT0_ADICA
          Length = 207

 Score =  176 bits (445), Expect = 2e-42
 Identities = 94/154 (61%), Positives = 96/154 (62%), Gaps = 9/154 (5%)
 Frame = -3

Query: 435 YPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP- 259
           YP  SPPP    P SPPY Y SPPPP  SPP  PY Y SPPPP  SPPPPY Y SPPPP 
Sbjct: 70  YPHKSPPPS---PSSPPYKYKSPPPPSPSPPP-PYIYKSPPPPSPSPPPPYIYKSPPPPS 125

Query: 258 --PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSP-PPPYHYSSPPPP 88
             P  PY Y SPPPP    SP     SPPPP   Y Y SPPPP  +P PPPY YSSPPPP
Sbjct: 126 PSPPPPYLYKSPPPP----SP-----SPPPP---YIYKSPPPPPCTPSPPPYFYSSPPPP 173

Query: 87  -----PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                P  PY Y SPPPP +  PPPY Y SPPPP
Sbjct: 174 SPSPPP--PYQYKSPPPPSHPSPPPYVYKSPPPP 205

 Score =  161 bits (408), Expect = 4e-38
 Identities = 89/158 (56%), Positives = 90/158 (56%), Gaps = 6/158 (3%)
 Frame = -3

Query: 498 YPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSS 319
           YP  SPPP       SPP K   P  P P   PP  PPY Y SPPPP  SPP  PY Y S
Sbjct: 70  YPHKSPPPSPS----SPPYKYKSPPPPSPS--PP--PPYIYKSPPPPSPSPP-PPYIYKS 120

Query: 318 PPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHS 148
           PPPP  SPPPPY Y SPPPP   P  PY Y SPPPP       P   SPP    PY+Y S
Sbjct: 121 PPPPSPSPPPPYLYKSPPPPSPSPPPPYIYKSPPPP-------PCTPSPP----PYFYSS 169

Query: 147 PPPPVYSPPPPYHYSSPPP---PPKKPYYYHSPPPPVY 43
           PPPP  SPPPPY Y SPPP   P   PY Y SPPPP Y
Sbjct: 170 PPPPSPSPPPPYQYKSPPPPSHPSPPPYVYKSPPPPPY 207

 Score =  148 bits (373), Expect = 4e-34
 Identities = 83/161 (51%), Positives = 85/161 (52%), Gaps = 4/161 (2%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           P   S+  Y Y SPPPP    P  PPP +Y    SPPP   P  SPP        PPY Y
Sbjct: 76  PPSPSSPPYKYKSPPPPS---PSPPPPYIYK---SPPP---PSPSPP--------PPYIY 118

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPP----KKPYKYSSPPPPEHHV 208
            SPPPP  SPP  PY Y SPPPP  SPPPPY Y SPPPPP      PY YSSPPPP    
Sbjct: 119 KSPPPPSPSPP-PPYLYKSPPPPSPSPPPPYIYKSPPPPPCTPSPPPYFYSSPPPPSPSP 177

Query: 207 SPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPP 85
            P   Y SPPPP  P             PPPY Y SPPPPP
Sbjct: 178 PPPYQYKSPPPPSHP------------SPPPYVYKSPPPPP 206

 Score =  128 bits (321), Expect(2) = 6e-29
 Identities = 66/120 (55%), Positives = 71/120 (59%), Gaps = 9/120 (7%)
 Frame = -3

Query: 333 YHYSSPPPPVYSPPPPYHYSSPPPPPKKP-YKYSSPPPPEHHVSPKPYYHSPP-P---PK 169
           YH+     P +   P Y + SPPP P  P YKY SPPPP     P   Y SPP P   P 
Sbjct: 57  YHHHKQRTPWH---PHYPHKSPPPSPSSPPYKYKSPPPPSPSPPPPYIYKSPPPPSPSPP 113

Query: 168 KPYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSP-PPPYHYTSPPPP 1
            PY Y SPPPP  SPPPPY Y SPPPP   P  PY Y SPPPP  +P PPPY Y+SPPPP
Sbjct: 114 PPYIYKSPPPPSPSPPPPYLYKSPPPPSPSPPPPYIYKSPPPPPCTPSPPPYFYSSPPPP 173

 Score = 23.9 bits (50), Expect(2) = 6e-29
 Identities = 11/30 (36%), Positives = 14/30 (46%)
 Frame = -1

Query: 398 QFHHLIITLHHHHRCTHHLKSHTITLHHHH 309
           Q H+  +  HHHH       SH    H+HH
Sbjct: 36  QAHYHHVPYHHHH------DSHWRHPHYHH 59

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 49/102 (48%), Positives = 52/102 (50%), Gaps = 22/102 (21%)
 Frame = -3

Query: 240 YSSPPPPEHHVS----PKPYYHSPPPPKKPYYYH---------------SPPPPVYSPPP 118
           Y   P   HH S    P  ++H    P  P+Y H               SPPPP  SPPP
Sbjct: 39  YHHVPYHHHHDSHWRHPHYHHHKQRTPWHPHYPHKSPPPSPSSPPYKYKSPPPPSPSPPP 98

Query: 117 PYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           PY Y SPPPP   P  PY Y SPPPP  SPPPPY Y SPPPP
Sbjct: 99  PYIYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYLYKSPPPP 140

[77][TOP]
>UniRef100_B9SSV0 Cleavage and polyadenylation specificity factor, putative n=1
           Tax=Ricinus communis RepID=B9SSV0_RICCO
          Length = 210

 Score =  176 bits (445), Expect = 2e-42
 Identities = 104/217 (47%), Positives = 121/217 (55%), Gaps = 15/217 (6%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISANSYLYSSPPPPK--VYPPV---SPPPKVYPPVYSPPP 442
           ++S    +++ LV+ T  + +   SY Y  PPP K   YPP    SPPP    P  SPPP
Sbjct: 10  LSSMIHVVVLCLVATTAVADLKYPSYEYKLPPPHKKVYYPPYYYKSPPP----PSPSPPP 65

Query: 441 KVYPPVSPPPKVYPPVSP--PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSP 268
             Y    PP K YP  SP  PYHY SPPPP  S     Y+Y+SPPPP       Y+Y+SP
Sbjct: 66  PYYYTSPPPRKKYPSPSPLLPYHYHSPPPPKKST-HPTYYYNSPPPP-------YYYNSP 117

Query: 267 PPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSS 100
           PPP       SS PPP +      YY SPPPPKK    PY+Y SP P   SPPPPY+Y+S
Sbjct: 118 PPP-------SSSPPPLY------YYDSPPPPKKSLSPPYHYQSPSPLSPSPPPPYYYAS 164

Query: 99  PPPPPKKP----YYYHSPPPPVYSPPPPYHYTSPPPP 1
           P P PKK      YY SPPPP  SPP  Y+Y S PPP
Sbjct: 165 PSPTPKKSPSPLSYYKSPPPPSLSPPLSYYYQSLPPP 201

 Score = 86.3 bits (212), Expect = 2e-15
 Identities = 56/124 (45%), Positives = 60/124 (48%), Gaps = 34/124 (27%)
 Frame = -3

Query: 531 YLYSSPPPPK-----VYPPVSPPPKVY-----PPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
           Y Y SPPPPK      Y   SPPP  Y     PP  SPPP  Y    PPPK    +SPPY
Sbjct: 87  YHYHSPPPPKKSTHPTYYYNSPPPPYYYNSPPPPSSSPPPLYYYDSPPPPK--KSLSPPY 144

Query: 381 HYSSP-------PPPVY------SPPKKPY---HYSSPPPPVYSPP--------PPYHYS 274
           HY SP       PPP Y      +P K P    +Y SPPPP  SPP        PP +Y 
Sbjct: 145 HYQSPSPLSPSPPPPYYYASPSPTPKKSPSPLSYYKSPPPPSLSPPLSYYYQSLPPPNYF 204

Query: 273 SPPP 262
           SPPP
Sbjct: 205 SPPP 208

 Score = 78.2 bits (191), Expect = 5e-13
 Identities = 45/101 (44%), Positives = 51/101 (50%), Gaps = 18/101 (17%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPV------SPPPK--VYPPVY----------SPPPKVYPPVSPPPKV 406
           Y Y+SPPPP   PP        PPPK  + PP +           PPP  Y   SP PK 
Sbjct: 112 YYYNSPPPPSSSPPPLYYYDSPPPPKKSLSPPYHYQSPSPLSPSPPPPYYYASPSPTPKK 171

Query: 405 YPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPY 283
            P  SP  +Y SPPPP  SPP   Y+ S PPP  +SPPP Y
Sbjct: 172 SP--SPLSYYKSPPPPSLSPPLSYYYQSLPPPNYFSPPPYY 210

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 37/81 (45%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = -3

Query: 567 SLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSP 388
           SL+ P    + S L  SPPPP  Y   SP PK      SP P  Y    PPP + PP+S 
Sbjct: 139 SLSPPYHYQSPSPLSPSPPPPYYYASPSPTPK-----KSPSPLSYYKSPPPPSLSPPLS- 192

Query: 387 PYHYSSPPPPVY-SPPKKPYH 328
            Y+Y S PPP Y SPP  PY+
Sbjct: 193 -YYYQSLPPPNYFSPP--PYY 210

[78][TOP]
>UniRef100_O65375 F12F1.9 protein n=1 Tax=Arabidopsis thaliana RepID=O65375_ARATH
          Length = 744

 Score =  172 bits (435), Expect = 3e-41
 Identities = 106/219 (48%), Positives = 112/219 (51%), Gaps = 35/219 (15%)
 Frame = -3

Query: 552  SLISANSYLYSSPPPP--------KVYPPVSPPPKVYPPVY----SPPPKVYPPVSPPPK 409
            S +S +   YS PPPP        + YPP  PP    PP Y     PPP VY    PPP 
Sbjct: 430  SKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPY 489

Query: 408  VYP-PVSPPYHYSSPPPP-VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYS 235
            VY  P  PPY YSSPPPP VYS P  PY YSSPPPP  SPPPP   SSPPPP       +
Sbjct: 490  VYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVT 549

Query: 234  SPPPPEHHVSPKPYYHSPPPPKKPYY---YHSPPPP--------VYSPPPP----YHYSS 100
              PPP   V   P   SPPPP   YY    +SPPPP         YSPPPP    Y   +
Sbjct: 550  QSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVT 609

Query: 99   PPPPPKKPYYY----HSPPP--PVYSPPPPYHYTSPPPP 1
            P PPP  P YY     SPPP  PVY PP      SPPPP
Sbjct: 610  PSPPPPSPLYYPPVTPSPPPPSPVYYPPVT---PSPPPP 645

 Score =  169 bits (429), Expect = 1e-40
 Identities = 104/198 (52%), Positives = 108/198 (54%), Gaps = 21/198 (10%)
 Frame = -3

Query: 531 YLYSSPPPP--KVYPPVSPPPKVYPPVY---SPPPKVYPPVSPPPKVYPPVSPPYHYSSP 367
           Y   SPPPP  K+ P V   P   PP+Y   SPPP     +SP  + Y P  PP    SP
Sbjct: 378 YNIFSPPPPTFKMSPEVRTLP---PPIYVYSSPPPPPSSKMSPTVRAYSPPPPPSSKMSP 434

Query: 366 PPPVYSPPKKPYH--------YSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHH 211
               YSPP  PY         Y  PPPP  SPPPPY YSSPPPP    Y YSSPPPP   
Sbjct: 435 SVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPP----YVYSSPPPP--- 487

Query: 210 VSPKPY-YHSPPPPKKPYYYHSPPPP-VY-SPPPPYHYSSPPPPPKKPYYYHSPPPPVYS 40
               PY Y SPPPP  PY Y SPPPP VY SPPPPY YSSPPPPP  P     PP P  S
Sbjct: 488 ----PYVYSSPPPP--PYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSP----PPPCPESS 537

Query: 39  PPPPYHY-----TSPPPP 1
           PPPP  Y      SPPPP
Sbjct: 538 PPPPVVYYAPVTQSPPPP 555

 Score =  164 bits (415), Expect = 5e-39
 Identities = 116/233 (49%), Positives = 123/233 (52%), Gaps = 47/233 (20%)
 Frame = -3

Query: 561  TLPSLISANSYLYSSPPPP---KVYPPV---SPPP----KVYPPV--YSPPPKVYPPVSP 418
            TLP  I    Y+YSSPPPP   K+ P V   SPPP    K+ P V  YSPPP  Y  +SP
Sbjct: 396  TLPPPI----YVYSSPPPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPPPPPYSKMSP 451

Query: 417  PPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPP-VYS--PPPPYHYSSPPPPPKKP 247
              + YPP         PPPP  SPP  PY YSSPPPP VYS  PPPPY YSSPPPPP   
Sbjct: 452  SVRAYPP---------PPPPSPSPPP-PYVYSSPPPPYVYSSPPPPPYVYSSPPPPP--- 498

Query: 246  YKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV-YSPPPPYHYSSPP-------- 94
            Y YSSPPPP        Y +S PPP  PY Y SPPPP   SPPPP   SSPP        
Sbjct: 499  YVYSSPPPP--------YVYSSPPP--PYVYSSPPPPPP-SPPPPCPESSPPPPVVYYAP 547

Query: 93   ----PPPKKPYYY----HSPPP--PVYSPP-------------PPYHYTSPPP 4
                PPP  P YY     SPPP  PVY PP             PP  Y+ PPP
Sbjct: 548  VTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPP 600

 Score =  139 bits (349), Expect = 2e-31
 Identities = 107/241 (44%), Positives = 113/241 (46%), Gaps = 70/241 (29%)
 Frame = -3

Query: 531  YLYSSPPPPKVY-----PPVSPPPKVYPPVYSPPPKV--YPPV--SPPPK---VYPPVS- 391
            Y+YSSPPPP VY     PP SPPP    P  SPPP V  Y PV  SPPP     YPPV+ 
Sbjct: 508  YVYSSPPPPYVYSSPPPPPPSPPPPC--PESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQ 565

Query: 390  ----------PPYHYSSPPP-PVYSPPKKPYHYSSPPP-PVY------SPPPP----YHY 277
                      PP   S PPP PVY PP     YS PPP PVY      SPPPP    Y  
Sbjct: 566  SPPPPSPVYYPPVTNSPPPPSPVYYPPVT---YSPPPPSPVYYPQVTPSPPPPSPLYYPP 622

Query: 276  SSPPPPPKKPYKYS----SPPPPEH----HVSPKP------YY----HSPPPPKKPYY-- 157
             +P PPP  P  Y     SPPPP       V+P P      YY     SPPPP + YY  
Sbjct: 623  VTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSP 682

Query: 156  YHSPPP-------------PVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY--SPPPPYH 22
              SPPP             P Y PPP Y YSS PPPP    Y+   P   Y  SPPPP  
Sbjct: 683  SQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPPPPSPTSYFPPMPSVSYDASPPPPPS 742

Query: 21   Y 19
            Y
Sbjct: 743  Y 743

 Score =  115 bits (287), Expect = 4e-24
 Identities = 95/233 (40%), Positives = 102/233 (43%), Gaps = 78/233 (33%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS------PPPKVY--PPVYSPPPK---VYPPV--SPPPK---VYP 400
            Y+YSSPPPP   PP        PPP VY  P   SPPP     YPPV  SPPP     YP
Sbjct: 517  YVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYP 576

Query: 399  PVS-----------PPYHYSSPPP-PVY-------SPPKKPYHYS----SPPPP--VY-- 301
            PV+           PP  YS PPP PVY        PP  P +Y     SPPPP  VY  
Sbjct: 577  PVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYP 636

Query: 300  ----SPPPP----YHYSSPPPPPKKPYKYSS-----PPPPEHHVSPKPYYHSPPP----- 175
                SPPPP    Y   +P PPP  P  Y S     PPP E++ SP     SPPP     
Sbjct: 637  PVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPS---QSPPPTKACK 693

Query: 174  ------------PKKPYYYHSPPPPV----YSPP-PPYHYSSPPPPPKKPYYY 67
                        P   Y Y S PPP     Y PP P   Y + PPPP  P YY
Sbjct: 694  EGHPPQATPSYEPPPEYSYSSSPPPPSPTSYFPPMPSVSYDASPPPP--PSYY 744

[79][TOP]
>UniRef100_A3KD22 Leucine-rich repeat/extensin 1 n=1 Tax=Nicotiana tabacum
            RepID=A3KD22_TOBAC
          Length = 723

 Score =  170 bits (431), Expect = 8e-41
 Identities = 96/201 (47%), Positives = 106/201 (52%), Gaps = 24/201 (11%)
 Frame = -3

Query: 531  YLYSSPPPPK-------VYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYS 373
            Y + SPPPP+        Y P SPPP   P  Y PP   Y P SPPP       PP HY 
Sbjct: 493  YHHPSPPPPQPVYYAPPTYKPQSPPPPPPPVHYEPP--TYTPQSPPP------PPPVHYE 544

Query: 372  SPPPPVYSPPKKPYHY-------SSPPPPVY----SPPPP-YHYSSPP-PPPKKPYKYSS 232
             PP    SPP  P HY        SPPPPVY    SPPPP Y +  PP P P  P  Y+ 
Sbjct: 545  PPPYTPQSPPPPPVHYEPPTYTPQSPPPPVYVTPSSPPPPVYEHPKPPTPTPSPPAGYTP 604

Query: 231  PPPPEHHVSPKPYYHS--PPPPKKPYYYHSP-PPPVYSPPPPYHYSSPPPPPKKPYYYHS 61
            P  P H   P P  +   PPPP  P++   P PPP Y+P P Y  S PPPPP   Y Y S
Sbjct: 605  PQEPSHPAPPTPPCNETPPPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPP--TYTYSS 662

Query: 60   PPPPVYSPPPP-YHYTSPPPP 1
            PPPP  SPPPP Y+Y+SPPPP
Sbjct: 663  PPPPSSSPPPPTYYYSSPPPP 683

 Score =  166 bits (419), Expect = 2e-39
 Identities = 100/202 (49%), Positives = 109/202 (53%), Gaps = 28/202 (13%)
 Frame = -3

Query: 522  SSPPPPKV------YPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP 361
            S PPPP V      Y P SPPP   PPV+  PP  Y P SPPP VY  V+P    SSPPP
Sbjct: 534  SPPPPPPVHYEPPPYTPQSPPP---PPVHYEPP-TYTPQSPPPPVY--VTP----SSPPP 583

Query: 360  PVYSPPKKPYHYSSPP--------PPVYSPPPPYHYSSPPPPPKKPYKYSSP-PPPEHHV 208
            PVY  PK P    SPP        P   +PP P    +PPPPP  P+    P PPP ++ 
Sbjct: 584  PVYEHPKPPTPTPSPPAGYTPPQEPSHPAPPTPPCNETPPPPPSTPHWQPKPSPPPTYNP 643

Query: 207  SPKPYYHSPPPPKKPYYYHSPPPPVYSPPPP-YHYSSPPPPPKKPYYYHSPPPPVYSPPP 31
            SP  Y  SPPPP   Y Y SPPPP  SPPPP Y+YSSPPPPP       SPPPP  SPPP
Sbjct: 644  SPS-YTQSPPPPPPTYTYSSPPPPSSSPPPPTYYYSSPPPPPP------SPPPPSPSPPP 696

Query: 30   PYH------------YTSPPPP 1
            P +            Y SPPPP
Sbjct: 697  PSYEHVPLPPIVGVSYASPPPP 718

 Score =  147 bits (372), Expect = 5e-34
 Identities = 92/205 (44%), Positives = 106/205 (51%), Gaps = 11/205 (5%)
 Frame = -3

Query: 582 LVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY 403
           +V + S   PS  S+ S+   SPPPP+  PP SPPP   PPVYS  P  +   SPPP  +
Sbjct: 416 IVPIESPPPPSSKSSGSHFKRSPPPPQSTPPPSPPPP--PPVYSSSPS-HQHRSPPPPTH 472

Query: 402 PPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPP--VYSPPPPYHYSSPPPPPKKPYKYSSP 229
             +SP   ++ PPPP  SP    YH+ SPPPP  VY  PP Y   SPPPPP         
Sbjct: 473 K-ISPVTRHAPPPPPPPSPVY--YHHPSPPPPQPVYYAPPTYKPQSPPPPP--------- 520

Query: 228 PPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPP----KKPYYYHS 61
            PP H+  P     SPPPP          PPV+  PPPY   SPPPPP       Y   S
Sbjct: 521 -PPVHYEPPTYTPQSPPPP----------PPVHYEPPPYTPQSPPPPPVHYEPPTYTPQS 569

Query: 60  PPPPVY----SPPPP-YHYTSPPPP 1
           PPPPVY    SPPPP Y +  PP P
Sbjct: 570 PPPPVYVTPSSPPPPVYEHPKPPTP 594

 Score =  142 bits (357), Expect = 3e-32
 Identities = 82/184 (44%), Positives = 92/184 (50%), Gaps = 17/184 (9%)
 Frame = -3

Query: 501 VYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYS 322
           + P V P PK  P    PP +  PP    PK  PP  P     SPPPP  S      H+ 
Sbjct: 381 ISPVVKPRPKPTPKPKRPPVQNKPPA---PKPSPPTKPIVPIESPPPP--SSKSSGSHFK 435

Query: 321 SPPPPVYSPPPPYHYSSPPPPP----KKPYKYSSPPPPEHHVSP-KPYYHSPPPPKKPYY 157
             PPP  S PPP   S PPPPP       +++ SPPPP H +SP   +   PPPP  P Y
Sbjct: 436 RSPPPPQSTPPP---SPPPPPPVYSSSPSHQHRSPPPPTHKISPVTRHAPPPPPPPSPVY 492

Query: 156 YH--SPPP--PVYSPPPPYHYSSPPPPPKKPYY--------YHSPPPPVYSPPPPYHYTS 13
           YH  SPPP  PVY  PP Y   SPPPPP   +Y           PPPPV+  PPPY   S
Sbjct: 493 YHHPSPPPPQPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPPYTPQS 552

Query: 12  PPPP 1
           PPPP
Sbjct: 553 PPPP 556

 Score = 79.0 bits (193), Expect = 3e-13
 Identities = 49/112 (43%), Positives = 53/112 (47%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           P+   + SY  S PPPP  Y   SPPP              P  SPPP       P Y+Y
Sbjct: 639 PTYNPSPSYTQSPPPPPPTYTYSSPPP--------------PSSSPPP-------PTYYY 677

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPP 220
           SSPPPP   PP       SPPPP  SPPPP  Y   P PP     Y+SPPPP
Sbjct: 678 SSPPPP---PP-------SPPPPSPSPPPP-SYEHVPLPPIVGVSYASPPPP 718

[80][TOP]
>UniRef100_UPI0001982EE5 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
            RepID=UPI0001982EE5
          Length = 746

 Score =  170 bits (430), Expect = 1e-40
 Identities = 99/177 (55%), Positives = 105/177 (59%), Gaps = 3/177 (1%)
 Frame = -3

Query: 522  SSPPPP--KVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
            SSPPPP     PPV  PP   PPV+SPPP +  PV  PP   P  SPP   SSPPPP +S
Sbjct: 554  SSPPPPVHSTPPPVRSPP---PPVFSPPPPI--PVRSPPPPTPVRSPPPSVSSPPPPEHS 608

Query: 348  PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
            PP       SPPPP+YSP PP H  SPPPPP       SPPPP    SP P   SPPPP 
Sbjct: 609  PPPP---VQSPPPPLYSPSPPVH--SPPPPP-----VHSPPPPVR--SPPPPVSSPPPPP 656

Query: 168  KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPY-YYHSPPPPVYSPPPPYHYTSPPPP 1
                  SPPPPV+SPPPP   SSPPPP   P+     PPPPV SPPPP H  SPPPP
Sbjct: 657  ----VSSPPPPVHSPPPPV--SSPPPPVSSPHPPVAFPPPPVSSPPPPVH--SPPPP 705

 Score =  164 bits (414), Expect = 7e-39
 Identities = 101/179 (56%), Positives = 109/179 (60%), Gaps = 5/179 (2%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYP-PVYSPPPKVY---PPV-SPPPKVYPPVSPPYHYSSPPPP 358
           SSPPPP    P +P PK  P P+ SPPP V+   PPV SPPP V+   SPP     PP P
Sbjct: 531 SSPPPPHKATPPTPTPKPSPAPISSPPPPVHSTPPPVRSPPPPVF---SPP-----PPIP 582

Query: 357 VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPP 178
           V SPP  P    SPPP V SPPPP H  SPPPP +      SPPPP +  SP P  HSPP
Sbjct: 583 VRSPPP-PTPVRSPPPSVSSPPPPEH--SPPPPVQ------SPPPPLY--SPSPPVHSPP 631

Query: 177 PPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           PP      HSPPPPV SPPPP   SSPPPPP       SPPPPV+SPPPP   +SPPPP
Sbjct: 632 PPP----VHSPPPPVRSPPPPV--SSPPPPPVS-----SPPPPVHSPPPPV--SSPPPP 677

 Score =  160 bits (405), Expect = 8e-38
 Identities = 91/188 (48%), Positives = 100/188 (53%), Gaps = 14/188 (7%)
 Frame = -3

Query: 522  SSPPPPKVYP------PVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP 361
            S+PP PK  P      P +P P+  P   S PP   P  +P PK  P   PP   S PPP
Sbjct: 477  STPPTPKPRPSPPKSVPSTPKPQPSPSPVSAPPTPTPTPTPTPKPKPSPHPPKTSSPPPP 536

Query: 360  -----PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVS 205
                 P  +P   P   SSPPPPV+S PPP    SPPPP   P  P    SPPPP    S
Sbjct: 537  HKATPPTPTPKPSPAPISSPPPPVHSTPPPVR--SPPPPVFSPPPPIPVRSPPPPTPVRS 594

Query: 204  PKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPY 25
            P P   SPPPP+     HSPPPPV SPPPP +  SPP     P   HSPPPPV SPPPP 
Sbjct: 595  PPPSVSSPPPPE-----HSPPPPVQSPPPPLYSPSPPVHSPPPPPVHSPPPPVRSPPPP- 648

Query: 24   HYTSPPPP 1
              +SPPPP
Sbjct: 649  -VSSPPPP 655

 Score =  149 bits (377), Expect = 1e-34
 Identities = 96/182 (52%), Positives = 102/182 (56%), Gaps = 3/182 (1%)
 Frame = -3

Query: 570  VSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPP-- 397
            V  T P + S    ++S PPP  V  P  PPP    PV SPPP V  P  PPP+  PP  
Sbjct: 560  VHSTPPPVRSPPPPVFSPPPPIPVRSP--PPP---TPVRSPPPSVSSP--PPPEHSPPPP 612

Query: 396  -VSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPP 220
              SPP    SP PPV+SPP  P H  SPPPPV SPPPP   SSPPPPP      SSPPPP
Sbjct: 613  VQSPPPPLYSPSPPVHSPPPPPVH--SPPPPVRSPPPP--VSSPPPPP-----VSSPPPP 663

Query: 219  EHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYS 40
             H  SP P   SPPPP       SP PPV  PPPP   SSPPPP   P     PPPPV+S
Sbjct: 664  VH--SPPPPVSSPPPP-----VSSPHPPVAFPPPP--VSSPPPPVHSP-----PPPPVFS 709

Query: 39   PP 34
            PP
Sbjct: 710  PP 711

 Score =  105 bits (263), Expect = 2e-21
 Identities = 80/211 (37%), Positives = 82/211 (38%), Gaps = 62/211 (29%)
 Frame = -3

Query: 453  SPPPKVYPPV-SPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHY 277
            S PPK  PPV SP P   PP S P    SPP P   P   P    SP PP   P PP   
Sbjct: 429  SSPPKPRPPVRSPTP---PPASTP---RSPPTPKPQPHPSP----SPSPPKPQPAPP--- 475

Query: 276  SSPPPPPK------------------------------------------KPYKYSSPPP 223
             S PP PK                                           P K SSPPP
Sbjct: 476  KSTPPTPKPRPSPPKSVPSTPKPQPSPSPVSAPPTPTPTPTPTPKPKPSPHPPKTSSPPP 535

Query: 222  PEHHVSPKPY-------YHSPPPP--KKPYYYHSPPPPVYSPPPPYHYSSPPPP------ 88
            P     P P          SPPPP    P    SPPPPV+SPPPP    SPPPP      
Sbjct: 536  PHKATPPTPTPKPSPAPISSPPPPVHSTPPPVRSPPPPVFSPPPPIPVRSPPPPTPVRSP 595

Query: 87   ----PKKPYYYHSPPPPVYSPPPPYHYTSPP 7
                   P   HSPPPPV SPPPP +  SPP
Sbjct: 596  PPSVSSPPPPEHSPPPPVQSPPPPLYSPSPP 626

[81][TOP]
>UniRef100_Q9FLQ7 Formin-like protein 20 n=1 Tax=Arabidopsis thaliana RepID=FH20_ARATH
          Length = 1615

 Score =  169 bits (428), Expect = 2e-40
 Identities = 94/194 (48%), Positives = 105/194 (54%), Gaps = 14/194 (7%)
 Frame = -3

Query: 540  ANSYLYSSPPPPKVYPPVSPPPKV-YPPVY------SPPPKVYPPVSPPPKVYPPVSPPY 382
            AN Y+   PPPP  Y  ++P P V   P++      SPP K  PP  PPP    P S  +
Sbjct: 877  ANDYIL--PPPPLPYTSIAPSPSVKILPLHGISSAPSPPVKTAPPPPPPP----PFSNAH 930

Query: 381  HYSSPPPPVYS----PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEH 214
               SPPPP Y     PP  P  Y SPPPP   PPPP  Y SPPPPP  P  Y SPPPP  
Sbjct: 931  SVLSPPPPSYGSPPPPPPPPPSYGSPPPP---PPPPPSYGSPPPPPPPPPGYGSPPPPP- 986

Query: 213  HVSPKPYYHSPPPPKKPYYYH---SPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY 43
               P P Y SPPPP  P + H    PPPP   PPPP H  +PPPPP  P +  +PPPP  
Sbjct: 987  --PPPPSYGSPPPPPPPPFSHVSSIPPPP---PPPPMHGGAPPPPPPPPMHGGAPPPP-- 1039

Query: 42   SPPPPYHYTSPPPP 1
             PPPP H  +PPPP
Sbjct: 1040 -PPPPMHGGAPPPP 1052

 Score =  159 bits (402), Expect = 2e-37
 Identities = 91/184 (49%), Positives = 98/184 (53%), Gaps = 10/184 (5%)
 Frame = -3

Query: 522  SSPPPP-KVYPPVSPPPKVYPP--VYSPPPKVY---PPVSPPPKVY----PPVSPPYHYS 373
            S+P PP K  PP  PPP       V SPPP  Y   PP  PPP  Y    PP  PP  Y 
Sbjct: 908  SAPSPPVKTAPPPPPPPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYG 967

Query: 372  SPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPY 193
            SPPPP    P  P  Y SPPPP   PPPP  Y SPPPP         PPPP  HVS  P 
Sbjct: 968  SPPPP----PPPPPGYGSPPPP---PPPPPSYGSPPPP---------PPPPFSHVSSIP- 1010

Query: 192  YHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTS 13
               PPPP  P +  +PPPP   PPPP H  +PPPPP  P +  +PPPP   PPPP H  +
Sbjct: 1011 ---PPPPPPPMHGGAPPPP---PPPPMHGGAPPPPPPPPMHGGAPPPP---PPPPMHGGA 1061

Query: 12   PPPP 1
            PPPP
Sbjct: 1062 PPPP 1065

 Score =  152 bits (383), Expect = 3e-35
 Identities = 91/209 (43%), Positives = 100/209 (47%), Gaps = 29/209 (13%)
 Frame = -3

Query: 540  ANSYLYSSPPPPKVY--PPVSPPPKVY--PPVYSPPPKVY---PPVSPPPKVY----PPV 394
            +N++   SPPPP     PP  PPP  Y  PP   PPP  Y   PP  PPP  Y    PP 
Sbjct: 927  SNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPPPP 986

Query: 393  SPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEH 214
             PP  Y SPPPP   PP    H SS PPP   PPPP H  +PPPPP  P    +PPPP  
Sbjct: 987  PPPPSYGSPPPP---PPPPFSHVSSIPPP--PPPPPMHGGAPPPPPPPPMHGGAPPPP-- 1039

Query: 213  HVSPKPYYHS---PPPPKKPYYYHSPPPP-------VYSPPPPYHYSSPPPPPKKPYYYH 64
               P P  H    PPPP  P +  +PPPP          PPPP      PPPP  P    
Sbjct: 1040 ---PPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGG 1096

Query: 63   SPPPP--------VYSPPPPYHYTSPPPP 1
            +PPPP           PPPP H  +PPPP
Sbjct: 1097 APPPPPPPMRGGAPPPPPPPMHGGAPPPP 1125

 Score =  141 bits (356), Expect = 4e-32
 Identities = 98/252 (38%), Positives = 107/252 (42%), Gaps = 79/252 (31%)
 Frame = -3

Query: 519  SPPPPKVYPPVS-----------PPPKVYPPVYS----------PPPKVYPP-------- 427
            SPPPP   PP +           PPP   PP ++          PPP   PP        
Sbjct: 788  SPPPPPPPPPFASVRRNSETLLPPPPPPPPPPFASVRRNSETLLPPPPPPPPWKSLYAST 847

Query: 426  ----------VSPPPKVYPPVSPPY---------HYSSPPPP------------------ 358
                       SPPP   PP  PP+          Y  PPPP                  
Sbjct: 848  FETHEACSTSSSPPP---PPPPPPFSPLNTTKANDYILPPPPLPYTSIAPSPSVKILPLH 904

Query: 357  -VYSPPKKPYHYSSPPPP---------VYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHV 208
             + S P  P   + PPPP         V SPPPP  Y SPPPPP  P  Y SPPPP    
Sbjct: 905  GISSAPSPPVKTAPPPPPPPPFSNAHSVLSPPPP-SYGSPPPPPPPPPSYGSPPPPP--- 960

Query: 207  SPKPYYHS-PPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHS--PPPPVYSP 37
             P P Y S PPPP  P  Y SPPPP   PPPP  Y SPPPPP  P+ + S  PPPP   P
Sbjct: 961  PPPPSYGSPPPPPPPPPGYGSPPPP---PPPPPSYGSPPPPPPPPFSHVSSIPPPP---P 1014

Query: 36   PPPYHYTSPPPP 1
            PPP H  +PPPP
Sbjct: 1015 PPPMHGGAPPPP 1026

 Score =  133 bits (335), Expect = 1e-29
 Identities = 86/214 (40%), Positives = 97/214 (45%), Gaps = 39/214 (18%)
 Frame = -3

Query: 525  YSSPPPPKVYPP---VSPPPKVYPPVY-SPPPKVYPPVS---------PPPKVY-----P 400
            Y SPPPP   PP     PPP   PP Y SPPP   PP S         PPP ++     P
Sbjct: 966  YGSPPPPPPPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPP 1025

Query: 399  PVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPP 220
            P  PP H  +PPPP    P  P H  +PPPP   PPPP H  +PPPPP   +  + PPPP
Sbjct: 1026 PPPPPMHGGAPPPP----PPPPMHGGAPPPP---PPPPMHGGAPPPPPPPMFGGAQPPPP 1078

Query: 219  EHHVSPKPYYHSPPPPKKPYYYHSPPPPVYS--------PPPPYHYSSPPP--------- 91
                 P     +PPPP  P    +PPPP           PPPP H  +PPP         
Sbjct: 1079 -----PPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGA 1133

Query: 90   --PPKKP--YYYHSPPPPVYSPPPPYHYTSPPPP 1
              PP  P      +PPPP   PPP      PPPP
Sbjct: 1134 PPPPPPPGGRGPGAPPPP---PPPGGRAPGPPPP 1164

 Score =  124 bits (311), Expect = 6e-27
 Identities = 78/200 (39%), Positives = 92/200 (46%), Gaps = 26/200 (13%)
 Frame = -3

Query: 525  YSSPPPPKVYPPVS-----PPPKVYPPVYS------PPPKVY---PPVSPPPKVY----- 403
            Y SPPPP   PP S     PPP   PP++       PPP ++   PP  PPP ++     
Sbjct: 992  YGSPPPPPP-PPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPP 1050

Query: 402  PPVSPPYHYSSPPPP-------VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPY 244
            PP  PP H  +PPPP          PP  P    +PPP    PPPP    +PPPPP  P 
Sbjct: 1051 PPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPP----PPPPMRGGAPPPPP-PPM 1105

Query: 243  KYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYH 64
            +  +PPPP     P  +  +PPPP  P    +PPPP   PPP       PPPP  P    
Sbjct: 1106 RGGAPPPP----PPPMHGGAPPPPPPPMRGGAPPPP---PPPGGRGPGAPPPPPPPGGRA 1158

Query: 63   SPPPPVYSPPPPYHYTSPPP 4
              PPP   P PP     PPP
Sbjct: 1159 PGPPPPPGPRPPGGGPPPPP 1178

 Score =  104 bits (259), Expect = 7e-21
 Identities = 108/350 (30%), Positives = 121/350 (34%), Gaps = 164/350 (46%)
 Frame = -3

Query: 558  LPSLIS-ANSYLYSSP----PPPKVYPP------------VSPPPKVYPPVYSPPPK--- 439
            LPSL S A + L+SS     PPP   PP            + PPP   PP  S  P    
Sbjct: 627  LPSLTSEAKTVLHSSQAVASPPPPPPPPPLPTYSHYQTSQLPPPPPPPPPFSSERPNSGT 686

Query: 438  VYPPVSPPPKVY------------PPVSPPYHYSS---------PPPP------VYS--- 349
            V PP  PPP  +            PP  PP  +SS         PPPP      VY+   
Sbjct: 687  VLPPPPPPPPPFSSERPNSGTVLPPPPPPPLPFSSERPNSGTVLPPPPSPPWKSVYASAL 746

Query: 348  ------------------PPKKPYHYS------------------SPPPPVYS------- 298
                              PP  P +YS                   PPPP ++       
Sbjct: 747  AIPAICSTSQAPTSSPTPPPPPPAYYSVGQKSSDLQTSQLPSPPPPPPPPPFASVRRNSE 806

Query: 297  -------PPPPYHYSS---------PPPPPKKPYK--YSS---------------PPPPE 217
                   PPPP  ++S         PPPPP  P+K  Y+S               PPPP 
Sbjct: 807  TLLPPPPPPPPPPFASVRRNSETLLPPPPPPPPWKSLYASTFETHEACSTSSSPPPPPPP 866

Query: 216  HHVSP------KPYYHSPPP-----------------------PKKPYYYHSPPPP---- 136
               SP        Y   PPP                       P  P     PPPP    
Sbjct: 867  PPFSPLNTTKANDYILPPPPLPYTSIAPSPSVKILPLHGISSAPSPPVKTAPPPPPPPPF 926

Query: 135  -----VYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                 V SPPPP  Y SPPPPP  P  Y SPPPP   PPPP  Y SPPPP
Sbjct: 927  SNAHSVLSPPPP-SYGSPPPPPPPPPSYGSPPPP---PPPPPSYGSPPPP 972

 Score = 88.2 bits (217), Expect = 5e-16
 Identities = 58/157 (36%), Positives = 70/157 (44%), Gaps = 29/157 (18%)
 Frame = -3

Query: 516  PPPPKVY---PPVSPPPKVY---PPVYSPPPKV--YPPVSPPPK---VYPPVSPPYHYSS 370
            PPPP ++   PP  PPP ++   PP   PPP     PP  PPP      PP  PP    +
Sbjct: 1026 PPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGA 1085

Query: 369  PPPPVYSPPKKPYHYSSPPPPVYS-----PPPPYHYSSPPPPPKKPYKYSSPPPPEHHVS 205
            PPPP   PP +      PPPP+       PPPP H  +PPPPP  P +  +PPPP     
Sbjct: 1086 PPPP--PPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPP-PMRGGAPPPPPPPGG 1142

Query: 204  PKPYYHSPPPPK-------------KPYYYHSPPPPV 133
              P    PPPP              +P     PPPP+
Sbjct: 1143 RGPGAPPPPPPPGGRAPGPPPPPGPRPPGGGPPPPPM 1179

 Score = 85.1 bits (209), Expect = 4e-15
 Identities = 77/242 (31%), Positives = 89/242 (36%), Gaps = 53/242 (21%)
 Frame = -3

Query: 567  SLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSP 388
            S++ P + S      S    PK  P   PP     P  +PPP   P ++   K     S 
Sbjct: 588  SVSSPDMRSRAPICSSPDSSPKETPSSLPPAS---PHQAPPP--LPSLTSEAKTVLHSSQ 642

Query: 387  PYHYSSPPPPVYSPPKKPY-HYSS---PPPPVYSPPPPYHYSSP------PPPPKKPYKY 238
                +SPPPP   PP   Y HY +   PPPP   PPPP+    P      PPPP  P  +
Sbjct: 643  AV--ASPPPPPPPPPLPTYSHYQTSQLPPPP--PPPPPFSSERPNSGTVLPPPPPPPPPF 698

Query: 237  SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPP------------------- 115
            SS  P    V P      PPPP  P+    P      PPPP                   
Sbjct: 699  SSERPNSGTVLP-----PPPPPPLPFSSERPNSGTVLPPPPSPPWKSVYASALAIPAICS 753

Query: 114  ---YHYSSPPPPPKKPYYYH--------------SPPPPVYSPPPPY-------HYTSPP 7
                  SSP PPP  P YY               SPPPP   PPPP+           PP
Sbjct: 754  TSQAPTSSPTPPPPPPAYYSVGQKSSDLQTSQLPSPPPP--PPPPPFASVRRNSETLLPP 811

Query: 6    PP 1
            PP
Sbjct: 812  PP 813

[82][TOP]
>UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum
           bicolor RepID=C5XPK9_SORBI
          Length = 613

 Score =  169 bits (427), Expect = 2e-40
 Identities = 93/189 (49%), Positives = 97/189 (51%), Gaps = 17/189 (8%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PP P   PP  PPP   PP  SPPP   PP SPPP   PP SPP    SPPPP   PP  
Sbjct: 421 PPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPP-- 478

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
                SPPPP  SPPPP      PPPP  P    SPPPP + VSP+  Y SPPPP    Y
Sbjct: 479 -----SPPPPSPSPPPP-----SPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPA---Y 525

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY----------SPPPP------- 28
              PPPP Y   P   Y SPPPPP     +H PPPP Y          SPPPP       
Sbjct: 526 TEVPPPPYYEVSPEDRYLSPPPPP----VHHDPPPPPYYEVSPEDRYLSPPPPSPASLPK 581

Query: 27  YHYTSPPPP 1
           Y Y+SPPPP
Sbjct: 582 YDYSSPPPP 590

 Score =  163 bits (413), Expect = 9e-39
 Identities = 91/181 (50%), Positives = 96/181 (53%), Gaps = 7/181 (3%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPP-VSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           S PPP    PP SPPP   PP   PPP   PP  SPPP   PP SPP    SPPPP   P
Sbjct: 435 SPPPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPP 494

Query: 345 PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
           P  P    SPPPP Y   P   Y SPPPP         PPPP + VSP+  Y SPPPP  
Sbjct: 495 PSPPPPSPSPPPPYYEVSPEERYLSPPPPAYT----EVPPPPYYEVSPEDRYLSPPPP-- 548

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPP-----PKKPYYYHSPPPPVYSPP-PPYHYTSPPP 4
           P ++  PPPP Y   P   Y SPPPP     PK  Y Y SPPPP   P  P Y Y+SPPP
Sbjct: 549 PVHHDPPPPPYYEVSPEDRYLSPPPPSPASLPK--YDYSSPPPPRALPKLPVYDYSSPPP 606

Query: 3   P 1
           P
Sbjct: 607 P 607

 Score =  139 bits (351), Expect = 1e-31
 Identities = 81/168 (48%), Positives = 86/168 (51%), Gaps = 5/168 (2%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSP-PPKVYPPVSPPYHYSSPPPPVYSPP 343
           SPPPP   PP  PPP   PP  SPPP   PP SP PP  Y  VSP   Y SPPPP Y+  
Sbjct: 469 SPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAYT-- 526

Query: 342 KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
                   PPPP Y   P   Y SPPPP   P  +  PPPP + VSP+  Y SPPPP   
Sbjct: 527 ------EVPPPPYYEVSPEDRYLSPPPP---PVHHDPPPPPYYEVSPEDRYLSPPPP--- 574

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYY-YHSPPPPVYSPPP 31
               SP     +  P Y YSSPPPP   PK P Y Y SPPPP     P
Sbjct: 575 ----SP-----ASLPKYDYSSPPPPRALPKLPVYDYSSPPPPAAGSTP 613

 Score =  135 bits (339), Expect = 4e-30
 Identities = 88/183 (48%), Positives = 90/183 (49%), Gaps = 32/183 (17%)
 Frame = -3

Query: 453 SPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVY---SPPPPY 283
           SPP    PP SPPP   PP SP     SPPPP   PP  P    SPPPP     SPPPP 
Sbjct: 406 SPP---LPPPSPPPPSPPPPSP-----SPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPP- 456

Query: 282 HYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYH-- 109
              SPPPP   P   S PPP     SP P   SPPPP  P    SPPPP  SPPPPY+  
Sbjct: 457 ---SPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPP--PPSPPPPSPSPPPPYYEV 511

Query: 108 -----YSSPPPP-----PKKPYY-------YHSPPPPVY---SPPPPYH-------YTSP 10
                Y SPPPP     P  PYY       Y SPPPP      PPPPY+       Y SP
Sbjct: 512 SPEERYLSPPPPAYTEVPPPPYYEVSPEDRYLSPPPPPVHHDPPPPPYYEVSPEDRYLSP 571

Query: 9   PPP 1
           PPP
Sbjct: 572 PPP 574

 Score =  100 bits (248), Expect = 1e-19
 Identities = 60/129 (46%), Positives = 62/129 (48%), Gaps = 16/129 (12%)
 Frame = -3

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPP---------PPPKKPYKYSSPPPPEHHVSPKPYYH 187
           K +   SPP P  SPPPP   S PP         PPP  P   S  PPP     P P   
Sbjct: 400 KKFVLPSPPLPPPSPPPP---SPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPP 456

Query: 186 SPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYH----- 22
           SPPPP  P    SPPPP   PP P   S  PPPP  P    SPPPP  SPPPPY+     
Sbjct: 457 SPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPP--PPSPPPPSPSPPPPYYEVSPE 514

Query: 21  --YTSPPPP 1
             Y SPPPP
Sbjct: 515 ERYLSPPPP 523

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 37/86 (43%), Positives = 40/86 (46%)
 Frame = -3

Query: 546 ISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSP 367
           +S      S PPPP  + P  PPP  Y    SP  +   P  PPP   P   P Y YSSP
Sbjct: 536 VSPEDRYLSPPPPPVHHDP--PPPPYYE--VSPEDRYLSP--PPPS--PASLPKYDYSSP 587

Query: 366 PPPVYSPPKKPYHYSSPPPPVYSPPP 289
           PPP   P    Y YSSPPPP     P
Sbjct: 588 PPPRALPKLPVYDYSSPPPPAAGSTP 613

[83][TOP]
>UniRef100_UPI00001631D5 LRX2 (LEUCINE-RICH REPEAT/EXTENSIN 2); protein binding / structural
            constituent of cell wall n=1 Tax=Arabidopsis thaliana
            RepID=UPI00001631D5
          Length = 826

 Score =  166 bits (421), Expect = 1e-39
 Identities = 96/204 (47%), Positives = 109/204 (53%), Gaps = 30/204 (14%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            ++PPPP     +SP  K YPP   PPP  Y P  PPP     +SP      PPPP+  PP
Sbjct: 484  ATPPPPS--SKMSPSVKAYPP--PPPPPEYEPSPPPPS--SEMSPSVRAYPPPPPLSPPP 537

Query: 342  KKP---YHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP--YYHSPP 178
              P   Y YSSPPPP  SPPPPY YSSPPP    P    SPPPP++  +P P  YY SP 
Sbjct: 538  PSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPS 597

Query: 177  PPKKPYYYH--SPPPPVY-------SPPPPYHYSSPPPPPKKPYYY-----HSPPPPVY- 43
            P   PYY +  SPPPP Y        PPPP +Y+   PPP  P YY       PPPPVY 
Sbjct: 598  P---PYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYY 654

Query: 42   ------SPPPPYHYT----SPPPP 1
                   PPPP +Y+    SPPPP
Sbjct: 655  TPVIQSPPPPPVYYSPVTQSPPPP 678

 Score =  158 bits (400), Expect = 3e-37
 Identities = 109/239 (45%), Positives = 122/239 (51%), Gaps = 55/239 (23%)
 Frame = -3

Query: 552  SLISANSYLYSSPPPPKVYPPVSPPP--KVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYH 379
            S +S +   Y  PPPP  Y P  PPP  ++ P V + PP   PP+SPPP   P   PPY 
Sbjct: 491  SKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPP--PPLSPPP---PSPPPPYI 545

Query: 378  YSSPPPPVYSPPKKPYHYSSPPPPV------YSPPPPYHYSSPP-----PPPKKPYKY-- 238
            YSSPPPP  SPP  PY YSSPPP V       SPPPP +  +P      P P  PY    
Sbjct: 546  YSSPPPPSPSPP-PPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYT 604

Query: 237  SSPPPPEHHVSPKP-------YY--HSPPPPKKPYY----YHSPPPPVY-------SPPP 118
            SSPPPP ++ +  P       YY   SPPPP   YY       PPPPVY        PPP
Sbjct: 605  SSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPP 664

Query: 117  PYHYS----SPPPPPKKPYYY----HSPPP-PVY-------SPPPPYHY----TSPPPP 1
            P +YS    SPPPPP  P YY     SPPP PVY        PPPP +Y     SPPPP
Sbjct: 665  PVYYSPVTQSPPPPP--PVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPP 721

 Score =  152 bits (384), Expect = 2e-35
 Identities = 104/240 (43%), Positives = 112/240 (46%), Gaps = 64/240 (26%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPV-----SPPPKVY--PPVYSPPPKVYPPVSPPPKVYPPVSPPYHY- 376
            Y+YSSPPPP   PP      SPPP V   P   SPPP  Y     P + YP  SPPY+  
Sbjct: 544  YIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQY 603

Query: 375  -SSPPPPVY------SPPKKPYHYS----SPPPPVY-------SPPPPYHYS----SPPP 262
             SSPPPP Y       PP  P +Y+     PPPPVY        PPPP +Y+    SPPP
Sbjct: 604  TSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPP 663

Query: 261  PPK--KPYKYSSPPPPEHHVSPKPYYHSP---PPPKKPYYY-----HSPPPPVY------ 130
            PP    P   S PPPP       P Y+ P    PP  P YY       PPPPVY      
Sbjct: 664  PPVYYSPVTQSPPPPP-------PVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQ 716

Query: 129  SPPPPYHYSSPP----PPPKKPYYY----HSPPPP----VYSPP------PPYHYTSPPP 4
            SPPPP     PP    PPP  P YY     SPPPP     Y PP      PP  Y SPPP
Sbjct: 717  SPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPP 776

 Score =  147 bits (371), Expect = 7e-34
 Identities = 105/263 (39%), Positives = 113/263 (42%), Gaps = 78/263 (29%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPV--SPPPKVY--------------PPVY----SPPPKV 436
            PS      Y+YSSPPP    PP   SPPP  Y              PP Y    SPPP  
Sbjct: 552  PSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPT 611

Query: 435  Y-----PPVSPPPKVY----PPVSPPYHY-----SSPPPPVY------SPPKKPYHYS-- 322
            Y     PP  PPP  Y    PP  PP +Y     S PPPPVY      SPP  P +YS  
Sbjct: 612  YYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPV 671

Query: 321  ----SPPPPVYSPP------------PPYHYSSPP-----------PPPKKPYKY----S 235
                 PPPPVY PP            PP   S PP           PPP  P  Y     
Sbjct: 672  TQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAK 731

Query: 234  SPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPP-----PPKKPYY 70
            SPPPP     P P   SPPPP  P  YH P  P  SPPP   Y SPPP      P   ++
Sbjct: 732  SPPPPSPVYYP-PVTQSPPPPSTPVEYHPPASPNQSPPP--EYQSPPPKGCNDSPSNDHH 788

Query: 69   YHSPPPPVYSPPPPYHYTSPPPP 1
            Y +P PP  S PPPY+  +P PP
Sbjct: 789  YQTPTPP--SLPPPYYEDTPLPP 809

 Score =  145 bits (367), Expect = 2e-33
 Identities = 95/224 (42%), Positives = 101/224 (45%), Gaps = 50/224 (22%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYS------PPPKVYPPVS----PPPKVYPPV-----SP 388
            SSPPPP  Y   SPPP   P  Y+      PPP  YPPV+    PPP  Y PV      P
Sbjct: 605  SSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPP 664

Query: 387  PYHYSS------PPPPVY------SPPKKPYHYSSPPPPVYSPPPPYHYSSP---PPPPK 253
            P +YS       PPPPVY      SPP  P +Y   PP   SPPPP  Y  P    PPP 
Sbjct: 665  PVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYY---PPVTQSPPPPPVYYLPVTQSPPPP 721

Query: 252  KPYKY----SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSP------PPPVYSPPPP---- 115
             P  Y     SPPPP     P P   SPPPP  P  YH P      PPP Y  PPP    
Sbjct: 722  SPVYYPPVAKSPPPPSPVYYP-PVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPPKGCN 780

Query: 114  ------YHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                  +HY +P PP   P YY   P P   P     Y SPPPP
Sbjct: 781  DSPSNDHHYQTPTPPSLPPPYYEDTPLP---PIRGVSYASPPPP 821

 Score =  140 bits (352), Expect = 1e-31
 Identities = 96/222 (43%), Positives = 108/222 (48%), Gaps = 48/222 (21%)
 Frame = -3

Query: 522  SSPPPP--KVYPP--VSPPP---KVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYS-SP 367
            ++PPPP  K+ P    +PPP   K+ P   + PP     +SP  K YPP  PP  Y  SP
Sbjct: 454  ATPPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSP 513

Query: 366  PPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYH 187
            PPP  S    P   + PPPP  SPPPP    SPPPP    Y YSSPPPP     P PY +
Sbjct: 514  PPP--SSEMSPSVRAYPPPPPLSPPPP----SPPPP----YIYSSPPPPSPS-PPPPYIY 562

Query: 186  SPPPP--KKPYYYHSPPPPVY----------------------SPPPPYHYS--SPPPPP 85
            S PPP    P    SPPPP Y                      SPPPP +Y+  SPPPPP
Sbjct: 563  SSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPP 622

Query: 84   KKPYY---YHSPPPPVY-------SPPPPYHYT----SPPPP 1
               YY      PPPPVY        PPPP +YT    SPPPP
Sbjct: 623  PPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPP 664

 Score =  132 bits (332), Expect = 2e-29
 Identities = 84/199 (42%), Positives = 98/199 (49%), Gaps = 24/199 (12%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPP--KVYPPV-SPPPKVYPPVSPPYHYSSPPPPV 355
           + SPPPP     +SP  +V PP   PPP  K+ P   + PP     +SP +  + PPP  
Sbjct: 422 FFSPPPPSF--KMSPTVRVLPP---PPPSSKMSPTFRATPPPPSSKMSPSFRATPPPP-- 474

Query: 354 YSPPKKPYHYSSPPPPVYSPPPPYH-YSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPP 178
            S    P   ++PPPP     P    Y  PPPPP+      SPPPP   +SP    + PP
Sbjct: 475 -SSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYE---PSPPPPSSEMSPSVRAYPPP 530

Query: 177 P--------PKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY------- 43
           P        P  PY Y SPPPP  SPPPPY YSSPPP    P    SPPPP Y       
Sbjct: 531 PPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPR 590

Query: 42  ----SPPPPYH-YTSPPPP 1
               SP PPY+ YTS PPP
Sbjct: 591 EYYPSPSPPYYQYTSSPPP 609

 Score = 94.7 bits (234), Expect = 5e-18
 Identities = 62/147 (42%), Positives = 68/147 (46%), Gaps = 14/147 (9%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
            PS +       S PPPP  Y PV+  P    PVY PP    PP  P P  YPPV+     
Sbjct: 692  PSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPP-PPSPVYYPPVT----- 745

Query: 375  SSPPPP----VYSPPKKPYHYSSPPPPVYSPPP---------PYHYSSPPPPP-KKPYKY 238
             SPPPP     Y PP  P    SPPP   SPPP          +HY +P PP    PY  
Sbjct: 746  QSPPPPSTPVEYHPPASP--NQSPPPEYQSPPPKGCNDSPSNDHHYQTPTPPSLPPPYYE 803

Query: 237  SSPPPPEHHVSPKPYYHSPPPPKKPYY 157
             +P PP   VS    Y SPPPP  PYY
Sbjct: 804  DTPLPPIRGVS----YASPPPPSIPYY 826

[84][TOP]
>UniRef100_O48809 F24O1.18 n=1 Tax=Arabidopsis thaliana RepID=O48809_ARATH
          Length = 786

 Score =  166 bits (421), Expect = 1e-39
 Identities = 96/204 (47%), Positives = 109/204 (53%), Gaps = 30/204 (14%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            ++PPPP     +SP  K YPP   PPP  Y P  PPP     +SP      PPPP+  PP
Sbjct: 444  ATPPPPS--SKMSPSVKAYPP--PPPPPEYEPSPPPPS--SEMSPSVRAYPPPPPLSPPP 497

Query: 342  KKP---YHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP--YYHSPP 178
              P   Y YSSPPPP  SPPPPY YSSPPP    P    SPPPP++  +P P  YY SP 
Sbjct: 498  PSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPS 557

Query: 177  PPKKPYYYH--SPPPPVY-------SPPPPYHYSSPPPPPKKPYYY-----HSPPPPVY- 43
            P   PYY +  SPPPP Y        PPPP +Y+   PPP  P YY       PPPPVY 
Sbjct: 558  P---PYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYY 614

Query: 42   ------SPPPPYHYT----SPPPP 1
                   PPPP +Y+    SPPPP
Sbjct: 615  TPVIQSPPPPPVYYSPVTQSPPPP 638

 Score =  158 bits (400), Expect = 3e-37
 Identities = 109/239 (45%), Positives = 122/239 (51%), Gaps = 55/239 (23%)
 Frame = -3

Query: 552  SLISANSYLYSSPPPPKVYPPVSPPP--KVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYH 379
            S +S +   Y  PPPP  Y P  PPP  ++ P V + PP   PP+SPPP   P   PPY 
Sbjct: 451  SKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPP--PPLSPPP---PSPPPPYI 505

Query: 378  YSSPPPPVYSPPKKPYHYSSPPPPV------YSPPPPYHYSSPP-----PPPKKPYKY-- 238
            YSSPPPP  SPP  PY YSSPPP V       SPPPP +  +P      P P  PY    
Sbjct: 506  YSSPPPPSPSPP-PPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYT 564

Query: 237  SSPPPPEHHVSPKP-------YY--HSPPPPKKPYY----YHSPPPPVY-------SPPP 118
            SSPPPP ++ +  P       YY   SPPPP   YY       PPPPVY        PPP
Sbjct: 565  SSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPP 624

Query: 117  PYHYS----SPPPPPKKPYYY----HSPPP-PVY-------SPPPPYHY----TSPPPP 1
            P +YS    SPPPPP  P YY     SPPP PVY        PPPP +Y     SPPPP
Sbjct: 625  PVYYSPVTQSPPPPP--PVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPP 681

 Score =  152 bits (384), Expect = 2e-35
 Identities = 104/240 (43%), Positives = 112/240 (46%), Gaps = 64/240 (26%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPV-----SPPPKVY--PPVYSPPPKVYPPVSPPPKVYPPVSPPYHY- 376
            Y+YSSPPPP   PP      SPPP V   P   SPPP  Y     P + YP  SPPY+  
Sbjct: 504  YIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQY 563

Query: 375  -SSPPPPVY------SPPKKPYHYS----SPPPPVY-------SPPPPYHYS----SPPP 262
             SSPPPP Y       PP  P +Y+     PPPPVY        PPPP +Y+    SPPP
Sbjct: 564  TSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPP 623

Query: 261  PPK--KPYKYSSPPPPEHHVSPKPYYHSP---PPPKKPYYY-----HSPPPPVY------ 130
            PP    P   S PPPP       P Y+ P    PP  P YY       PPPPVY      
Sbjct: 624  PPVYYSPVTQSPPPPP-------PVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQ 676

Query: 129  SPPPPYHYSSPP----PPPKKPYYY----HSPPPP----VYSPP------PPYHYTSPPP 4
            SPPPP     PP    PPP  P YY     SPPPP     Y PP      PP  Y SPPP
Sbjct: 677  SPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPP 736

 Score =  147 bits (371), Expect = 7e-34
 Identities = 105/263 (39%), Positives = 113/263 (42%), Gaps = 78/263 (29%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPV--SPPPKVY--------------PPVY----SPPPKV 436
            PS      Y+YSSPPP    PP   SPPP  Y              PP Y    SPPP  
Sbjct: 512  PSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPT 571

Query: 435  Y-----PPVSPPPKVY----PPVSPPYHY-----SSPPPPVY------SPPKKPYHYS-- 322
            Y     PP  PPP  Y    PP  PP +Y     S PPPPVY      SPP  P +YS  
Sbjct: 572  YYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPV 631

Query: 321  ----SPPPPVYSPP------------PPYHYSSPP-----------PPPKKPYKY----S 235
                 PPPPVY PP            PP   S PP           PPP  P  Y     
Sbjct: 632  TQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAK 691

Query: 234  SPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPP-----PPKKPYY 70
            SPPPP     P P   SPPPP  P  YH P  P  SPPP   Y SPPP      P   ++
Sbjct: 692  SPPPPSPVYYP-PVTQSPPPPSTPVEYHPPASPNQSPPP--EYQSPPPKGCNDSPSNDHH 748

Query: 69   YHSPPPPVYSPPPPYHYTSPPPP 1
            Y +P PP  S PPPY+  +P PP
Sbjct: 749  YQTPTPP--SLPPPYYEDTPLPP 769

 Score =  145 bits (367), Expect = 2e-33
 Identities = 95/224 (42%), Positives = 101/224 (45%), Gaps = 50/224 (22%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYS------PPPKVYPPVS----PPPKVYPPV-----SP 388
            SSPPPP  Y   SPPP   P  Y+      PPP  YPPV+    PPP  Y PV      P
Sbjct: 565  SSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPP 624

Query: 387  PYHYSS------PPPPVY------SPPKKPYHYSSPPPPVYSPPPPYHYSSP---PPPPK 253
            P +YS       PPPPVY      SPP  P +Y   PP   SPPPP  Y  P    PPP 
Sbjct: 625  PVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYY---PPVTQSPPPPPVYYLPVTQSPPPP 681

Query: 252  KPYKY----SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSP------PPPVYSPPPP---- 115
             P  Y     SPPPP     P P   SPPPP  P  YH P      PPP Y  PPP    
Sbjct: 682  SPVYYPPVAKSPPPPSPVYYP-PVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPPKGCN 740

Query: 114  ------YHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                  +HY +P PP   P YY   P P   P     Y SPPPP
Sbjct: 741  DSPSNDHHYQTPTPPSLPPPYYEDTPLP---PIRGVSYASPPPP 781

 Score =  140 bits (352), Expect = 1e-31
 Identities = 96/222 (43%), Positives = 108/222 (48%), Gaps = 48/222 (21%)
 Frame = -3

Query: 522  SSPPPP--KVYPP--VSPPP---KVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYS-SP 367
            ++PPPP  K+ P    +PPP   K+ P   + PP     +SP  K YPP  PP  Y  SP
Sbjct: 414  ATPPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSP 473

Query: 366  PPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYH 187
            PPP  S    P   + PPPP  SPPPP    SPPPP    Y YSSPPPP     P PY +
Sbjct: 474  PPP--SSEMSPSVRAYPPPPPLSPPPP----SPPPP----YIYSSPPPPSPS-PPPPYIY 522

Query: 186  SPPPP--KKPYYYHSPPPPVY----------------------SPPPPYHYS--SPPPPP 85
            S PPP    P    SPPPP Y                      SPPPP +Y+  SPPPPP
Sbjct: 523  SSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPP 582

Query: 84   KKPYY---YHSPPPPVY-------SPPPPYHYT----SPPPP 1
               YY      PPPPVY        PPPP +YT    SPPPP
Sbjct: 583  PPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPP 624

 Score =  132 bits (332), Expect = 2e-29
 Identities = 84/199 (42%), Positives = 98/199 (49%), Gaps = 24/199 (12%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPP--KVYPPV-SPPPKVYPPVSPPYHYSSPPPPV 355
           + SPPPP     +SP  +V PP   PPP  K+ P   + PP     +SP +  + PPP  
Sbjct: 382 FFSPPPPSF--KMSPTVRVLPP---PPPSSKMSPTFRATPPPPSSKMSPSFRATPPPP-- 434

Query: 354 YSPPKKPYHYSSPPPPVYSPPPPYH-YSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPP 178
            S    P   ++PPPP     P    Y  PPPPP+      SPPPP   +SP    + PP
Sbjct: 435 -SSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYE---PSPPPPSSEMSPSVRAYPPP 490

Query: 177 P--------PKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY------- 43
           P        P  PY Y SPPPP  SPPPPY YSSPPP    P    SPPPP Y       
Sbjct: 491 PPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPR 550

Query: 42  ----SPPPPYH-YTSPPPP 1
               SP PPY+ YTS PPP
Sbjct: 551 EYYPSPSPPYYQYTSSPPP 569

 Score = 94.7 bits (234), Expect = 5e-18
 Identities = 62/147 (42%), Positives = 68/147 (46%), Gaps = 14/147 (9%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
            PS +       S PPPP  Y PV+  P    PVY PP    PP  P P  YPPV+     
Sbjct: 652  PSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPP-PPSPVYYPPVT----- 705

Query: 375  SSPPPP----VYSPPKKPYHYSSPPPPVYSPPP---------PYHYSSPPPPP-KKPYKY 238
             SPPPP     Y PP  P    SPPP   SPPP          +HY +P PP    PY  
Sbjct: 706  QSPPPPSTPVEYHPPASP--NQSPPPEYQSPPPKGCNDSPSNDHHYQTPTPPSLPPPYYE 763

Query: 237  SSPPPPEHHVSPKPYYHSPPPPKKPYY 157
             +P PP   VS    Y SPPPP  PYY
Sbjct: 764  DTPLPPIRGVS----YASPPPPSIPYY 786

[85][TOP]
>UniRef100_Q9FSG0 Extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG0_NICSY
          Length = 161

 Score =  165 bits (418), Expect = 2e-39
 Identities = 105/210 (50%), Positives = 110/210 (52%), Gaps = 8/210 (3%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPP 427
           + S   TL+VAL+SL+ P    AN Y YSSPP                            
Sbjct: 4   IVSLLATLVVALLSLSFPLECKAN-YYYSSPP---------------------------- 34

Query: 426 VSPPPKVYPPVSPPYHYSSPPPPVY---SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPP 256
             PP K Y        YSSPPPPVY   SPP   Y + SPPPP    PP Y Y SPPPP 
Sbjct: 35  --PPTKKYV-------YSSPPPPVYKYKSPPPPVYKHKSPPPP----PPVYKYKSPPPPV 81

Query: 255 KKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY-SPPPP-YHYSSPPPPPK 82
              YKY SPPPP       P Y SPPPP   Y    PPPPVY SPPPP Y Y SPPPPP 
Sbjct: 82  ---YKYKSPPPPP------PVYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPP 132

Query: 81  KPYYYHSPPPPVY-SPPPPYH--YTSPPPP 1
               Y SPPPPVY SPPPPYH  YTSPPPP
Sbjct: 133 ---VYKSPPPPVYKSPPPPYHYYYTSPPPP 159

[86][TOP]
>UniRef100_Q41805 Extensin-like protein n=1 Tax=Zea mays RepID=Q41805_MAIZE
          Length = 1188

 Score =  165 bits (417), Expect = 3e-39
 Identities = 100/187 (53%), Positives = 103/187 (55%), Gaps = 14/187 (7%)
 Frame = -3

Query: 522  SSPPP-----PKVYPPVSPPPKVYPPVYSPPPKVYP-----PVSPPPKVYPPVSPPYHYS 373
            SSPPP     P   P  SPPP    PV  PPP+V       PVS PP       PP   S
Sbjct: 946  SSPPPAPVSSPPATPKSSPPPA---PVNLPPPEVKSSPPPTPVSSPPPAPKSSPPPAPMS 1002

Query: 372  SPPPP-VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
            SPPPP V SPP  P   SSPPPPV SPPPP   SSPPPP K      SPPPP    SP P
Sbjct: 1003 SPPPPEVKSPP-PPAPVSSPPPPVKSPPPPAPVSSPPPPVK------SPPPPAPVSSPPP 1055

Query: 195  YYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPY 25
               SPPPP       SPPPPV SPPPP   SSPPPP   P  P    SPPPP+ SPPPP 
Sbjct: 1056 PVKSPPPPAP---ISSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPIKSPPPPA 1112

Query: 24   HYTSPPP 4
              +SPPP
Sbjct: 1113 PVSSPPP 1119

 Score =  162 bits (409), Expect = 3e-38
 Identities = 104/201 (51%), Positives = 110/201 (54%), Gaps = 16/201 (7%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVY---PPV---SPPPKVYPPVYSPP--PKVYPPVSP---PPK 409
            P+++S+      S PPP V    PP    SPPP    PV SPP  PK  PP +P   PP 
Sbjct: 918  PAMVSSPPMTPKSSPPPVVVSSPPPTVKSSPPPA---PVSSPPATPKSSPPPAPVNLPPP 974

Query: 408  VYPPVSPPYHYSSPPP-PVYSPPKKPYHYSSPPPP-VYSPPPPYHYSSPPPPPKKPYKYS 235
                  PP   SSPPP P  SPP  P   SSPPPP V SPPPP   SSPPPP K      
Sbjct: 975  EVKSSPPPTPVSSPPPAPKSSPPPAPM--SSPPPPEVKSPPPPAPVSSPPPPVK------ 1026

Query: 234  SPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYH 64
            SPPPP    SP P   SPPPP       SPPPPV SPPPP   SSPPPP   P  P    
Sbjct: 1027 SPPPPAPVSSPPPPVKSPPPPAP---VSSPPPPVKSPPPPAPISSPPPPVKSPPPPAPVS 1083

Query: 63   SPPPPVYSPPPPYHYTSPPPP 1
            SPPPPV SPPPP   +SPPPP
Sbjct: 1084 SPPPPVKSPPPPAPVSSPPPP 1104

 Score =  159 bits (403), Expect = 1e-37
 Identities = 94/213 (44%), Positives = 105/213 (49%), Gaps = 21/213 (9%)
 Frame = -3

Query: 576  ALVSLTLPSLISANSYLYSSPPPPKVYPPV-SPPPKVYPPVYSPPPKVYPPVSPPPKVYP 400
            A + +  P    A+ Y+  +PP P   PP  SP P+V PP  S PP     +SPP     
Sbjct: 455  APMPMPTPHSPPADDYVPPTPPVPGKSPPATSPSPQVQPPAASTPPPSLVKLSPPQAPVG 514

Query: 399  PVSPPYHYSSPPPPVYSP-PKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSS 232
               PP   +SPP P+ SP P  P    SPPPPV SPPPP    SPPPP   P  P   +S
Sbjct: 515  SPPPPVKTTSPPAPIGSPSPPPPVSVVSPPPPVKSPPPPAPVGSPPPPEKSPPPPAPVAS 574

Query: 231  PPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP-------- 88
            PPPP     P     SPPPP K    P    SPPPPV SPPPP   +SPPPP        
Sbjct: 575  PPPPVKSPPPPTLVASPPPPVKSPPPPAPVASPPPPVKSPPPPTPVASPPPPAPVASSPP 634

Query: 87   ----PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                P  P    SPPPP  SPPPP    S PPP
Sbjct: 635  PMKSPPPPTPVSSPPPPEKSPPPPPPAKSTPPP 667

 Score =  158 bits (400), Expect = 3e-37
 Identities = 102/187 (54%), Positives = 104/187 (55%), Gaps = 13/187 (6%)
 Frame = -3

Query: 522  SSPPPPKVYPPV-----SPPPKVYPPVYSPPP--KVYPPVSP-----PPKVYPPVSPPYH 379
            SSPPP  V  P      SPPP    PV SPPP  K  PP +P     PP+V  P  PP  
Sbjct: 962  SSPPPAPVNLPPPEVKSSPPPT---PVSSPPPAPKSSPPPAPMSSPPPPEVKSP-PPPAP 1017

Query: 378  YSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPK 199
             SSPPPPV SPP  P   SSPPPPV SPPPP   SSPPPP K      SPPPP    SP 
Sbjct: 1018 VSSPPPPVKSPPP-PAPVSSPPPPVKSPPPPAPVSSPPPPVK------SPPPPAPISSPP 1070

Query: 198  PYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPP-PYH 22
            P   SPPPP       SPPPPV SPPPP   SSPPPP K P     PP PV SPPP P  
Sbjct: 1071 PPVKSPPPPAP---VSSPPPPVKSPPPPAPVSSPPPPIKSP----PPPAPVSSPPPAPVK 1123

Query: 21   YTSPPPP 1
              S PPP
Sbjct: 1124 PPSLPPP 1130

 Score =  158 bits (399), Expect = 4e-37
 Identities = 99/205 (48%), Positives = 105/205 (51%), Gaps = 21/205 (10%)
 Frame = -3

Query: 552  SLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPP 385
            ++IS  S   SSPPP     PVS PP +     PP     P + P  SPPP V     P 
Sbjct: 888  TVISPPSEPKSSPPPT----PVSLPPPIVKSSPPPAMVSSPPMTPKSSPPPVVVSSPPPT 943

Query: 384  YHYSSPPPPVYSPPKKPYH------YSSPPPPVYSPPPPYHYSSPPPPPKK---PYKYSS 232
               S PP PV SPP  P         + PPP V S PPP   SSPPP PK    P   SS
Sbjct: 944  VKSSPPPAPVSSPPATPKSSPPPAPVNLPPPEVKSSPPPTPVSSPPPAPKSSPPPAPMSS 1003

Query: 231  PPPPEHHVSPKPY-YHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKP 76
            PPPPE    P P    SPPPP K    P    SPPPPV SPPPP   SSPPPP   P  P
Sbjct: 1004 PPPPEVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPP 1063

Query: 75   YYYHSPPPPVYSPPPPYHYTSPPPP 1
                SPPPPV SPPPP   +SPPPP
Sbjct: 1064 APISSPPPPVKSPPPPAPVSSPPPP 1088

 Score =  149 bits (375), Expect = 2e-34
 Identities = 90/186 (48%), Positives = 96/186 (51%), Gaps = 15/186 (8%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYP-PVYSPPPKVYP-PVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           P P   P VSP P   P PV +P P   P P SPP   Y P +PP    SPP    SP  
Sbjct: 432 PSPHTPPDVSPEPLPEPSPVPAPAPMPMPTPHSPPADDYVPPTPPVPGKSPPATSPSPQV 491

Query: 339 KPYHYSSPPP----------PVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYY 190
           +P   S+PPP          PV SPPPP   +SPP P   P    SPPPP   VSP P  
Sbjct: 492 QPPAASTPPPSLVKLSPPQAPVGSPPPPVKTTSPPAPIGSP----SPPPPVSVVSPPPPV 547

Query: 189 HSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHY 19
            SPPPP       SPPPP  SPPPP   +SPPPP   P  P    SPPPPV SPPPP   
Sbjct: 548 KSPPPPAP---VGSPPPPEKSPPPPAPVASPPPPVKSPPPPTLVASPPPPVKSPPPPAPV 604

Query: 18  TSPPPP 1
            SPPPP
Sbjct: 605 ASPPPP 610

 Score =  146 bits (368), Expect = 2e-33
 Identities = 87/183 (47%), Positives = 97/183 (53%), Gaps = 10/183 (5%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPV-SPPPKVYPPVSPPYHYSSPPPPVY--S 349
           +P P  +  P SPP   Y P   P P   PP  SP P+V PP +     S+PPP +   S
Sbjct: 453 APAPMPMPTPHSPPADDYVPPTPPVPGKSPPATSPSPQVQPPAA-----STPPPSLVKLS 507

Query: 348 PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
           PP+ P    SPPPPV +  PP    SP PPP  P    SPPPP     P     SPPPP+
Sbjct: 508 PPQAPV--GSPPPPVKTTSPPAPIGSPSPPP--PVSVVSPPPPVKSPPPPAPVGSPPPPE 563

Query: 168 K----PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSP 10
           K    P    SPPPPV SPPPP   +SPPPP   P  P    SPPPPV SPPPP    SP
Sbjct: 564 KSPPPPAPVASPPPPVKSPPPPTLVASPPPPVKSPPPPAPVASPPPPVKSPPPPTPVASP 623

Query: 9   PPP 1
           PPP
Sbjct: 624 PPP 626

 Score =  145 bits (367), Expect = 2e-33
 Identities = 90/179 (50%), Positives = 96/179 (53%), Gaps = 7/179 (3%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            SP PP     VSPPP    PV SPPP       PPP+  PP  PP   +SPPPPV SPP 
Sbjct: 531  SPSPPPPVSVVSPPP----PVKSPPPPAPVGSPPPPEKSPP--PPAPVASPPPPVKSPPP 584

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
             P   +SPPPPV SPPPP   +SPPPP   P  P   +SPPPP    S  P   SPPPP 
Sbjct: 585  -PTLVASPPPPVKSPPPPAPVASPPPPVKSPPPPTPVASPPPPAPVASSPPPMKSPPPPT 643

Query: 168  KPYYYHSPPPPVYSPPPP--YHYSSPPPP--PKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
                  SPPPP  SPPPP     S+PPP   P  P    S PPP  S PPP    SPPP
Sbjct: 644  P---VSSPPPPEKSPPPPPPAK-STPPPEEYPTPPTSVKSSPPPEKSLPPPTLIPSPPP 698

 Score =  140 bits (354), Expect = 6e-32
 Identities = 89/176 (50%), Positives = 94/176 (53%), Gaps = 2/176 (1%)
 Frame = -3

Query: 522  SSPPPPKVY--PPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
            SSPPPP+V   PP +P     PPV SPPP   P  SPPP V  P  PP   SSPPPPV S
Sbjct: 1002 SSPPPPEVKSPPPPAPVSSPPPPVKSPPPPA-PVSSPPPPVKSP-PPPAPVSSPPPPVKS 1059

Query: 348  PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
            PP        PP P+ SPPPP    SPPPP       SSPPPP           SPPPP 
Sbjct: 1060 PP--------PPAPISSPPPP--VKSPPPPA----PVSSPPPP---------VKSPPPPA 1096

Query: 168  KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                  SPPPP+ SPPPP   SSPPP P KP     PP PV SPPP     +P PP
Sbjct: 1097 P---VSSPPPPIKSPPPPAPVSSPPPAPVKPPSL-PPPAPVSSPPP---VVTPAPP 1145

 Score =  134 bits (338), Expect = 5e-30
 Identities = 86/192 (44%), Positives = 94/192 (48%), Gaps = 19/192 (9%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPP K  PP +P     PPV SPPP       PPP   PP  PP   +SPPPPV SPP
Sbjct: 558  SPPPPEKSPPPPAPVASPPPPVKSPPPPTLVASPPPPVKSPP--PPAPVASPPPPVKSPP 615

Query: 342  KKPYHYSSPPPP--VY-------SPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPK 199
              P   +SPPPP  V        SPPPP   SSPPPP   P  P    S PPPE + +P 
Sbjct: 616  P-PTPVASPPPPAPVASSPPPMKSPPPPTPVSSPPPPEKSPPPPPPAKSTPPPEEYPTPP 674

Query: 198  PYYHSPPPPKK---PYYYHSPPPPVYSPPPPYHYSSPPPPPKKP----YYYHSPPPPVYS 40
                S PPP+K   P      PPP   P PP   S PP  P+KP        SPP    S
Sbjct: 675  TSVKSSPPPEKSLPPPTLIPSPPPQEKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQTPKS 734

Query: 39   PPPPYHYTSPPP 4
             PPP   +SPPP
Sbjct: 735  SPPPAPVSSPPP 746

 Score =  134 bits (337), Expect = 6e-30
 Identities = 106/245 (43%), Positives = 110/245 (44%), Gaps = 71/245 (28%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSP---PPKVY----PPVY--SPPPKVYPPVSPPPKVYPPVSPPYHYSS 370
            S PP P   PP++P   PP V     PPV   SPPP    PVS PP    P SPP H SS
Sbjct: 817  SPPPAPLSSPPLAPKSSPPHVVVSSPPPVVKSSPPPA---PVSSPPLTPKPASPPAHVSS 873

Query: 369  PP-------PP----VYSPPKKPYHYSSPPP-PVYSP-------PPPYHYSSPPPPPKK- 250
            PP       PP    V SPP +P   SSPPP PV  P       PPP   SSPP  PK  
Sbjct: 874  PPEVVKPSTPPAPTTVISPPSEPK--SSPPPTPVSLPPPIVKSSPPPAMVSSPPMTPKSS 931

Query: 249  --PYKYSSP-------------------------------PPPEHHVSPKPYYHSPPPP- 172
              P   SSP                               PPPE   SP P   S PPP 
Sbjct: 932  PPPVVVSSPPPTVKSSPPPAPVSSPPATPKSSPPPAPVNLPPPEVKSSPPPTPVSSPPPA 991

Query: 171  ----KKPYYYHSPPPP-VYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYT 16
                  P    SPPPP V SPPPP   SSPPPP   P  P    SPPPPV SPPPP   +
Sbjct: 992  PKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVS 1051

Query: 15   SPPPP 1
            SPPPP
Sbjct: 1052 SPPPP 1056

 Score =  132 bits (332), Expect = 2e-29
 Identities = 89/203 (43%), Positives = 97/203 (47%), Gaps = 32/203 (15%)
 Frame = -3

Query: 519  SPPPPKVYPP-----VSPPPKVY------------PPVYSPPPKVYPPVSPPPKVY--PP 397
            SPPPP+  PP      SPPP V             PPV SPPP   P  SPPP V   PP
Sbjct: 558  SPPPPEKSPPPPAPVASPPPPVKSPPPPTLVASPPPPVKSPPPPA-PVASPPPPVKSPPP 616

Query: 396  VS------PPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPY 244
             +      PP   +S PPP+ SPP  P   SSPPPP  SPPPP    S PPP   P  P 
Sbjct: 617  PTPVASPPPPAPVASSPPPMKSPP-PPTPVSSPPPPEKSPPPPPPAKSTPPPEEYPTPPT 675

Query: 243  KYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSP----PPPYHYSSPPPPPKKP 76
               S PPPE  + P     SPPP +KP    +P  P  SP    PP    SSPP  PK  
Sbjct: 676  SVKSSPPPEKSLPPPTLIPSPPPQEKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQTPKS- 734

Query: 75   YYYHSPPPPVYSPPPPYHYTSPP 7
                SPPP   S PPP   +SPP
Sbjct: 735  ----SPPPAPVSSPPPTPVSSPP 753

 Score =  130 bits (328), Expect = 7e-29
 Identities = 86/200 (43%), Positives = 94/200 (47%), Gaps = 16/200 (8%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPVSPPPKVYPP-----VYSPPPKVYPPVSPPPKVYPPVS 391
            P+L+++      SPPPP   P  SPPP V  P     V SPPP      SPPP   PP  
Sbjct: 585  PTLVASPPPPVKSPPPPA--PVASPPPPVKSPPPPTPVASPPPPAPVASSPPPMKSPP-- 640

Query: 390  PPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPP----PP----KKPYKYS 235
            PP   SSPPPP  SPP  P   S+PPP  Y  PP    SSPPP    PP      P    
Sbjct: 641  PPTPVSSPPPPEKSPPPPPPAKSTPPPEEYPTPPTSVKSSPPPEKSLPPPTLIPSPPPQE 700

Query: 234  SPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSP- 58
             P PP     P      P PPK+P    SPP    S PPP   SSPPP P       +P 
Sbjct: 701  KPTPPSTPSKPPSSPEKPSPPKEP--VSSPPQTPKSSPPPAPVSSPPPTPVSSPPALAPV 758

Query: 57   --PPPVYSPPPPYHYTSPPP 4
              PP V S PPP   +SPPP
Sbjct: 759  SSPPSVKSSPPPAPLSSPPP 778

 Score =  130 bits (327), Expect = 9e-29
 Identities = 88/178 (49%), Positives = 91/178 (51%), Gaps = 28/178 (15%)
 Frame = -3

Query: 522  SSPPPPKVYPP----VSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPV 355
            SSPPPP   PP    VS PP   PPV SPPP   P  SPPP V  P  PP   SSPPPPV
Sbjct: 1019 SSPPPPVKSPPPPAPVSSPP---PPVKSPPPPA-PVSSPPPPVKSP-PPPAPISSPPPPV 1073

Query: 354  YSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPP---------PEHH 211
             SPP  P   SSPPPPV SPPPP   SSPPPP   P  P   SSPPP         P   
Sbjct: 1074 KSPPP-PAPVSSPPPPVKSPPPPAPVSSPPPPIKSPPPPAPVSSPPPAPVKPPSLPPPAP 1132

Query: 210  VSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYH------------YSSPPPPPKKPY 73
            VS  P   +P PPKK     S PPP  S PPP              Y+SPPPP  + Y
Sbjct: 1133 VSSPPPVVTPAPPKKEE--QSLPPPAESQPPPSFNDIILPPIMANKYASPPPPQFQGY 1188

 Score =  121 bits (303), Expect = 5e-26
 Identities = 89/206 (43%), Positives = 101/206 (49%), Gaps = 26/206 (12%)
 Frame = -3

Query: 546  ISANSYLYSSPPP-PKVYPPVSPPPKVYPP---VYSPPP--KVYPPVSP---PPKVYPPV 394
            +S+   + SSPPP P   PP +P  K  PP   V SPPP  K  PP++P   PP+V    
Sbjct: 758  VSSPPSVKSSPPPAPLSSPPPAPQVKSSPPPVQVSSPPPAPKSSPPLAPVSSPPQVEKTS 817

Query: 393  SPPYHYSSPPPPVYSPPKKPYH--YSSPPPPVYSPPPPYHYSSPP-------PP-----P 256
             PP   SSPP    +P   P H   SSPPP V S PPP   SSPP       PP     P
Sbjct: 818  PPPAPLSSPP---LAPKSSPPHVVVSSPPPVVKSSPPPAPVSSPPLTPKPASPPAHVSSP 874

Query: 255  KKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKK- 79
             +  K S+PP P   +SP     S PPP        PPP V S PPP   SSPP  PK  
Sbjct: 875  PEVVKPSTPPAPTTVISPPSEPKSSPPPTP---VSLPPPIVKSSPPPAMVSSPPMTPKSS 931

Query: 78   --PYYYHSPPPPVYSPPPPYHYTSPP 7
              P    SPPP V S PPP   +SPP
Sbjct: 932  PPPVVVSSPPPTVKSSPPPAPVSSPP 957

 Score =  119 bits (297), Expect = 3e-25
 Identities = 78/202 (38%), Positives = 94/202 (46%), Gaps = 20/202 (9%)
 Frame = -3

Query: 546 ISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSP-PYHYSS 370
           +  + ++ +  P P   PP SP P   P   +P P  + P    P+  P  SP P     
Sbjct: 399 VDCSKHVCAGYPTPGGGPPSSPVPGK-PAASAPMPSPHTPPDVSPEPLPEPSPVPAPAPM 457

Query: 369 PPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSP-KPY 193
           P P  +SPP   Y   +PP P  SPP     ++ P P  +P   S+PPP    +SP +  
Sbjct: 458 PMPTPHSPPADDYVPPTPPVPGKSPP-----ATSPSPQVQPPAASTPPPSLVKLSPPQAP 512

Query: 192 YHSPPPPKK---------------PYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYY 67
             SPPPP K               P    SPPPPV SPPPP    SPPPP   P  P   
Sbjct: 513 VGSPPPPVKTTSPPAPIGSPSPPPPVSVVSPPPPVKSPPPPAPVGSPPPPEKSPPPPAPV 572

Query: 66  HSPPPPVYSPPPPYHYTSPPPP 1
            SPPPPV SPPPP    SPPPP
Sbjct: 573 ASPPPPVKSPPPPTLVASPPPP 594

 Score =  115 bits (289), Expect = 2e-24
 Identities = 95/225 (42%), Positives = 101/225 (44%), Gaps = 39/225 (17%)
 Frame = -3

Query: 561  TLPSLISANSYLYSSPPPPKVYPPVSPP--PKVYPP---VYSPPPKVYPPVSPPPKVYPP 397
            T PS  S        P PPK  P  SPP  PK  PP   V SPPP    PVS PP + P 
Sbjct: 703  TPPSTPSKPPSSPEKPSPPKE-PVSSPPQTPKSSPPPAPVSSPPPT---PVSSPPALAPV 758

Query: 396  VSPPYHYSSPPP-PVYSPPKKPYHYSSPPP-----------------PVYSPP------- 292
             SPP   SSPPP P+ SPP  P   SSPPP                 PV SPP       
Sbjct: 759  SSPPSVKSSPPPAPLSSPPPAPQVKSSPPPVQVSSPPPAPKSSPPLAPVSSPPQVEKTSP 818

Query: 291  PPYHYSSPPPPPKK--PYKYSSPPPPEHHVSPKPYYHSPPP----PKKPYYYHSPPPPVY 130
            PP   SSPP  PK   P+   S PPP    SP P   S PP    P  P  + S PP V 
Sbjct: 819  PPAPLSSPPLAPKSSPPHVVVSSPPPVVKSSPPPAPVSSPPLTPKPASPPAHVSSPPEVV 878

Query: 129  ---SPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
               +PP P    SPP  PK      SPPP   S PPP   +SPPP
Sbjct: 879  KPSTPPAPTTVISPPSEPKS-----SPPPTPVSLPPPIVKSSPPP 918

 Score =  114 bits (286), Expect = 5e-24
 Identities = 89/210 (42%), Positives = 96/210 (45%), Gaps = 21/210 (10%)
 Frame = -3

Query: 567  SLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYP---PVYSPP--PKVYP--------- 430
            SL  P+LI +        PP     P S P K  P   PV SPP  PK  P         
Sbjct: 686  SLPPPTLIPSPPPQEKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQTPKSSPPPAPVSSPP 745

Query: 429  --PVSPPPKVYPPVSPPYHYSSPPP-PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP 259
              PVS PP + P  SPP   SSPPP P+ SPP  P   SSPPP   S PPP   SSPP  
Sbjct: 746  PTPVSSPPALAPVSSPPSVKSSPPPAPLSSPPPAPQVKSSPPPVQVSSPPPAPKSSPPLA 805

Query: 258  PKKPYKYSSPPPPEHHVSPKPYYHSPP--PPKKPYY--YHSPPPPVYSPPPPYHYSSPPP 91
            P      SSPP  E    P     SPP  P   P +    SPPP V S PPP   SSPP 
Sbjct: 806  P-----VSSPPQVEKTSPPPAPLSSPPLAPKSSPPHVVVSSPPPVVKSSPPPAPVSSPPL 860

Query: 90   PPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             PK      SPP  V SPP     ++PP P
Sbjct: 861  TPKPA----SPPAHVSSPPEVVKPSTPPAP 886

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 62/142 (43%), Positives = 68/142 (47%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
            P+ IS+      SPPPP    PVS PP   PPV SPPP   P  SPPP +  P  PP   
Sbjct: 1063 PAPISSPPPPVKSPPPP---APVSSPP---PPVKSPPPPA-PVSSPPPPIKSP-PPPAPV 1114

Query: 375  SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
            SSPPP    PP  P     PP PV SPPP       P PPKK  +  S PPP     P  
Sbjct: 1115 SSPPPAPVKPPSLP-----PPAPVSSPPPVV----TPAPPKK--EEQSLPPPAESQPPPS 1163

Query: 195  YYHSPPPPKKPYYYHSPPPPVY 130
            +     PP     Y SPPPP +
Sbjct: 1164 FNDIILPPIMANKYASPPPPQF 1185

[87][TOP]
>UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK5_CHLRE
          Length = 853

 Score =  165 bits (417), Expect = 3e-39
 Identities = 89/173 (51%), Positives = 90/173 (52%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP     PPPP   PP 
Sbjct: 191 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 248

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P   S PPPP  SPPPP    SPPPP   P    SPPPP     P P   SPPPP    
Sbjct: 249 SPPPPSPPPPPPPSPPPP----SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP---- 300

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPP   PPPP     P PPP  P     PPPP  SPPPP   + PPPP
Sbjct: 301 ---SPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 350

 Score =  164 bits (416), Expect = 4e-39
 Identities = 93/174 (53%), Positives = 93/174 (53%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
           S PPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP     PPPP   PP
Sbjct: 381 SPPPPPPPSPPPPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 438

Query: 342 KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
             P   S PPPP  SPPPP   S PPPPP  P   S PPP     SP P    PPPP  P
Sbjct: 439 PPPP--SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 496

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                PPPP  SPPPP   S PPP P  P    SPPPP  SPPPP    SPPPP
Sbjct: 497 -----PPPPPPSPPPPPPPSPPPPSPPPP----SPPPP--SPPPP----SPPPP 535

 Score =  162 bits (411), Expect = 2e-38
 Identities = 95/176 (53%), Positives = 95/176 (53%), Gaps = 3/176 (1%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYP---PVSPPYHYSSPPPPVYS 349
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   P   P SPP     PPPP   
Sbjct: 206 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSP 263

Query: 348 PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
           PP  P   S PPPP  SPPPP   S PPPPP  P    SPPPP     P P   SPPPP 
Sbjct: 264 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP-PSPPPPSPPPPPPP---SPPPPS 319

Query: 168 KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            P    SPPPP  SPPPP   S PPPPP  P     PPPP  SPPPP    SPPPP
Sbjct: 320 PPP--PSPPPP--SPPPPPPPSPPPPPPPSP-----PPPPPPSPPPP----SPPPP 362

 Score =  160 bits (405), Expect = 8e-38
 Identities = 90/172 (52%), Positives = 90/172 (52%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  P     SPPPP   PP  
Sbjct: 310 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 369

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P   S PPPP  SPPPP   S PPPPP  P   S PPP     SP P   SPPPP  P  
Sbjct: 370 PPP-SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPP-P 425

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP  SPPPP   S PPPPP  P     PPPP  SPPPP    SPPPP
Sbjct: 426 PSPPPPPPPSPPPPPPPSPPPPPPPSP-----PPPPPPSPPPP-PPPSPPPP 471

 Score =  160 bits (404), Expect = 1e-37
 Identities = 93/173 (53%), Positives = 93/173 (53%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP SPPP   PP  SPPP   PP SPPP   PP SPP      PPP   PP 
Sbjct: 272 SPPPP---PPPSPPP---PPPPSPPPP--PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 323

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P   S PPPP  SPPPP   S PPPPP  P   S PPP     SP P    PPPP  P 
Sbjct: 324 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP- 382

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP  SPPPP   S PPP P  P    SPPPP  SPPPP    SPPPP
Sbjct: 383 ----PPPPPPSPPPPPPPSPPPPSPPPP----SPPPP--SPPPP----SPPPP 421

 Score =  158 bits (400), Expect = 3e-37
 Identities = 93/173 (53%), Positives = 93/173 (53%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP SPPP   PP  SPPP   PP SPPP   PP SPP    SPPPP   PP 
Sbjct: 329 SPPPP---PPPSPPP---PPPPSPPPP--PPPSPPPPSPPPPSPPP--PSPPPPSPPPPP 378

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P   S PPPP  SPPPP   S PPP P  P      PPP     P P   SPPPP  P 
Sbjct: 379 PP---SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP- 434

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP  SPPPP   S PPPPP  P     PPPP  SPPPP    SPPPP
Sbjct: 435 --SPPPPPPPSPPPPPPPSPPPPPPPSP-----PPPPPPSPPPP----SPPPP 476

 Score =  158 bits (399), Expect = 4e-37
 Identities = 91/178 (51%), Positives = 92/178 (51%), Gaps = 5/178 (2%)
 Frame = -3

Query: 519 SPPPPKVYPP-VSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
           SPPPP   PP   PPP   PP  SPPP   PP SPPP   P   PP   S PPPP  SPP
Sbjct: 296 SPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 355

Query: 342 KKPYHYSSPP---PPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP 172
                  SPP   PP  SPPPP   S PPPPP  P     PPPP     P P   SPPPP
Sbjct: 356 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP----PPPPPPSPPPPSPPPPSPPPP 411

Query: 171 KKPYYYHSPP-PPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             P     PP PP  SPPPP   S PPPPP  P     PPPP  SPPPP   + PPPP
Sbjct: 412 SPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP-----PPPPPPSPPPPPPPSPPPPP 464

 Score =  158 bits (399), Expect = 4e-37
 Identities = 90/177 (50%), Positives = 90/177 (50%), Gaps = 4/177 (2%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP   PPP   PP  PPP   PP  P     SPPPP   PP 
Sbjct: 353 SPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPS 412

Query: 339 KPYHYSSPP-PPVYSPPPPYHYSSPPPPPKK--PYKYSSPPPPEHHVSPKPYYHSPPPPK 169
            P     PP PP  SPPPP   S PPPPP    P    SPPPP     P P   SPPPP 
Sbjct: 413 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 472

Query: 168 KPYYYHSPP-PPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            P     PP PP  SPPPP   S PPPPP  P     PPPP  SPPPP    SPPPP
Sbjct: 473 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP-----PPPPPPSPPPP----SPPPP 520

 Score =  157 bits (396), Expect = 9e-37
 Identities = 89/175 (50%), Positives = 89/175 (50%), Gaps = 2/175 (1%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP   PPP   PP  PPP    P  PP     PPPP   PP 
Sbjct: 244 SPPPPSPPPPSPPPP---PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 300

Query: 339 KPYHYSSPPPPVYSPPPPYHYS-SPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
            P   S PPPP  SPPPP     SPPPP   P    SPPPP     P P   SPPPP  P
Sbjct: 301 SPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 360

Query: 162 YYYHSPP-PPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                PP PP  SPPPP   S PPPPP  P     PPPP  SPPPP    SPPPP
Sbjct: 361 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSP-----PPPPPPSPPPP----SPPPP 406

 Score =  156 bits (395), Expect = 1e-36
 Identities = 89/173 (51%), Positives = 89/173 (51%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP 
Sbjct: 262 SPPPPSPPPPSPPPPP--PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPS 319

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P    SPPPP  SPPPP   S PPPPP  P     PPPP     P P   SPPPP  P 
Sbjct: 320 PPP--PSPPPP--SPPPPPPPSPPPPPPPSP----PPPPPPSPPPPSPPPPSPPPPSPPP 371

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P    SPPPP  SPPPP    SPPPP
Sbjct: 372 PSPPPPPPPSPPPPPPPSPPPPPPPSPP--PPSPPPP--SPPPP----SPPPP 416

 Score =  155 bits (392), Expect = 3e-36
 Identities = 90/175 (51%), Positives = 91/175 (52%), Gaps = 2/175 (1%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP SPPP   PP   PPP   PP SPPP   PP SPP     PPPP   PP 
Sbjct: 288 SPPPP---PPPSPPPPSPPPPSPPPP---PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 341

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P   S PPPP  SPPPP      PPPP  P    SPPPP     P P   SPPPP  P 
Sbjct: 342 PPP--SPPPPPPPSPPPPSPPPPSPPPPSPP--PPSPPPPPPPSPPPPPPPSPPPPPPP- 396

Query: 159 YYHSPPPPVYSPPPPYHYSSPP--PPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPP   PP P   S PP  PPP  P     PPPP  SPPPP   + PPPP
Sbjct: 397 ---SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 448

 Score =  155 bits (392), Expect = 3e-36
 Identities = 89/173 (51%), Positives = 89/173 (51%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   P   PP   S PPPP  SPP 
Sbjct: 397 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 454

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P   S PPPP  SPPPP      PPPP  P    SPPPP     P P   SPPPP  P 
Sbjct: 455 PPPP-SPPPPPPPSPPPPSPPPPSPPPPSPP--PPSPPPPPPPSPPPPPPPSPPPPPPP- 510

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPP  SPPPP      PPPP  P     PPPP   PPP     SPPPP
Sbjct: 511 ---SPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558

 Score =  155 bits (391), Expect = 3e-36
 Identities = 90/173 (52%), Positives = 90/173 (52%), Gaps = 1/173 (0%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP SPPP   PP   PPP   PP SPPP   PP  PP   S PPPP  SPP  
Sbjct: 239 PPPPPSPPPPSPPPPSPPP---PPPPSPPPPSPPPPSPPPPPPP---SPPPPPPPSPPPP 292

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPP-PEHHVSPKPYYHSPPPPKKPY 160
           P    SPPPP  SPPPP   S PPPPP  P   S PPP P     P P   SPPPP  P 
Sbjct: 293 PP--PSPPPP--SPPPP---SPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP- 344

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP  SPPPP      PPPP  P     PPPP   PPPP     PPPP
Sbjct: 345 --SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395

 Score =  155 bits (391), Expect = 3e-36
 Identities = 86/174 (49%), Positives = 86/174 (49%), Gaps = 2/174 (1%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP SPPP   PP   PPP   PP  P P   PP SPP     PPPP   PP  
Sbjct: 348 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP-----PPPPPSPPPPS 402

Query: 336 PYHYSSPPP--PVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
           P   S PPP  P  SPPPP    SPPPP   P    SPPPP     P P   SPPPP  P
Sbjct: 403 PPPPSPPPPSPPPPSPPPP----SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 458

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                PPPP  SPPPP      PPPP  P     PPPP   PPPP     PPPP
Sbjct: 459 ---SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509

 Score =  154 bits (389), Expect = 6e-36
 Identities = 94/173 (54%), Positives = 94/173 (54%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP SPPP   PP  SPPP   PP SPPP   PP SPP    SPPPP   PP 
Sbjct: 226 SPPPPSP-PPPSPPP---PPPPSPPPPSPPPPSPPPP--PPPSPP--PPSPPPPSPPPPP 277

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P   S PPPP  SPPPP   S PPP P  P    SPPPP     P P   SPPPP  P 
Sbjct: 278 PP---SPPPPPPPSPPPPPPPSPPPPSPPPP----SPPPPPPPSPPPP---SPPPPSPPP 327

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P    SPPPP  SPPPP    SPPPP
Sbjct: 328 PSPPPPPPPSPPPPPPPSPPPPPPPSPP--PPSPPPP--SPPPP----SPPPP 372

 Score =  154 bits (389), Expect = 6e-36
 Identities = 91/180 (50%), Positives = 92/180 (51%), Gaps = 7/180 (3%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP SPPP   PP   PPP   PP SPPP   PP SPP     PPPP   PP 
Sbjct: 236 SPPPP---PPPSPPPPSPPPPSPPPP---PPPSPPPPSPPPPSPP----PPPPPSPPPPP 285

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P   S PPPP  SPPPP   S PPP P  P   S PPP     SP P    PPPP  P 
Sbjct: 286 PP---SPPPPPPPSPPPP---SPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSP- 338

Query: 159 YYHSPPPPVYSPPPPYHYSSPP-------PPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP  SPPPP   S PP       PPP  P     PPPP  SPPPP   + PPPP
Sbjct: 339 ----PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 394

 Score =  122 bits (307), Expect = 2e-26
 Identities = 83/165 (50%), Positives = 83/165 (50%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
           S PPPP   PP  PPP   PP  SPPP   PP SPPP   PP  PP   S PPPP  SPP
Sbjct: 451 SPPPPPPPSPPPPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPPPP---SPPPPPPPSPP 505

Query: 342 KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
             P    SPPPP  SPPPP    SPPPP        SPPPP           SPPPP   
Sbjct: 506 PPPP--PSPPPP--SPPPP----SPPPP--------SPPPP-----------SPPPP--- 535

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPP 28
               SPPPP   PPP     SPPPP        SPPPP  SPPPP
Sbjct: 536 ----SPPPP---PPP-----SPPPP--------SPPPP--SPPPP 558

 Score =  110 bits (275), Expect = 9e-23
 Identities = 77/164 (46%), Positives = 79/164 (48%)
 Frame = -3

Query: 492 PVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPP 313
           P+S P    PP  SPPP   PP SPPP             SPPPP   PP       SPP
Sbjct: 183 PISTPGIPSPPPPSPPPPSPPPPSPPPP------------SPPPPSPPPP-------SPP 223

Query: 312 PPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV 133
           PP  SPPPP    SPPPP        SPPPP     P P   SPPPP       SPPPP 
Sbjct: 224 PP--SPPPP----SPPPP--------SPPPP-----PPP---SPPPP-------SPPPPS 254

Query: 132 YSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             PPPP    SPPPP        SPPPP  SPPPP   + PPPP
Sbjct: 255 PPPPPP---PSPPPP--------SPPPP--SPPPPPPPSPPPPP 285

[88][TOP]
>UniRef100_A3KD20 Leucine-rich repeat/extensin n=1 Tax=Nicotiana plumbaginifolia
            RepID=A3KD20_NICPL
          Length = 725

 Score =  164 bits (416), Expect = 4e-39
 Identities = 93/200 (46%), Positives = 106/200 (53%), Gaps = 26/200 (13%)
 Frame = -3

Query: 522  SSPPPPKV------YPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY------PPVSPPYH 379
            S PPPP V      Y P SPPP   PPV+  PP  Y P SPPP VY      PP +P Y 
Sbjct: 533  SPPPPPPVHYEPPTYTPQSPPPP--PPVHYEPP-TYTPHSPPPPVYVTPSSPPPPTPVYE 589

Query: 378  YSSPPPPV-YSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP-PPPEHHVS 205
            + +P PP  Y+PP++P H + P PP   PP P        PP  P+    P PPP ++ S
Sbjct: 590  HPTPSPPAGYTPPQEPSHPAPPTPPCNEPPTP--------PPSTPHWQPKPSPPPTYNPS 641

Query: 204  PKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPY 25
            P  Y  SPPPP   Y Y SPPPP  SPPPP +Y S PPPP  P    SPPPP  SPPPP 
Sbjct: 642  PS-YTQSPPPPPPTYTYSSPPPPSPSPPPPTYYYSSPPPPSPPPPSPSPPPPSPSPPPPS 700

Query: 24   H------------YTSPPPP 1
            +            Y SPPPP
Sbjct: 701  YEHVPLPPVVGVSYASPPPP 720

 Score =  160 bits (404), Expect = 1e-37
 Identities = 104/259 (40%), Positives = 118/259 (45%), Gaps = 74/259 (28%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPVSPPPKVY------------PPVY---------SPPPK 439
            PS  S+ S+   SPPPP+  PP SPPP VY            PP +         SPPP 
Sbjct: 425  PSSKSSGSHFKRSPPPPQSTPPPSPPPPVYSSSPSHKHRSPPPPTHKISPVTRHASPPPP 484

Query: 438  VYPPV--------SPPPKVY-----------PPVSPPYHYSSP---------PPPVY--- 352
               PV         PPP VY           PP  PP HY  P         PPPV+   
Sbjct: 485  PPSPVYYHHPSPSPPPPPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEP 544

Query: 351  -------SPPKKPYHYSSPPPPVYSPPPPYHY--SSPPPP--------PKKPYKYSSPPP 223
                    PP  P HY  P    +SPPPP +   SSPPPP        P  P  Y+ P  
Sbjct: 545  PTYTPQSPPPPPPVHYEPPTYTPHSPPPPVYVTPSSPPPPTPVYEHPTPSPPAGYTPPQE 604

Query: 222  PEHHVSPKPYYHSPP--PPKKPYYYHSP-PPPVYSPPPPYHYSSPPPPPKKP-YYYHSPP 55
            P H   P P  + PP  PP  P++   P PPP Y+P P Y  S PPPPP    Y Y SPP
Sbjct: 605  PSHPAPPTPPCNEPPTPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPP---TYTYSSPP 661

Query: 54   PPVYSPPPP-YHYTSPPPP 1
            PP  SPPPP Y+Y+SPPPP
Sbjct: 662  PPSPSPPPPTYYYSSPPPP 680

 Score =  137 bits (346), Expect = 5e-31
 Identities = 88/218 (40%), Positives = 101/218 (46%), Gaps = 47/218 (21%)
 Frame = -3

Query: 513  PPPKVYPPVSPPP---KVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            P PK  P    PP   K   P  S P +   P+  PP      S  +   SPPPP  +PP
Sbjct: 387  PRPKPTPKPKRPPVQNKPPAPKPSTPSRPVAPIESPPPPSSKSSGSHFKRSPPPPQSTPP 446

Query: 342  KKPYHYSSPPPPVY---------SPPPPYH-------YSSPPPPPKKPYKY-----SSPP 226
                   SPPPPVY         SPPPP H       ++SPPPPP  P  Y     S PP
Sbjct: 447  ------PSPPPPVYSSSPSHKHRSPPPPTHKISPVTRHASPPPPPPSPVYYHHPSPSPPP 500

Query: 225  PPEHHVSPKPYYHSPPPPKKPYYYH---------SPPPPVYSPPPPYHYSSPPPPPKKPY 73
            PP ++  P     SPPPP  P +Y           PPPPV+  PP Y   SPPPPP  P 
Sbjct: 501  PPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPQSPPPPP--PV 558

Query: 72   YY-------HSPPPPVY----SPPPP---YHYTSPPPP 1
            +Y       HSPPPPVY    SPPPP   Y + +P PP
Sbjct: 559  HYEPPTYTPHSPPPPVYVTPSSPPPPTPVYEHPTPSPP 596

 Score =  129 bits (323), Expect = 3e-28
 Identities = 78/175 (44%), Positives = 87/175 (49%), Gaps = 22/175 (12%)
 Frame = -3

Query: 459 VYSPPPKVYP-PVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPY 283
           V  P PK  P P  PP +  PP   P   S P  P+ SPP  P   SS      SPPPP 
Sbjct: 384 VVKPRPKPTPKPKRPPVQNKPPAPKPSTPSRPVAPIESPPP-PSSKSSGSHFKRSPPPPQ 442

Query: 282 HYSSPPPPPKKP-------YKYSSPPPPEHHVSPKPYYHS-PPPPKKPYYYH-----SPP 142
             S+PPP P  P       +K+ SPPPP H +SP   + S PPPP  P YYH      PP
Sbjct: 443 --STPPPSPPPPVYSSSPSHKHRSPPPPTHKISPVTRHASPPPPPPSPVYYHHPSPSPPP 500

Query: 141 PPVYSPPPPYHYSSPPPPPKKPYY--------YHSPPPPVYSPPPPYHYTSPPPP 1
           PPVY  PP Y   SPPPPP   +Y           PPPPV+  PP Y   SPPPP
Sbjct: 501 PPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPQSPPPP 555

 Score =  119 bits (299), Expect = 2e-25
 Identities = 74/176 (42%), Positives = 83/176 (47%), Gaps = 13/176 (7%)
 Frame = -3

Query: 489 VSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPP 310
           V P PK  P    PP +  PP   P     PV+P     SPPPP  S      H+   PP
Sbjct: 385 VKPRPKPTPKPKRPPVQNKPPAPKPSTPSRPVAP---IESPPPP--SSKSSGSHFKRSPP 439

Query: 309 PVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPP 139
           P  S PPP    SPPPP       +K+ SPPPP H +SP   + SPPPP        PP 
Sbjct: 440 PPQSTPPP----SPPPPVYSSSPSHKHRSPPPPTHKISPVTRHASPPPP--------PPS 487

Query: 138 PVYSPPPPYHYSSPPPPPKKPYYY----------HSPPPPVYSPPPPYHYTSPPPP 1
           PVY     YH+ SP PPP  P YY            PPPPV+  PP Y   SPPPP
Sbjct: 488 PVY-----YHHPSPSPPP-PPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPP 537

 Score =  119 bits (297), Expect = 3e-25
 Identities = 70/160 (43%), Positives = 74/160 (46%), Gaps = 26/160 (16%)
 Frame = -3

Query: 534  SYLYSSPPPPKVYPPVSPPPKVYPPVY-----SPPPKVYPPVSP-------PPKVYPPVS 391
            +Y   SPPPP    P SPPP    PVY     SPP    PP  P       PP   PP  
Sbjct: 564  TYTPHSPPPPVYVTPSSPPPPT--PVYEHPTPSPPAGYTPPQEPSHPAPPTPPCNEPPTP 621

Query: 390  PP----YHYSSPPPPVYSP----------PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPK 253
            PP    +     PPP Y+P          P   Y YSSPPPP  SPPPP +Y S PPPP 
Sbjct: 622  PPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPSPSPPPPTYYYSSPPPPS 681

Query: 252  KPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV 133
             P    SPPPP     P  Y H P PP     Y SPPPPV
Sbjct: 682  PPPPSPSPPPPSPSPPPPSYEHVPLPPVVGVSYASPPPPV 721

 Score =  110 bits (276), Expect = 7e-23
 Identities = 62/131 (47%), Positives = 69/131 (52%), Gaps = 8/131 (6%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY---PPVSPPYHYSSPPPPV 355
           + +PP P    P +PPP    P + P P   P  +P P      PP  P Y YSSPPPP 
Sbjct: 607 HPAPPTPPCNEPPTPPPST--PHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPS 664

Query: 354 YSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP-----YY 190
            SPP   Y+YSSPPPP  SPPPP    SP PPP  P    SPPPP +   P P      Y
Sbjct: 665 PSPPPPTYYYSSPPPP--SPPPP----SPSPPPPSP----SPPPPSYEHVPLPPVVGVSY 714

Query: 189 HSPPPPKKPYY 157
            SPPPP  PYY
Sbjct: 715 ASPPPPVIPYY 725

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 49/112 (43%), Positives = 53/112 (47%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           P+   + SY  S PPPP  Y   SPPP              P  SPPP       P Y+Y
Sbjct: 636 PTYNPSPSYTQSPPPPPPTYTYSSPPP--------------PSPSPPP-------PTYYY 674

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPP 220
           SSPPPP   PP       SPPPP  SPPPP  Y   P PP     Y+SPPPP
Sbjct: 675 SSPPPPSPPPPS-----PSPPPPSPSPPPP-SYEHVPLPPVVGVSYASPPPP 720

[89][TOP]
>UniRef100_UPI0001A7B0C1 protein binding / structural constituent of cell wall n=1
            Tax=Arabidopsis thaliana RepID=UPI0001A7B0C1
          Length = 857

 Score =  163 bits (413), Expect = 9e-39
 Identities = 95/208 (45%), Positives = 110/208 (52%), Gaps = 32/208 (15%)
 Frame = -3

Query: 528  LYSSPPPPKVYPPVSP--------PPKVYPPVYSPPPKVYPPVSPPPKVY-----PPVSP 388
            +YS PPP   YPP  P        PP   PP +SP P + PP   PP+ Y     PP  P
Sbjct: 624  VYSPPPPSTGYPPPPPFTGYSPPSPPPPPPPTFSPSPSIPPP---PPQTYSPFPPPPPPP 680

Query: 387  PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP--PPPEH 214
            P  Y  P P    PP+ P + + PP P+   P P  ++SPPPP   PY YSSP  PPP H
Sbjct: 681  PQTYYPPQPSPSQPPQSPIYGTPPPSPIPYLPSPPQFASPPPPA--PYYYSSPQPPPPPH 738

Query: 213  HVSPKP----YYHSPPPPKKPYYYHSPPPPV------YSPPPP--YHYSSPPPPPKKPYY 70
            +  P P    +Y SPPPP  P   HSPPP        YSPPPP   HY+ PPPPP   +Y
Sbjct: 739  YSLPPPTPTYHYISPPPPPTPI--HSPPPQSHPPCIEYSPPPPPTVHYN-PPPPPSPAHY 795

Query: 69   YHSPPPPVY---SPPPP--YHYTSPPPP 1
               P PPVY   SPPPP   HY+ PPPP
Sbjct: 796  SPPPSPPVYYYNSPPPPPAVHYSPPPPP 823

 Score =  158 bits (400), Expect = 3e-37
 Identities = 94/202 (46%), Positives = 107/202 (52%), Gaps = 30/202 (14%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPK--VY--PPVSPPYHYSSPPPPVYS 349
            PPPP+ Y P  PPP   P  Y PP    P  S PP+  +Y  PP SP  +  SPP     
Sbjct: 664  PPPPQTYSPFPPPPPPPPQTYYPPQ---PSPSQPPQSPIYGTPPPSPIPYLPSPPQFASP 720

Query: 348  PPKKPYHYS---SPPPPVYSPPPP---YHYSSPPPPPKKPY-----------KYSSPPPP 220
            PP  PY+YS    PPPP YS PPP   YHY SPPPPP   +           +YS PPPP
Sbjct: 721  PPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPP 780

Query: 219  EHHVS----PKPYYHSPPPPKKPYYYHSPPPPV---YSPPPP--YHYSSPPPPPKKPYYY 67
              H +    P P ++SPPP    YYY+SPPPP    YSPPPP   H+S PPPPP     Y
Sbjct: 781  TVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPP----IY 836

Query: 66   HSPPPPVYSPPPPYHYTSPPPP 1
              P PP+    P   Y SPPPP
Sbjct: 837  EGPLPPI----PGISYASPPPP 854

 Score =  158 bits (399), Expect = 4e-37
 Identities = 107/238 (44%), Positives = 116/238 (48%), Gaps = 66/238 (27%)
 Frame = -3

Query: 516  PPPPKVYP-PVSPPPKVYPPVYSPPPKV--YPPVSPPPKV-YPPVSPPYHYSSPPPPVYS 349
            P PP V P P SPPP    PVYSPPP    YPP  PPP   Y P SPP     PPPP +S
Sbjct: 604  PSPPIVGPTPSSPPPSTPTPVYSPPPPSTGYPP--PPPFTGYSPPSPP----PPPPPTFS 657

Query: 348  P-----PKKPYHYSSPPPPVYSPPPPYH--------------YSSPP------------- 265
            P     P  P  YS  PPP   PP  Y+              Y +PP             
Sbjct: 658  PSPSIPPPPPQTYSPFPPPPPPPPQTYYPPQPSPSQPPQSPIYGTPPPSPIPYLPSPPQF 717

Query: 264  --PPPKKPYKYSS--PPPPEHHVSPKP----YYHSPPPPKKPYYYHSPPPP------VYS 127
              PPP  PY YSS  PPPP H+  P P    +Y SPPPP  P   HSPPP        YS
Sbjct: 718  ASPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTP--IHSPPPQSHPPCIEYS 775

Query: 126  PPPP--YHYSSPPP-------PPKKP--YYYHSPPPPV---YSPPPP--YHYTSPPPP 1
            PPPP   HY+ PPP       PP  P  YYY+SPPPP    YSPPPP   H++ PPPP
Sbjct: 776  PPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPP 833

 Score =  154 bits (389), Expect = 6e-36
 Identities = 97/214 (45%), Positives = 104/214 (48%), Gaps = 39/214 (18%)
 Frame = -3

Query: 525  YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPV--Y 352
            ++ P PP    P  PP    PP+  P P   PP +P P   PP  PP     PPPP   Y
Sbjct: 586  FTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTPVYSPP--PPSTGYPPPPPFTGY 643

Query: 351  SPPKKPYHYSSPPPPVYS------PPPPYHYSS-PPPPPKKPYKYSSP-----PPPEHHV 208
            SPP  P     PPPP +S      PPPP  YS  PPPPP  P  Y  P      PP+  +
Sbjct: 644  SPPSPP----PPPPPTFSPSPSIPPPPPQTYSPFPPPPPPPPQTYYPPQPSPSQPPQSPI 699

Query: 207  ------SPKPYYHSP-----PPPKKPYYYHS---PPPPVYSPPPP---YHYSSPPPPPKK 79
                  SP PY  SP     PPP  PYYY S   PPPP YS PPP   YHY SPPPPP  
Sbjct: 700  YGTPPPSPIPYLPSPPQFASPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTP 759

Query: 78   PYYYHSPPPP------VYSPPPP--YHYTSPPPP 1
                HSPPP        YSPPPP   HY  PPPP
Sbjct: 760  ---IHSPPPQSHPPCIEYSPPPPPTVHYNPPPPP 790

 Score =  140 bits (354), Expect = 6e-32
 Identities = 98/219 (44%), Positives = 103/219 (47%), Gaps = 46/219 (21%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVY------PPVSPPPKVYPPVSPPYHYSSPPPP 358
            SPP P    P SP P   PP  S PP         PP+ P P    P SPP   S P PP
Sbjct: 545  SPPSPSSPTPSSPIPS--PPTPSTPPTPISPGQNSPPIIPSPPFTGP-SPPSSPSPPLPP 601

Query: 357  VY-SPPKKPYHYSSPPP----PVYSPPPP------------YHYSSPPPPPKKPYKYSS- 232
            V  SPP      SSPPP    PVYSPPPP            Y   SPPPPP   +  S  
Sbjct: 602  VIPSPPIVGPTPSSPPPSTPTPVYSPPPPSTGYPPPPPFTGYSPPSPPPPPPPTFSPSPS 661

Query: 231  -PPPPEHHVSPKPYYHSPPPPKKPYYYHSPPP--------PVYSPPPPY---HYSSPP-- 94
             PPPP    SP P    PPPP  P  Y+ P P        P+Y  PPP    +  SPP  
Sbjct: 662  IPPPPPQTYSPFP----PPPPPPPQTYYPPQPSPSQPPQSPIYGTPPPSPIPYLPSPPQF 717

Query: 93   --PPPKKPYYYHS---PPPPVYSPPPP---YHYTSPPPP 1
              PPP  PYYY S   PPPP YS PPP   YHY SPPPP
Sbjct: 718  ASPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPP 756

 Score =  123 bits (308), Expect = 1e-26
 Identities = 74/164 (45%), Positives = 85/164 (51%), Gaps = 6/164 (3%)
 Frame = -3

Query: 558  LPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYS--PPPKVYPPVSPPPKVYPPVSPP 385
            +P L S   +    PP P  Y    PPP   PP YS  PP   Y  +SPPP   P  SPP
Sbjct: 708  IPYLPSPPQFASPPPPAPYYYSSPQPPP---PPHYSLPPPTPTYHYISPPPPPTPIHSPP 764

Query: 384  YHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVS 205
               S PP   YSPP  P  + +PPP    PP P HYS PP PP   Y Y+SPPPP     
Sbjct: 765  -PQSHPPCIEYSPPPPPTVHYNPPP----PPSPAHYSPPPSPP--VYYYNSPPPP----- 812

Query: 204  PKPYYHSPPPPKKPYYYHSPPPPVYSPP----PPYHYSSPPPPP 85
            P  +Y SPPPP   ++   PPPP+Y  P    P   Y+SPPPPP
Sbjct: 813  PAVHY-SPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPPP 855

 Score =  115 bits (287), Expect = 4e-24
 Identities = 76/205 (37%), Positives = 85/205 (41%), Gaps = 32/205 (15%)
 Frame = -3

Query: 519  SPPPPKVYP--------PVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
            SP PP   P        P SPP    P   SP P    P +PP  + P  + P    SPP
Sbjct: 526  SPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPP 585

Query: 363  PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHS 184
                SPP  P   S P PPV   PP    +   PPP  P    SPPPP     P P +  
Sbjct: 586  FTGPSPPSSP---SPPLPPVIPSPPIVGPTPSSPPPSTPTPVYSPPPPSTGYPPPPPFTG 642

Query: 183  PPPPKKPYYYHSPPPPVYSP------PPPYHYSS-PPPPPKKPYYYHSPPP--------P 49
              PP  P     PPPP +SP      PPP  YS  PPPPP  P  Y+ P P        P
Sbjct: 643  YSPPSPP----PPPPPTFSPSPSIPPPPPQTYSPFPPPPPPPPQTYYPPQPSPSQPPQSP 698

Query: 48   VYSPPPPY---------HYTSPPPP 1
            +Y  PPP           + SPPPP
Sbjct: 699  IYGTPPPSPIPYLPSPPQFASPPPP 723

 Score =  102 bits (255), Expect = 2e-20
 Identities = 78/199 (39%), Positives = 84/199 (42%), Gaps = 26/199 (13%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSP--------PYHYSSPP 364
            SPP P + P    PP   P   SPP     P +P P   PP SP        P    + P
Sbjct: 448  SPPSPSIVPS---PPSTTPSPGSPPTS---PTTPTPGGSPPSSPTTPTPGGSPPSSPTTP 501

Query: 363  PPVYSPPKKPYHYS---SPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP--PPPEHHVSPK 199
             P  SPP  P   S   SPP P  SP PP    SPP  P  P    SP  P P   +   
Sbjct: 502  TPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSP 561

Query: 198  PYYHSPPPPKKPYYYHSPP----PPVYSPPPPYHYSSPPPP--PKKPYY---YHSPPP-- 52
            P   +PP P  P   +SPP    PP   P PP   S P PP  P  P       SPPP  
Sbjct: 562  PTPSTPPTPISP-GQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPST 620

Query: 51   --PVYSPPPPYHYTSPPPP 1
              PVYSPPPP     PPPP
Sbjct: 621  PTPVYSPPPPSTGYPPPPP 639

 Score = 82.0 bits (201), Expect = 4e-14
 Identities = 67/170 (39%), Positives = 69/170 (40%), Gaps = 10/170 (5%)
 Frame = -3

Query: 480 PPKVYPPVYSPPPKVYPPVSPP-PKVYPPVSPPYHYSSPP--------PPVYS-PPKKPY 331
           PP V P   SPP    P  SPP P + P  SPP    SPP        PP  S  P  P 
Sbjct: 406 PPVVVP---SPPTTPSPGGSPPSPSISP--SPPITVPSPPTTPSPGGSPPSPSIVPSPPS 460

Query: 330 HYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYH 151
              SP  P  SP  P    SPP  P  P    S  PP    +P P    P  P  P    
Sbjct: 461 TTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGS--PPSSPTTPTPGGSPPSSPTTPSPGG 518

Query: 150 SPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           SPP P  SP PP    SPP  P  P    SPP P  SP P     SPP P
Sbjct: 519 SPPSPSISPSPPITVPSPPSTPTSP---GSPPSP-SSPTPSSPIPSPPTP 564

 Score = 58.5 bits (140), Expect = 4e-07
 Identities = 46/135 (34%), Positives = 49/135 (36%), Gaps = 30/135 (22%)
 Frame = -3

Query: 321 SPPPPVYSPPPPYHYS---SPPPP---PKKPYKYSSPP--------PPEHHVSPKPYYHS 184
           S  PPV  P PP   S   SPP P   P  P    SPP        PP   + P P   +
Sbjct: 403 STRPPVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTT 462

Query: 183 PPPPKKPYYYHSPPP----------------PVYSPPPPYHYSSPPPPPKKPYYYHSPPP 52
           P P   P    +P P                P  SP  P    SPP  P  P    SPP 
Sbjct: 463 PSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPS 522

Query: 51  PVYSPPPPYHYTSPP 7
           P  SP PP    SPP
Sbjct: 523 PSISPSPPITVPSPP 537

[90][TOP]
>UniRef100_Q94ES3 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES3_PEA
          Length = 137

 Score =  162 bits (410), Expect = 2e-38
 Identities = 81/134 (60%), Positives = 87/134 (64%), Gaps = 17/134 (12%)
 Frame = -3

Query: 351 SPPKKPYHYSSPPPP-VYSPPPPYH-YSSPPPPPKKPYKYSSPPPPEHHVSPKPY--YHS 184
           +P KKPY Y SPPPP V++ P P+  Y SPPPP KKPYKYSSPPPP  H  P P+  YHS
Sbjct: 1   TPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHS 60

Query: 183 PPPPKKPY-----YYHSPPPPVYSPPPPYHYSSPPPPPKKPY-------YYHSPPPPVYS 40
           PPPP   Y      YHSPPPP      PY Y SPPPPP   Y        YHSPPPPVYS
Sbjct: 61  PPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVYS 120

Query: 39  PPPP-YHYTSPPPP 1
           PPPP Y+Y SPPPP
Sbjct: 121 PPPPAYYYKSPPPP 134

 Score =  140 bits (352), Expect = 1e-31
 Identities = 82/156 (52%), Positives = 92/156 (58%), Gaps = 6/156 (3%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSS-PPPPVYSPPKK 337
           P  K Y   SPPP   PPV++  P  +P    PP   PP   PY YSS PPPPV++ P  
Sbjct: 2   PHKKPYKYPSPPP---PPVHT-YPHPHPVYHSPP---PPHKKPYKYSSPPPPPVHTYPHP 54

Query: 336 PYHYSSPPPPVYSPPPPYH-YSSPPPPP---KKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
              Y SPPPPV++ P P+  Y SPPPPP   KKPYKY SPPPP  H  P    H P P  
Sbjct: 55  HPVYHSPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPP---HVPTP-- 109

Query: 168 KPYYYHSPPPPVYSPPPP-YHYSSPPPPPKKPYYYH 64
               YHSPPPPVYSPPPP Y+Y SPPPP     Y+H
Sbjct: 110 ---VYHSPPPPVYSPPPPAYYYKSPPPP-----YHH 137

 Score = 80.9 bits (198), Expect = 8e-14
 Identities = 56/109 (51%), Positives = 57/109 (52%), Gaps = 24/109 (22%)
 Frame = -3

Query: 531 YLYSSPPPPKV--YP---PV--SPPPKV--YP---PVY-SPPPKVYP---------PVSP 418
           Y YSSPPPP V  YP   PV  SPPP V  YP   PVY SPPP   P         P  P
Sbjct: 38  YKYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPP 97

Query: 417 PPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVY--SPPPPYHY 277
           P   YPP  P   Y SPPPPVYSPP         PP  Y  SPPPPYH+
Sbjct: 98  PAHTYPPHVPTPVYHSPPPPVYSPP---------PPAYYYKSPPPPYHH 137

[91][TOP]
>UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q8L685_VOLCA
          Length = 1009

 Score =  162 bits (410), Expect = 2e-38
 Identities = 83/173 (47%), Positives = 84/173 (48%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP + PP  PPP   PP  PP     PPPP   PP 
Sbjct: 213 SPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P 
Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

 Score =  159 bits (402), Expect = 2e-37
 Identities = 82/172 (47%), Positives = 82/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 527  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 587  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P    SPPPP   PPPP     PPPP
Sbjct: 647  PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698

 Score =  158 bits (399), Expect = 4e-37
 Identities = 81/172 (47%), Positives = 82/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP+ PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

 Score =  158 bits (399), Expect = 4e-37
 Identities = 82/172 (47%), Positives = 82/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 511  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 571  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP    SPPPP
Sbjct: 631  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682

 Score =  158 bits (399), Expect = 4e-37
 Identities = 81/172 (47%), Positives = 82/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 512  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 572  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP   + PPPP
Sbjct: 632  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683

 Score =  157 bits (398), Expect = 5e-37
 Identities = 82/174 (47%), Positives = 83/174 (47%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
           S PPP    PP SPPP + PP   PPP   PP  PPP   PP  PP     PPPP   PP
Sbjct: 223 SPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282

Query: 342 KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
             P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P
Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

 Score =  157 bits (398), Expect = 5e-37
 Identities = 82/173 (47%), Positives = 82/173 (47%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP 
Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P 
Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

 Score =  157 bits (398), Expect = 5e-37
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 528  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 588  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 648  PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699

 Score =  157 bits (398), Expect = 5e-37
 Identities = 82/172 (47%), Positives = 82/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 541  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 601  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP   S PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 661  PPPPPPPPPPPPPPLPPSPPPPPPPPP-----PPPPPPPPPPPPPPPHPPPP 707

 Score =  157 bits (397), Expect = 7e-37
 Identities = 82/174 (47%), Positives = 82/174 (47%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
           S PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP
Sbjct: 228 SPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287

Query: 342 KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
             P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 485  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 545  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 605  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 486  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 546  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 606  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 487  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 547  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 607  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 488  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 548  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 608  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 489  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 549  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 609  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 490  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 550  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 610  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 491  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 551  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 611  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 492  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 552  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 612  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 493  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 553  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 613  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 494  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 554  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 614  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 495  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 555  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 615  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 496  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 556  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 616  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 497  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 557  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 617  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 498  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 558  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 618  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 499  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 559  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 619  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 500  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 560  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 620  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 501  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 561  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 621  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 502  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 562  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 622  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673

 Score =  156 bits (395), Expect = 1e-36
 Identities = 81/172 (47%), Positives = 81/172 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 503  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 563  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP   PPPP     PPPP
Sbjct: 623  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674

 Score =  155 bits (391), Expect = 3e-36
 Identities = 80/172 (46%), Positives = 80/172 (46%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 539  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 599  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP   PPPP      PPPP  P     PPPP   PPPP H   P PP
Sbjct: 659  PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPP 710

 Score =  153 bits (387), Expect = 1e-35
 Identities = 82/173 (47%), Positives = 83/173 (47%), Gaps = 1/173 (0%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 523  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 583  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP-- 640

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPV-YSPPPPYHYTSPPPP 1
               PPPP   PPPP     PPPPP  P     PPPP+  SPPPP     PPPP
Sbjct: 641  --PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691

 Score =  151 bits (381), Expect = 5e-35
 Identities = 81/171 (47%), Positives = 82/171 (47%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 556  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
            P     PPPP   PPPP     PPPPP  P     PPPP     P P    PPPP  P  
Sbjct: 616  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 675

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
              SPPPP   PPPP     PPPPP  P     PPPP + PPP     SPPP
Sbjct: 676  PPSPPPPPPPPPPP-----PPPPPPPP-----PPPPPHPPPP-----SPPP 711

 Score =  130 bits (328), Expect = 7e-29
 Identities = 74/162 (45%), Positives = 75/162 (46%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P   S PPPP            PPPP  P  
Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP------------PPPPPPP-- 690

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPP 31
              PPPP   PPPP H   PPPP        SPPP V + PP
Sbjct: 691 ---PPPPPPPPPPPPH---PPPP--------SPPPLVPALPP 718

 Score =  125 bits (315), Expect = 2e-27
 Identities = 70/152 (46%), Positives = 72/152 (47%)
 Frame = -3

Query: 456 YSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHY 277
           Y+PPP   PP  P P   PP SPP    SPPPP+  PP  P     PPPP   PPPP   
Sbjct: 207 YNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPP-----PPPPPPPPPPP--- 258

Query: 276 SSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSP 97
             PPPPP  P     PPPP            PPPP  P     PPPP   PPPP     P
Sbjct: 259 --PPPPPPPPPPPPPPPPPP-----------PPPPPPP-----PPPPPPPPPPPPPPPPP 300

Query: 96  PPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           PPPP  P     PPPP   PPPP     PPPP
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 57/139 (41%), Positives = 62/139 (44%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP  PPP   PP  PP     PPPP   PP  
Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P     PPPP   PPPP     PPPPP  P     PPP     SP P   + PP  +   
Sbjct: 680 PPPPPPPPPPPPPPPPP-----PPPPPPHP-----PPP-----SPPPLVPALPPSCEVCI 724

Query: 156 YHSPPPPVYSPPPPYHYSS 100
                PP +    PY +S+
Sbjct: 725 VARLLPPAFD-VRPYRFSN 742

[92][TOP]
>UniRef100_C5Y7E8 Putative uncharacterized protein Sb05g025945 (Fragment) n=1
           Tax=Sorghum bicolor RepID=C5Y7E8_SORBI
          Length = 360

 Score =  162 bits (410), Expect = 2e-38
 Identities = 99/180 (55%), Positives = 103/180 (57%), Gaps = 7/180 (3%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPP---VYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVY 352
           SSPPP  V  P  P PK  PP   V SPPP+V PP  P PK  PP +P    SSPPPPV 
Sbjct: 147 SSPPPAPVSLP-PPAPKTLPPPAPVSSPPPEVKPP--PAPKPLPPPAP---VSSPPPPVK 200

Query: 351 SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP 172
           SPP  P   SSPPPPV SPPPP   SSPPPP K      SPPPP    SP P   SPPPP
Sbjct: 201 SPPP-PAPVSSPPPPVKSPPPPAPLSSPPPPVK------SPPPPAPVSSPPPPVKSPPPP 253

Query: 171 KKPYYYHSPPPPVYSPPPPYHYSSPPPPPKK----PYYYHSPPPPVYSPPPPYHYTSPPP 4
                  SPPPPV SPPPP    S PPPP+K    P    SPPP   S PPP   +SPPP
Sbjct: 254 AP---VSSPPPPVKSPPPPPAPVSSPPPPEKSPPPPAPVSSPPPKPPSLPPPAPVSSPPP 310

 Score =  162 bits (409), Expect = 3e-38
 Identities = 95/182 (52%), Positives = 99/182 (54%), Gaps = 10/182 (5%)
 Frame = -3

Query: 516 PPPPKVYPPV----SPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVS---PPYHYSSPPPP 358
           PP PK  PP     SPPP+V PP   P PK  PP +P     PPV    PP   SSPPPP
Sbjct: 158 PPAPKTLPPPAPVSSPPPEVKPP---PAPKPLPPPAPVSSPPPPVKSPPPPAPVSSPPPP 214

Query: 357 VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPP 178
           V SPP  P   SSPPPPV SPPPP   SSPPPP K      SPPPP    SP P   SPP
Sbjct: 215 VKSPPP-PAPLSSPPPPVKSPPPPAPVSSPPPPVK------SPPPPAPVSSPPPPVKSPP 267

Query: 177 PPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKK---PYYYHSPPPPVYSPPPPYHYTSPP 7
           PP  P    SPPPP  SPPPP   SSPPP P     P    SPPP V   PP    ++P 
Sbjct: 268 PPPAP--VSSPPPPEKSPPPPAPVSSPPPKPPSLPPPAPVSSPPPAVTPAPPKKEESTPA 325

Query: 6   PP 1
           PP
Sbjct: 326 PP 327

 Score =  159 bits (402), Expect = 2e-37
 Identities = 101/197 (51%), Positives = 103/197 (52%), Gaps = 24/197 (12%)
 Frame = -3

Query: 522 SSPPPP-KVYPP----VSPPPKVYP-----PVYSPPPKVY-----PPVSPPPKVYPPVSP 388
           SSPPP  K  PP     SPPP   P     PV SPPP V       PVS PP     + P
Sbjct: 107 SSPPPVVKSTPPPAPVSSPPPAPKPSPPPAPVSSPPPVVKSSPPPAPVSLPPPAPKTLPP 166

Query: 387 PYHYSSPPPPVYSPP-----KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPP 223
           P   SSPPP V  PP       P   SSPPPPV SPPPP   SSPPPP K      SPPP
Sbjct: 167 PAPVSSPPPEVKPPPAPKPLPPPAPVSSPPPPVKSPPPPAPVSSPPPPVK------SPPP 220

Query: 222 PEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPP----PPKKPYYYHSPP 55
           P    SP P   SPPPP       SPPPPV SPPPP   SSPPP    PP  P    SPP
Sbjct: 221 PAPLSSPPPPVKSPPPPAP---VSSPPPPVKSPPPPAPVSSPPPPVKSPPPPPAPVSSPP 277

Query: 54  PPVYSPPPPYHYTSPPP 4
           PP  SPPPP   +SPPP
Sbjct: 278 PPEKSPPPPAPVSSPPP 294

 Score =  150 bits (378), Expect = 1e-34
 Identities = 101/221 (45%), Positives = 108/221 (48%), Gaps = 36/221 (16%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPP------------VYSPPPKVYP------ 430
           P+ +S+      S PPP       PP +V PP            V S PP   P      
Sbjct: 44  PAPVSSPPPAVKSSPPPLTPKSSGPPAQVSPPPEDEEESSPPPVVKSSPPPETPKLSPPP 103

Query: 429 -PVSPPPKVYPPVSPPYHYSSPPP-PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPP 256
            PVS PP V     PP   SSPPP P  SPP  P   SSPPP V S PPP   S PPP P
Sbjct: 104 APVSSPPPVVKSTPPPAPVSSPPPAPKPSPPPAP--VSSPPPVVKSSPPPAPVSLPPPAP 161

Query: 255 K---KPYKYSSPPPP-EHHVSPKPY-----YHSPPPPKK----PYYYHSPPPPVYSPPPP 115
           K    P   SSPPP  +   +PKP        SPPPP K    P    SPPPPV SPPPP
Sbjct: 162 KTLPPPAPVSSPPPEVKPPPAPKPLPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPP 221

Query: 114 YHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SSPPPP   P  P    SPPPPV SPPPP   +SPPPP
Sbjct: 222 APLSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPP 262

 Score =  147 bits (372), Expect = 5e-34
 Identities = 106/233 (45%), Positives = 112/233 (48%), Gaps = 59/233 (25%)
 Frame = -3

Query: 522 SSPPP-PKVYPPVSP---PPKVY------PPVYSPPPKVY---PPVS-----PPPKVYPP 397
           SSPPP PK  PP +P   PP+V        PV SPPP V    PP++     PP +V PP
Sbjct: 16  SSPPPTPKPSPPPAPVKSPPQVEKKTPPPAPVSSPPPAVKSSPPPLTPKSSGPPAQVSPP 75

Query: 396 VS-------PPYHYSSPPP--PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPK--- 253
                    PP   SSPPP  P  SPP  P   SSPPP V S PPP   SSPPP PK   
Sbjct: 76  PEDEEESSPPPVVKSSPPPETPKLSPPPAP--VSSPPPVVKSTPPPAPVSSPPPAPKPSP 133

Query: 252 KPYKYSSP-----------------------PPPEHHVSPKPYYHSPPPPK---KPYYYH 151
            P   SSP                       PPP    SP P    PP PK    P    
Sbjct: 134 PPAPVSSPPPVVKSSPPPAPVSLPPPAPKTLPPPAPVSSPPPEVKPPPAPKPLPPPAPVS 193

Query: 150 SPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           SPPPPV SPPPP   SSPPPP   P  P    SPPPPV SPPPP   +SPPPP
Sbjct: 194 SPPPPVKSPPPPAPVSSPPPPVKSPPPPAPLSSPPPPVKSPPPPAPVSSPPPP 246

 Score =  128 bits (322), Expect = 3e-28
 Identities = 81/161 (50%), Positives = 87/161 (54%), Gaps = 1/161 (0%)
 Frame = -3

Query: 522 SSPPPP-KVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           SSPPPP K  PP +P     PPV SPPP   P  SPPP V  P  PP   SSPPPPV SP
Sbjct: 209 SSPPPPVKSPPPPAPLSSPPPPVKSPPPPA-PVSSPPPPVKSP-PPPAPVSSPPPPVKSP 266

Query: 345 PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
           P  P   SSPPPP  SPPPP   SSPPP P       S PPP    SP P   +P PPKK
Sbjct: 267 PPPPAPVSSPPPPEKSPPPPAPVSSPPPKP------PSLPPPAPVSSPPPAV-TPAPPKK 319

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY 43
                +P PP  S PPP  ++    PP     Y SPPPP +
Sbjct: 320 E--ESTPAPPAESLPPP-SFNDIILPPIMANKYASPPPPQF 357

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 46/113 (40%), Positives = 55/113 (48%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           P+ +S+      SPPPP              PV SPPPK  PP  PPP    PVS P   
Sbjct: 270 PAPVSSPPPPEKSPPPP-------------APVSSPPPK--PPSLPPP---APVSSP--- 308

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPE 217
             PP    +PPKK    S+P PP  S PPP  ++    PP    KY+SPPPP+
Sbjct: 309 --PPAVTPAPPKK--EESTPAPPAESLPPP-SFNDIILPPIMANKYASPPPPQ 356

[93][TOP]
>UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J4Y2_HUMAN
          Length = 253

 Score =  162 bits (410), Expect = 2e-38
 Identities = 92/174 (52%), Positives = 92/174 (52%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
           SSPPPP    P  PPP   PP    PP   PP  PPP   PP  PP   S PPPP  SPP
Sbjct: 15  SSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPP--PPSPPPPPPSQPPPPPSSPP 72

Query: 342 KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
             P   S PPPP  SPPPP    SPPPPP  P   S PPPP    SP P   SPPPP   
Sbjct: 73  PPPPPPSPPPPPPPSPPPPL--PSPPPPPPLP---SPPPPPPLPSSPPPPPPSPPPPPL- 126

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               SPPPP  SPPPP   S PPPPP  P     PPPP   PPPP    SPPPP
Sbjct: 127 ----SPPPPPPSPPPPPLLSPPPPPPSPP-----PPPPPSPPPPP---PSPPPP 168

 Score =  161 bits (408), Expect = 4e-38
 Identities = 95/185 (51%), Positives = 99/185 (53%), Gaps = 4/185 (2%)
 Frame = -3

Query: 543 SANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP 364
           S  S L  SPPPP    P  PPP   PP  S PP   PP SPPP   P   PP     PP
Sbjct: 39  SPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPP 98

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHS 184
           PP+ SPP  P   SSPPPP  SPPPP    SPPPPP  P     PPPP   +SP P   S
Sbjct: 99  PPLPSPPPPPPLPSSPPPPPPSPPPP--PLSPPPPPPSP-----PPPP--LLSPPPPPPS 149

Query: 183 PPPPKKPYYYHSPPPPVYSPPPPYHYSS--PPPPPKKPYYY--HSPPPPVYSPPPPYHYT 16
           PPPP  P    SPPPP  SPPPP    S  PPPPP  P+      PPPP  SPPPP   +
Sbjct: 150 PPPPPPP----SPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPS 205

Query: 15  SPPPP 1
            PPPP
Sbjct: 206 PPPPP 210

 Score =  160 bits (405), Expect = 8e-38
 Identities = 85/174 (48%), Positives = 90/174 (51%), Gaps = 2/174 (1%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP+ SPPP    P  PPP   P   PP   S PPPP+  PP  
Sbjct: 73  PPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPP 132

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P   S PPPP+ SPPPP     PPPPP  P    SPPPP    SP P    PPPP  P+ 
Sbjct: 133 P---SPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLP----PPPPSPPHP 185

Query: 156 Y--HSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                PPPP  SPPPP   S PPPP   P     P PP+  PPPP     PPPP
Sbjct: 186 LPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPP 239

 Score =  160 bits (404), Expect = 1e-37
 Identities = 87/173 (50%), Positives = 90/173 (52%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP    P+   PP   PP  PPP   PP  PP   SSPPPP   P  
Sbjct: 24  SPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPP---PPSQPPPPPSSPPPPPPPPSP 80

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P    SPPPP+ SPPPP    SPPPPP  P   SSPPPP     P P    PPPP    
Sbjct: 81  PPPPPPSPPPPLPSPPPPPPLPSPPPPPPLP---SSPPPPPPSPPPPPLSPPPPPPS--- 134

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP+ SPPPP     PPPPP       SPPPP  SPPPP    SP PP
Sbjct: 135 ---PPPPPLLSPPPPPPSPPPPPPP-------SPPPPPPSPPPPLPPPSPLPP 177

 Score =  157 bits (398), Expect = 5e-37
 Identities = 95/175 (54%), Positives = 96/175 (54%), Gaps = 2/175 (1%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY--SSPPPPVYSP 346
           SPPPP   PP SPPP   PP  SPPP   PP SPPP   PP SPP     S PPPP  SP
Sbjct: 6   SPPPPPP-PPSSPPP---PPPPSPPP---PPPSPPPP--PPPSPPSPLPPSPPPPPPPSP 56

Query: 345 PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
           P  P   S PPPP  SPPPP    SPPPPP       SPPPP     P P   SPPPP  
Sbjct: 57  PPPPP--SQPPPPPSSPPPPPPPPSPPPPPPP-----SPPPPLPSPPPPPPLPSPPPP-- 107

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           P    SPPPP  SPPPP     PPPP   P    SPPPP  SPPPP   + PPPP
Sbjct: 108 PPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPP 162

 Score =  152 bits (385), Expect = 2e-35
 Identities = 89/174 (51%), Positives = 90/174 (51%), Gaps = 2/174 (1%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  P P   PP+ SPPP    P SPPP   PP SPP    SPPPP  SPP  
Sbjct: 82  PPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPP---PPPSPPPPPLSPPPPPPSPPPP 138

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPK--KPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
           P    SPPPP  SPPPP   S PPPPP    P    SP PP     P P   SPPPP  P
Sbjct: 139 PL--LSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPP 196

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                PPPP  SPPPP   S P P P  P     PPPP   PPPP    SPPPP
Sbjct: 197 ---SPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPP--PPSPPPP 245

 Score =  147 bits (371), Expect = 7e-34
 Identities = 91/172 (52%), Positives = 92/172 (53%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP       SPPP   PP SPPP   PP SPP      PPP  SPP  
Sbjct: 1   PPPPPSPPPPPPPPS------SPPPP--PPPSPPP---PPPSPP------PPPPPSPPS- 42

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P   S PPPP  SPPPP   S PPPPP  P     PPPP     P P   SPPPP  P  
Sbjct: 43  PLPPSPPPPPPPSPPPPPP-SQPPPPPSSP-----PPPP-----PPP---SPPPPPPP-- 86

Query: 156 YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             SPPPP+ SPPPP    SPPPPP  P    SPPPP  SPPPP     PPPP
Sbjct: 87  --SPPPPLPSPPPPPPLPSPPPPPPLP---SSPPPPPPSPPPPPLSPPPPPP 133

 Score =  146 bits (368), Expect = 2e-33
 Identities = 90/181 (49%), Positives = 94/181 (51%), Gaps = 8/181 (4%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVY 352
           SPPPP   P   PPP +     PP  SPPP   PP+SPPP   PP  PP    SPPPP  
Sbjct: 94  SPPPPPPLPSPPPPPPLPSSPPPPPPSPPP---PPLSPPPP--PPSPPPPPLLSPPPPPP 148

Query: 351 SPPKKPYHYSSPPPPVYSPPPPYHYSS--PPPPPKKPYKYSSPPPPEHHVSPKPYYHSPP 178
           SPP  P    SPPPP  SPPPP    S  PPPPP  P+     PPP     P P    PP
Sbjct: 149 SPPPPPP--PSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPP-----PPPPSPPPP 201

Query: 177 PPKKPYYYHSPPPPVYSPPPPYHYSS--PPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
           PP  P     PPPP+ SPP P   S   PPPPP  P     PPPP  SPPPP    SPPP
Sbjct: 202 PPPSP-----PPPPLPSPPAPSPPSPPLPPPPPPPP---SPPPPPPPSPPPP----SPPP 249

Query: 3   P 1
           P
Sbjct: 250 P 250

 Score =  107 bits (267), Expect = 8e-22
 Identities = 71/158 (44%), Positives = 73/158 (46%), Gaps = 1/158 (0%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSP-PPKVYPPVSPPYH 379
           P L+S      S PPPP   PP  PPP   PP   PPP   PP  P PP   PP  PP  
Sbjct: 138 PPLLSPPPPPPSPPPPP---PPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPP-- 192

Query: 378 YSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPK 199
              PPPP   PP  P   S PPPP+ SPP P    SPP PP        PPPP       
Sbjct: 193 ---PPPPSPPPPPPP---SPPPPPLPSPPAP----SPPSPP-------LPPPP------- 228

Query: 198 PYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPP 85
                PPPP        PPPP  SPPPP    SPPPPP
Sbjct: 229 -----PPPPS------PPPPPPPSPPPP----SPPPPP 251

[94][TOP]
>UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK6_CHLRE
          Length = 738

 Score =  161 bits (408), Expect = 4e-38
 Identities = 91/176 (51%), Positives = 92/176 (52%), Gaps = 3/176 (1%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP--PPVYSP 346
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP     PP  PP   P
Sbjct: 194 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 251

Query: 345 PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
           P  P   S PPPP  SPPPP   S PPPPP +P     PPPP     P P   SPPPP  
Sbjct: 252 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRP----PPPPPPSPPPPSPPPPSPPPPSP 307

Query: 165 PYYYHSPPPPVYSPPP-PYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           P     PPPP   PPP P   S PPPPP  P    SPPPP    PPP    SPPPP
Sbjct: 308 PPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPP---PSPPPP 360

 Score =  160 bits (406), Expect = 6e-38
 Identities = 91/173 (52%), Positives = 92/173 (53%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP    SPPPP   PP 
Sbjct: 209 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPPP 264

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P   S PPPP  SPPPP     PPPPP  P   S PPP     SP P    PPPP +P 
Sbjct: 265 PP---SPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRP- 320

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPP   PPPP    SPPPPP  P     PPPP   PPP     SPPPP
Sbjct: 321 PPPSPPPPSPPPPPP---PSPPPPPSPP-----PPPPPRPPPPSPPPPSPPPP 365

 Score =  159 bits (402), Expect = 2e-37
 Identities = 90/175 (51%), Positives = 92/175 (52%), Gaps = 1/175 (0%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPVY-SPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           S PPPP   PP  PPP+  PP   SPPP   PP SPPP   PP SPP     PPPP   P
Sbjct: 267 SPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP-----PPPPPRPP 321

Query: 345 PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
           P  P   S PPPP  SPPPP   S PPPPP +P   S PPP     SP P    PPPP  
Sbjct: 322 PPSPPPPSPPPPPPPSPPPP--PSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPS 379

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           P     P PP  SPPPP   S PPP P  P     PPPP   PPPP    SPPPP
Sbjct: 380 PPPPPPPRPPPPSPPPP---SPPPPSPPPPPPPSPPPPPPPRPPPP----SPPPP 427

 Score =  158 bits (400), Expect = 3e-37
 Identities = 87/173 (50%), Positives = 87/173 (50%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP  PP   S PPPP  SPP 
Sbjct: 224 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPPPP---SPPPPPPPSPPP 278

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P     PPPP  SPPPP      PPPP  P     PPPP     P P   SPPPP  P 
Sbjct: 279 PPPPRPPPPPPP-SPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPP- 336

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPP   PPPP     PP PP       SPPPP   PPPP     PPPP
Sbjct: 337 ---SPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 386

 Score =  157 bits (397), Expect = 7e-37
 Identities = 90/174 (51%), Positives = 92/174 (52%), Gaps = 1/174 (0%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP     PPPP   PP 
Sbjct: 214 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 271

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPP-PEHHVSPKPYYHSPPPPKKP 163
            P     PPPP   PPPP     P PPP  P   S PPP P     P+P   SPPPP  P
Sbjct: 272 PPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPP 331

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                PPPP   PPPP   S PPPPP +P    SPPPP  SPPPP    SPPPP
Sbjct: 332 -----PPPPPSPPPPP---SPPPPPPPRP-PPPSPPPP--SPPPP----SPPPP 370

 Score =  156 bits (394), Expect = 1e-36
 Identities = 89/176 (50%), Positives = 93/176 (52%), Gaps = 3/176 (1%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP   PPP   PP  PPP+  PP  P     SPPPP   PP 
Sbjct: 249 SPPPPSPPPPSPPPPP--PPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPS 306

Query: 339 KPYHYSSPPPPVYSPPP-PYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
            P     PPPP   PPP P   S PPPPP  P    SPPPP     P+P   SPPPP  P
Sbjct: 307 PPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPP---PPRPPPPSPPPPSPP 363

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPP--PPVYSPPPPYHYTSPPPP 1
               SPPPP  SPPPP   S PPPPP +P     PP  PP  SPPPP   + PPPP
Sbjct: 364 --PPSPPPP--SPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPP 415

 Score =  154 bits (389), Expect = 6e-36
 Identities = 92/173 (53%), Positives = 93/173 (53%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP    SPPPP   PP 
Sbjct: 189 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPPS 244

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P    SPPPP  SPPPP   S PPPPP  P     PPPP     P P    PPPP  P 
Sbjct: 245 PPP--PSPPPP--SPPPP---SPPPPPPPSP---PPPPPPSPPPPPPPRPPPPPPPSPP- 293

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPP   PP P   S PPPPP +P    SPPPP   PPPP    SPPPP
Sbjct: 294 -PPSPPPPSPPPPSPPPPSPPPPPPPRP-PPPSPPPPSPPPPPP---PSPPPP 341

 Score =  153 bits (386), Expect = 1e-35
 Identities = 91/173 (52%), Positives = 94/173 (54%), Gaps = 1/173 (0%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP SPPP   PP   PPP   PP  PPP+  PP  PP   S PPPP  SPP  
Sbjct: 286 PPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPPPPRPPPPSPPPP--SPPPPPPPSPPPP 341

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
           P   S PPPP   PPPP    SPPPP   P    SPPPP     P P    PPPP+ P  
Sbjct: 342 P---SPPPPPPPRPPPP----SPPPPSPPP---PSPPPPSPPPPPPPSPPPPPPPRPPPP 391

Query: 156 YHSPP-PPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              PP PP  SPPPP   S PPPPP +P    SPPPP  SPPPP    SPPPP
Sbjct: 392 SPPPPSPPPPSPPPPPPPSPPPPPPPRP-PPPSPPPP--SPPPP----SPPPP 437

 Score =  134 bits (337), Expect = 6e-30
 Identities = 78/167 (46%), Positives = 80/167 (47%), Gaps = 3/167 (1%)
 Frame = -3

Query: 492 PVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPP 313
           P+S      PP  SPPP   PP SPPP   PP SPP    SPPPP   PP       SPP
Sbjct: 181 PLSQANVPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPP-------SPP 231

Query: 312 PPVY---SPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPP 142
           PP     SPPPP      PPPP  P     PPPP     P P    PPPP +P     PP
Sbjct: 232 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRP-----PP 286

Query: 141 PPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           PP  SPPPP      PPPP  P     PPPP   PPP     SPPPP
Sbjct: 287 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPP 333

 Score =  122 bits (306), Expect = 2e-26
 Identities = 84/171 (49%), Positives = 85/171 (49%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP SPPP   PP   PPP+  PP  PPP   PP  PP    SPPPP   PP 
Sbjct: 329 SPPPP---PPPSPPPPPSPPP-PPPPRPPPPSPPPPSPPPPSPPP---PSPPPP---PPP 378

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P     PPPP   PPPP    SPPPP        SPPPP    SP P    PPPP  P 
Sbjct: 379 SP-----PPPPPPRPPPP----SPPPP--------SPPPP----SPPP----PPPPSPP- 412

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPP 7
               PPPP   PPP     SPPPP        SPPPP  SPPPP    SPP
Sbjct: 413 ----PPPPPRPPPP-----SPPPP--------SPPPP--SPPPP----SPP 440

 Score = 81.3 bits (199), Expect = 6e-14
 Identities = 48/88 (54%), Positives = 49/88 (55%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
           S PPPP   PP  PPP+  PP  SPPP   PP SPPP   PP SPP     PPPP   PP
Sbjct: 371 SPPPPPPPSPPPPPPPR--PPPPSPPPPSPPPPSPPPP--PPPSPP-----PPPPPRPPP 421

Query: 342 KKPYHYSSPPPPVYSPPPPYHYSSPPPP 259
                  SPPPP  SPPPP    SPPPP
Sbjct: 422 ------PSPPPP--SPPPP----SPPPP 437

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 55/120 (45%), Positives = 56/120 (46%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
           S PPP    PP  PPP   PP   PPP+  PP SPPP   PP SPP     PPPP   PP
Sbjct: 366 SPPPPS---PPPPPPPSPPPP---PPPRP-PPPSPPPPSPPPPSPP-----PPPPPSPPP 413

Query: 342 KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
                   PPPP   PPPP    SPPPP        SPPPP           SPPPP  P
Sbjct: 414 --------PPPP--RPPPP----SPPPP--------SPPPP-----------SPPPPSPP 440

 Score = 79.7 bits (195), Expect = 2e-13
 Identities = 43/90 (47%), Positives = 46/90 (51%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP    P   PPP+  PP  PPP   PP  PP    SPPPP   PP+
Sbjct: 361 SPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPP--PPPR 418

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKK 250
            P    SPPPP   PP P     PP PP +
Sbjct: 419 PPP--PSPPPPSPPPPSP----PPPSPPAR 442

[95][TOP]
>UniRef100_Q3ECC3 Putative uncharacterized protein At1g76930.1 n=1 Tax=Arabidopsis
           thaliana RepID=Q3ECC3_ARATH
          Length = 293

 Score =  161 bits (408), Expect = 4e-38
 Identities = 105/201 (52%), Positives = 109/201 (54%), Gaps = 7/201 (3%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISANSYLYSSPPPP-KVYPPVSPPPKVYPPVYSPPPKVYP 430
           M +   + LV   SL   S  +AN Y YSSPPPP K Y P        PPVY  PP    
Sbjct: 1   MGAPMASFLVLAFSLAFVSQTTAN-YFYSSPPPPVKHYSP--------PPVYKSPP---- 47

Query: 429 PVSPPPKVYPPVSPPYHYSSPPPPV--YSPPKKPYHYSSPPPPV--YSPPPPYHYSSPPP 262
              PP K Y   SPP  Y SPPPPV  YSPP     Y SPPPPV  YSPPP Y   SPPP
Sbjct: 48  ---PPVKHY---SPPPVYKSPPPPVKHYSPPPV---YKSPPPPVKYYSPPPVY--KSPPP 96

Query: 261 PPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPK 82
           P      Y SPPPP  H SP P Y SPPPP K Y   SPPP   SPPPP  + SPPP   
Sbjct: 97  PV-----YKSPPPPVKHYSPPPVYKSPPPPVKHY---SPPPVYKSPPPPVKHYSPPP--- 145

Query: 81  KPYYYHSPPPPV--YSPPPPY 25
               Y SPPPPV  YSPPP Y
Sbjct: 146 ---VYKSPPPPVKHYSPPPSY 163

 Score =  142 bits (359), Expect = 2e-32
 Identities = 86/142 (60%), Positives = 87/142 (61%), Gaps = 14/142 (9%)
 Frame = -3

Query: 384 YHYSSPPPPV--YSPPKKPYHYSSPPPPV--YSPPPPYHYSSPPPPPKK---PYKYSSPP 226
           Y YSSPPPPV  YSPP     Y SPPPPV  YSPPP Y   SPPPP K    P  Y SPP
Sbjct: 25  YFYSSPPPPVKHYSPPPV---YKSPPPPVKHYSPPPVY--KSPPPPVKHYSPPPVYKSPP 79

Query: 225 PPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV--YSPPPPYHYSSPPPPPK---KPYYYHS 61
           PP  + SP P Y SPPPP     Y SPPPPV  YSPPP   Y SPPPP K    P  Y S
Sbjct: 80  PPVKYYSPPPVYKSPPPP----VYKSPPPPVKHYSPPPV--YKSPPPPVKHYSPPPVYKS 133

Query: 60  PPPPV--YSPPPPYHYTSPPPP 1
           PPPPV  YSPPP   Y SPPPP
Sbjct: 134 PPPPVKHYSPPPV--YKSPPPP 153

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 48/101 (47%), Positives = 51/101 (50%), Gaps = 24/101 (23%)
 Frame = -3

Query: 528 LYSSPPPPKVY---PPV--SPPPKVY------------PPVY-SPPPKVY----PPV--S 421
           +Y SPPPP  Y   PPV  SPPP VY            PPVY SPPP V     PPV  S
Sbjct: 74  VYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKS 133

Query: 420 PPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYS 298
           PPP V     PP +  SPPPPV        HYS  PPP Y+
Sbjct: 134 PPPPVKHYSPPPVYK-SPPPPV-------KHYS--PPPSYT 164

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 27/50 (54%), Positives = 32/50 (64%)
 Frame = -1

Query: 377 TLHHHHRCTHHLKSHTITLHHHHRCTHLLLLIIIVHHHLHQRNHTSILLL 228
           TLHHH   TH L+S+T TLHHH   THLL L    HHH     +T++LLL
Sbjct: 165 TLHHHRFTTHLLQSYT-TLHHHRFTTHLLQLYTTPHHHPRSTTNTNLLLL 213

[96][TOP]
>UniRef100_Q304C4 Putative uncharacterized protein At1g76930.2 n=1 Tax=Arabidopsis
           thaliana RepID=Q304C4_ARATH
          Length = 256

 Score =  161 bits (408), Expect = 4e-38
 Identities = 105/201 (52%), Positives = 109/201 (54%), Gaps = 7/201 (3%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISANSYLYSSPPPP-KVYPPVSPPPKVYPPVYSPPPKVYP 430
           M +   + LV   SL   S  +AN Y YSSPPPP K Y P        PPVY  PP    
Sbjct: 1   MGAPMASFLVLAFSLAFVSQTTAN-YFYSSPPPPVKHYSP--------PPVYKSPP---- 47

Query: 429 PVSPPPKVYPPVSPPYHYSSPPPPV--YSPPKKPYHYSSPPPPV--YSPPPPYHYSSPPP 262
              PP K Y   SPP  Y SPPPPV  YSPP     Y SPPPPV  YSPPP Y   SPPP
Sbjct: 48  ---PPVKHY---SPPPVYKSPPPPVKHYSPPPV---YKSPPPPVKYYSPPPVY--KSPPP 96

Query: 261 PPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPK 82
           P      Y SPPPP  H SP P Y SPPPP K Y   SPPP   SPPPP  + SPPP   
Sbjct: 97  PV-----YKSPPPPVKHYSPPPVYKSPPPPVKHY---SPPPVYKSPPPPVKHYSPPP--- 145

Query: 81  KPYYYHSPPPPV--YSPPPPY 25
               Y SPPPPV  YSPPP Y
Sbjct: 146 ---VYKSPPPPVKHYSPPPSY 163

 Score =  142 bits (359), Expect = 2e-32
 Identities = 86/142 (60%), Positives = 87/142 (61%), Gaps = 14/142 (9%)
 Frame = -3

Query: 384 YHYSSPPPPV--YSPPKKPYHYSSPPPPV--YSPPPPYHYSSPPPPPKK---PYKYSSPP 226
           Y YSSPPPPV  YSPP     Y SPPPPV  YSPPP Y   SPPPP K    P  Y SPP
Sbjct: 25  YFYSSPPPPVKHYSPPPV---YKSPPPPVKHYSPPPVY--KSPPPPVKHYSPPPVYKSPP 79

Query: 225 PPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV--YSPPPPYHYSSPPPPPK---KPYYYHS 61
           PP  + SP P Y SPPPP     Y SPPPPV  YSPPP   Y SPPPP K    P  Y S
Sbjct: 80  PPVKYYSPPPVYKSPPPP----VYKSPPPPVKHYSPPPV--YKSPPPPVKHYSPPPVYKS 133

Query: 60  PPPPV--YSPPPPYHYTSPPPP 1
           PPPPV  YSPPP   Y SPPPP
Sbjct: 134 PPPPVKHYSPPPV--YKSPPPP 153

 Score = 59.7 bits (143), Expect(2) = 1e-12
 Identities = 48/101 (47%), Positives = 51/101 (50%), Gaps = 24/101 (23%)
 Frame = -3

Query: 528 LYSSPPPPKVY---PPV--SPPPKVY------------PPVY-SPPPKVY----PPV--S 421
           +Y SPPPP  Y   PPV  SPPP VY            PPVY SPPP V     PPV  S
Sbjct: 74  VYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKS 133

Query: 420 PPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYS 298
           PPP V     PP +  SPPPPV        HYS  PPP Y+
Sbjct: 134 PPPPVKHYSPPPVYK-SPPPPV-------KHYS--PPPSYT 164

 Score = 37.4 bits (85), Expect(2) = 1e-12
 Identities = 24/63 (38%), Positives = 31/63 (49%), Gaps = 4/63 (6%)
 Frame = -1

Query: 191 TTLHHHQ-RNHIT---TILHHHQCTHLLLHTIIVHHHRHQRSHTTTILHHHQCTHLLLPT 24
           TTLHHH+   H+    T LHHH+ T  LL      HH  + +  T +L     T  L  T
Sbjct: 164 TTLHHHRFTTHLLQSYTTLHHHRFTTHLLQLYTTPHHHPRSTTNTNLLLLRSITLPLRYT 223

Query: 23  IIL 15
           I+L
Sbjct: 224 ILL 226

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 42/97 (43%), Positives = 49/97 (50%), Gaps = 7/97 (7%)
 Frame = -1

Query: 377 TLHHHHRCTHHLKSHTITLHHHHRCTHLLLLIIIVHHHLHQRNHTSILLLHHRSIMSHLN 198
           TLHHH   TH L+S+T TLHHH   THLL L    HHH     +T++LLL  RSI   L 
Sbjct: 165 TLHHHRFTTHLLQSYT-TLHHHRFTTHLLQLYTTPHHHPRSTTNTNLLLL--RSITLPLR 221

Query: 197 LT-------TTLHHHQRNHITTILHHHQCTHLLLHTI 108
            T       TT H H     T   HH   T  LL+ +
Sbjct: 222 YTILLLLQYTTTHLHTNPTFTN--HHLLLTTRLLNRL 256

[97][TOP]
>UniRef100_Q9XIB6 F13F21.7 protein n=1 Tax=Arabidopsis thaliana RepID=Q9XIB6_ARATH
          Length = 847

 Score =  160 bits (405), Expect = 8e-38
 Identities = 94/179 (52%), Positives = 101/179 (56%), Gaps = 8/179 (4%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVS----PPPKV----YPPVSPPYHYSSPPP 361
           P  P+   PVSPP +   P    P    P  +    PPPKV     PP  PP    SPP 
Sbjct: 488 PQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPS 547

Query: 360 PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSP 181
           P+YSPP  P H  SPPPPVYS PPP H  SPPPP       +SPPPP    SP P  HSP
Sbjct: 548 PIYSPPP-PVH--SPPPPVYSSPPPPHVYSPPPP------VASPPPP----SPPPPVHSP 594

Query: 180 PPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
           PPP  P +  SPPPPV+SPPPP    SPPPP       HSPPPPVYSPPPP    SPPP
Sbjct: 595 PPP--PVF--SPPPPVFSPPPPSPVYSPPPPS------HSPPPPVYSPPPPTF--SPPP 641

 Score =  142 bits (358), Expect = 2e-32
 Identities = 87/174 (50%), Positives = 93/174 (53%), Gaps = 1/174 (0%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPP-VYSPP 343
           SPPPPKV     PPP+   P  SPP  +Y   SPPP V+ P  PP  YSSPPPP VYSPP
Sbjct: 522 SPPPPKVEDTRVPPPQPPMPSPSPPSPIY---SPPPPVHSP--PPPVYSSPPPPHVYSPP 576

Query: 342 KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
                 +SPPPP  SPPPP H  SPPPPP       SPPPP     P    +SPPPP   
Sbjct: 577 PP---VASPPPP--SPPPPVH--SPPPPP-----VFSPPPPVFSPPPPSPVYSPPPPS-- 622

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              HSPPPPVYSPPPP    SPPP           P P  +P P    T  P P
Sbjct: 623 ---HSPPPPVYSPPPPTF--SPPPTHNTNQPPMGAPTPTQAPTPSSETTQVPTP 671

 Score =  138 bits (348), Expect = 3e-31
 Identities = 88/191 (46%), Positives = 97/191 (50%), Gaps = 18/191 (9%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKV------YPPVSPPPKVYPPV-------SPPYH 379
           SP P    P  SP P+   P  SP P+         PVSPP +   P        SP  +
Sbjct: 460 SPKPQPSKPEDSPKPEQPKPEESPKPEQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKN 519

Query: 378 YSSPPPPVYS-----PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEH 214
             SPPPP        PP+ P    SPP P+YSPPPP H  SPPPP      YSSPPPP  
Sbjct: 520 RRSPPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVH--SPPPPV-----YSSPPPP-- 570

Query: 213 HVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPP 34
                 + +SPPPP       SPPPP  SPPPP H  SPPPPP       SPPPPV+SPP
Sbjct: 571 ------HVYSPPPPVA-----SPPPP--SPPPPVH--SPPPPP-----VFSPPPPVFSPP 610

Query: 33  PPYHYTSPPPP 1
           PP    SPPPP
Sbjct: 611 PPSPVYSPPPP 621

 Score =  115 bits (288), Expect = 3e-24
 Identities = 82/191 (42%), Positives = 91/191 (47%), Gaps = 10/191 (5%)
 Frame = -3

Query: 543  SANSYLYSSPPPPKVYPPV---SPPPKVYPPVYSPPPKVY--PPVSPPPKVYPPVSPPYH 379
            S  S +YS PPP    PP    SPPP   P VYSPPP V   PP SPPP V+ P  PP  
Sbjct: 544  SPPSPIYSPPPPVHSPPPPVYSSPPP---PHVYSPPPPVASPPPPSPPPPVHSPPPPPVF 600

Query: 378  YSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPK 199
              SPPPPV+SPP        PP PVYSPPPP H  SPPPP      YS PPP     SP 
Sbjct: 601  --SPPPPVFSPP--------PPSPVYSPPPPSH--SPPPP-----VYSPPPPT---FSPP 640

Query: 198  PYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYH--SP---PPPVYSPP 34
            P +++  PP         P P  +P P    +  P P  +       SP   P PV S  
Sbjct: 641  PTHNTNQPPM------GAPTPTQAPTPSSETTQVPTPSSESDQSQILSPVQAPTPVQSST 694

Query: 33   PPYHYTSPPPP 1
            P    T  P P
Sbjct: 695  PSSEPTQVPTP 705

 Score =  112 bits (279), Expect = 3e-23
 Identities = 74/183 (40%), Positives = 89/183 (48%), Gaps = 8/183 (4%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVY---PPVS--PPPKVYPPVYSPPPKVYPPV-SPPPKVY--P 400
            P + S    +YSSPPPP VY   PPV+  PPP   PPV+SPPP   PPV SPPP V+  P
Sbjct: 554  PPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPP---PPVFSPPPPVFSPP 610

Query: 399  PVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPP 220
            P SP Y   SPPPP +SPP   Y   SPPPP +SPPP ++ + PP     P   +  P P
Sbjct: 611  PPSPVY---SPPPPSHSPPPPVY---SPPPPTFSPPPTHNTNQPPMGAPTP---TQAPTP 661

Query: 219  EHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYS 40
                +  P   S     +       P PV S  P    +  P P     Y      PV +
Sbjct: 662  SSETTQVPTPSSESDQSQILSPVQAPTPVQSSTPSSEPTQVPTPSSSESYQAPNLSPVQA 721

Query: 39   PPP 31
            P P
Sbjct: 722  PTP 724

 Score =  109 bits (273), Expect = 2e-22
 Identities = 77/199 (38%), Positives = 87/199 (43%), Gaps = 25/199 (12%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSP---PYHYSSPPPPVY 352
           S P P    P  S  P+       P PK  PP    PK   P +    P    SP P   
Sbjct: 407 SKPEPVMPKPSDSSKPETPKTPEQPSPKPQPPKHESPKPEEPENKHELPKQKESPKPQPS 466

Query: 351 SP-----PKKPYHYSSPPPPVYSPPPPYHYSSPP-----PPPKKPYKYS------SPPPP 220
            P     P++P    SP P     P P    SPP     P P  PY  S      SPPPP
Sbjct: 467 KPEDSPKPEQPKPEESPKPEQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNRRSPPPP 526

Query: 219 EHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYH------YSSPPPPPKKPYYYHSP 58
           +   +        PPP+ P    SPP P+YSPPPP H      YSSPPPP     + +SP
Sbjct: 527 KVEDT------RVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPP-----HVYSP 575

Query: 57  PPPVYSPPPPYHYTSPPPP 1
           PPPV SPPPP    SPPPP
Sbjct: 576 PPPVASPPPP----SPPPP 590

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 56/179 (31%), Positives = 62/179 (34%), Gaps = 72/179 (40%)
 Frame = -3

Query: 321 SPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPE--HHVSPKPY--YHSPPPPKKPYYY 154
           SP PP  S P P   S P P   KP   S P  P+     SPKP    H  P P++P   
Sbjct: 395 SPNPPRTSEPKP---SKPEPVMPKPSDSSKPETPKTPEQPSPKPQPPKHESPKPEEPENK 451

Query: 153 H---------------------------------------------SPPPPVYSPPP--P 115
           H                                             SPP     P P  P
Sbjct: 452 HELPKQKESPKPQPSKPEDSPKPEQPKPEESPKPEQPQIPEPTKPVSPPNEAQGPTPDDP 511

Query: 114 YHYS------SPP---------PPPKKPYYYHSPPPPVYSPPPPYH------YTSPPPP 1
           Y  S      SPP         PPP+ P    SPP P+YSPPPP H      Y+SPPPP
Sbjct: 512 YDASPVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPP 570

[98][TOP]
>UniRef100_O81765 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=O81765_ARATH
          Length = 699

 Score =  160 bits (404), Expect = 1e-37
 Identities = 99/200 (49%), Positives = 107/200 (53%), Gaps = 27/200 (13%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYS--SPPPPVYSP 346
            SPPP     PV+ PP   PPVYSPPP   P  SPPP V+ P  PP  YS   PPPPV+SP
Sbjct: 517  SPPPA----PVNSPP---PPVYSPPPPPPPVHSPPPPVHSPPPPPV-YSPPPPPPPVHSP 568

Query: 345  PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
            P   +   SPPPPVYSPPPP H  SPPPP        SPPPP    SP P  HSPPPP  
Sbjct: 569  PPPVF---SPPPPVYSPPPPVH--SPPPP------VHSPPPPAPVHSPPPPVHSPPPPPP 617

Query: 165  PYYYHSPPPPVYSPP----PPYHYSSPPPPPK--KPYYYHSPP--------PPVYSPPPP 28
             Y   SPPPPV+SPP    PP  YS PP PPK   P     PP        PP ++P P 
Sbjct: 618  VY---SPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPVEKKETPPAHAPAPS 674

Query: 27   -----------YHYTSPPPP 1
                       + Y SPPPP
Sbjct: 675  DDEFIIPPFIGHQYASPPPP 694

 Score =  154 bits (389), Expect = 6e-36
 Identities = 90/172 (52%), Positives = 93/172 (54%), Gaps = 2/172 (1%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           P PPK  P    P    P      P   P  SPPP VY P  PP    SPPPPV+SPP  
Sbjct: 494 PQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPP 553

Query: 336 P-YHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
           P Y    PPPPV+SPPPP    SPPPP        SPPPP H  SP P  HSPPPP    
Sbjct: 554 PVYSPPPPPPPVHSPPPPVF--SPPPP------VYSPPPPVH--SPPPPVHSPPPPAP-- 601

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPP-PYHYTSPP 7
             HSPPPPV+SPPPP    SPPPP   P    S PP VYSPPP P    SPP
Sbjct: 602 -VHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQS-PPVVYSPPPRPPKINSPP 651

 Score =  152 bits (385), Expect = 2e-35
 Identities = 93/217 (42%), Positives = 101/217 (46%), Gaps = 45/217 (20%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPV-SPPPKVYPPVS----------------- 391
            P P    P   P P    PV  P P    PV  P P +  PV                  
Sbjct: 439  PTPVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLATPVDKPSPVPSRPVQKPQPPK 498

Query: 390  --------------------PPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSS 271
                                PP   +SPPPPVYSPP  P    SPPPPV+SPPPP  YS 
Sbjct: 499  ESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSP 558

Query: 270  PPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPP 91
            PPPPP       SPPPP    SP P  +SPPPP      HSPPPPV+SPPPP    SPPP
Sbjct: 559  PPPPP----PVHSPPPPV--FSPPPPVYSPPPP-----VHSPPPPVHSPPPPAPVHSPPP 607

Query: 90   P---PKKPYYYHSPPPPVYSPP----PPYHYTSPPPP 1
            P   P  P   +SPPPPV+SPP    PP  Y+ PP P
Sbjct: 608  PVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRP 644

 Score =  134 bits (336), Expect = 8e-30
 Identities = 81/180 (45%), Positives = 94/180 (52%), Gaps = 8/180 (4%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPVSPPPKVY---PPVYSPPPKVYPPVSPPPKVYPPVSPP 385
            P + S    ++S PPPP VY P  PPP V+   PPV+SPPP VY   SPPP V+ P  PP
Sbjct: 538  PPVHSPPPPVHSPPPPP-VYSPPPPPPPVHSPPPPVFSPPPPVY---SPPPPVHSP-PPP 592

Query: 384  YHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVS 205
             H   PP PV+SPP  P H   PPPPVYSPPPP    SPPP    P  YS PP P     
Sbjct: 593  VHSPPPPAPVHSPP-PPVHSPPPPPPVYSPPPPVF--SPPPSQSPPVVYSPPPRP----- 644

Query: 204  PKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPP-----PPKKPYYYHSPPPPVYS 40
              P  +SPP    P     P P      PP H  +P       PP   + Y SPPPP+++
Sbjct: 645  --PKINSPPVQSPP-----PAPVEKKETPPAHAPAPSDDEFIIPPFIGHQYASPPPPMFA 697

 Score =  133 bits (334), Expect = 1e-29
 Identities = 83/184 (45%), Positives = 90/184 (48%), Gaps = 11/184 (5%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP--PVYSP 346
           S  P K  P   P P    PV+ P P    P +P  K  P  + P    SP P  PV+ P
Sbjct: 416 SSTPSKPSPVHKPTPVPTTPVHKPTPV---PTTPVQKPSPVPTTPVQKPSPVPTTPVHEP 472

Query: 345 PK---KPYHYSSPPP--PVYSPPPPYHYSSPPPP-PKKPYKYSSPPPPEHHVSPKPYYHS 184
                 P    SP P  PV  P PP     P  P  + P      PPP    SP P  +S
Sbjct: 473 SPVLATPVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYS 532

Query: 183 PPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPP---KKPYYYHSPPPPVYSPPPPYHYTS 13
           PPPP  P   HSPPPPV+SPPPP  YS PPPPP     P    SPPPPVYSPPPP H  S
Sbjct: 533 PPPPPPPV--HSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVH--S 588

Query: 12  PPPP 1
           PPPP
Sbjct: 589 PPPP 592

[99][TOP]
>UniRef100_Q01942 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q01942_SOLLC
          Length = 132

 Score =  159 bits (402), Expect = 2e-37
 Identities = 86/155 (55%), Positives = 91/155 (58%)
 Frame = -3

Query: 465 PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPP 286
           PP  SPPP  Y    PPP   PP  PPY+Y SPPPP  SPP  PY+Y SPPPP  SPPPP
Sbjct: 1   PPSPSPPPPYYYKSPPPPSPSPP--PPYYYKSPPPPSPSPP-PPYYYKSPPPPSPSPPPP 57

Query: 285 YHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHY 106
           Y+Y SPPPP        SPPPP        YY SPPPP       SPPPP  SPPPP  Y
Sbjct: 58  YYYKSPPPPD------PSPPPPY-------YYKSPPPPSP-----SPPPPSPSPPPP-TY 98

Query: 105 SSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           SSPPPPP  P+Y + P PPV        Y SPPPP
Sbjct: 99  SSPPPPP--PFYENIPLPPVIG----VSYASPPPP 127

 Score =  144 bits (363), Expect = 6e-33
 Identities = 79/150 (52%), Positives = 86/150 (57%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP  Y   SPPP    P  SPPP  Y    PPP   PP  PPY+Y SPPPP  SPP 
Sbjct: 5   SPPPPYYYK--SPPP----PSPSPPPPYYYKSPPPPSPSPP--PPYYYKSPPPPSPSPPP 56

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            PY+Y SPPPP  SPPPPY+Y SPPPP        SP PP    SP P  +S PPP  P+
Sbjct: 57  -PYYYKSPPPPDPSPPPPYYYKSPPPP--------SPSPPPPSPSPPPPTYSSPPPPPPF 107

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYY 70
           Y + P PPV        Y+S PPPP  PYY
Sbjct: 108 YENIPLPPVIG----VSYAS-PPPPVIPYY 132

 Score =  101 bits (251), Expect = 6e-20
 Identities = 68/141 (48%), Positives = 71/141 (50%), Gaps = 8/141 (5%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPV-----SPPP---KVYPPVYSPPPKVYPPVSPPPKVYP 400
           PS      Y Y SPPPP   PP      SPPP      PP Y   P       PPP   P
Sbjct: 18  PSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-------PPPDPSP 70

Query: 399 PVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPP 220
           P  PPY+Y SPPPP  SP        SPPPP  SPPPP  YSSPPPPP  P+  + P PP
Sbjct: 71  P--PPYYYKSPPPP--SP--------SPPPPSPSPPPP-TYSSPPPPP--PFYENIPLPP 115

Query: 219 EHHVSPKPYYHSPPPPKKPYY 157
              VS    Y SPPPP  PYY
Sbjct: 116 VIGVS----YASPPPPVIPYY 132

[100][TOP]
>UniRef100_B9H7Q5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H7Q5_POPTR
          Length = 173

 Score =  157 bits (397), Expect = 7e-37
 Identities = 99/192 (51%), Positives = 104/192 (54%), Gaps = 11/192 (5%)
 Frame = -3

Query: 615 RSLMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKV 436
           RS MAS T TLL+  +SL+LPS  +AN Y YSSPPPPK  PP                  
Sbjct: 2   RSSMASLTATLLLVAISLSLPSQTTAN-YEYSSPPPPKKSPP------------------ 42

Query: 435 YPPVSPPPKVYPPVSPPYHYSSPPPP--VYSPPKKP--YHYSSPPPPV---YSPPPP--- 286
                PPP       PPYHY SPPPP  V+SPP  P  Y Y SPPPP     SPPPP   
Sbjct: 43  -----PPP-------PPYHYKSPPPPPPVHSPPPPPHPYKYKSPPPPPPVHKSPPPPKKP 90

Query: 285 YHYSSPPPPPKKPYKYSSPPPPEHHVSPKPY-YHSPPPPKKPYYYHSPPPPVYSPPPPYH 109
           Y Y SPPPPP       SPPPP H     PY Y SPPPP   Y Y SPP     PPPP  
Sbjct: 91  YKYKSPPPPP-----VHSPPPPSH-----PYKYKSPPPPPPVYKYKSPP-----PPPPV- 134

Query: 108 YSSPPPPPKKPY 73
           Y SPPPPPKKPY
Sbjct: 135 YKSPPPPPKKPY 146

 Score =  110 bits (275), Expect = 9e-23
 Identities = 60/109 (55%), Positives = 65/109 (59%), Gaps = 18/109 (16%)
 Frame = -3

Query: 273 SPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHS--PPPPVYSPPP---PYH 109
           S P      Y+YSSPPPP+          SPPPP  PY+Y S  PPPPV+SPPP   PY 
Sbjct: 20  SLPSQTTANYEYSSPPPPK---------KSPPPPPPPYHYKSPPPPPPVHSPPPPPHPYK 70

Query: 108 YSSP---------PPPPKKPYYYHS-PPPPVYSPPP---PYHYTSPPPP 1
           Y SP         PPPPKKPY Y S PPPPV+SPPP   PY Y SPPPP
Sbjct: 71  YKSPPPPPPVHKSPPPPKKPYKYKSPPPPPVHSPPPPSHPYKYKSPPPP 119

[101][TOP]
>UniRef100_Q09084 Extensin (Class II) n=1 Tax=Solanum lycopersicum RepID=Q09084_SOLLC
          Length = 322

 Score =  156 bits (394), Expect = 1e-36
 Identities = 103/242 (42%), Positives = 110/242 (45%), Gaps = 67/242 (27%)
 Frame = -3

Query: 525 YSSPPPPKVYP---PVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYP----------- 400
           +S PPP  VY    P SPPP VY    PPVY  PP  Y P SPPP   P           
Sbjct: 87  HSPPPPSPVYDHPSPSSPPPPVYYSPPPPVYHEPPPTYKPKSPPPPPTPSYEHPKTPSPL 146

Query: 399 --------PVSPPYHYS----SPPPPVYSPPKKPYHYSSPPPPVY------SPPPP---Y 283
                   P +PP H      SPP P Y  PK P    SPP P Y      SPPPP   Y
Sbjct: 147 PPTPSYEHPKTPPSHEHPKTPSPPTPSYEHPKTP----SPPTPSYEHPKTPSPPPPTPSY 202

Query: 282 HYSSP--PPPPKKPYKYSSPPPPEHHVSPKPYYHSPPP----------PKKPYYYHSPPP 139
            +  P  PPPP  P  Y  P  P H   P P  + PPP          P  PY Y SPPP
Sbjct: 203 EHPQPQSPPPPPTP-SYEHPKTPSHPTPPTPPCNEPPPPPPNSHWEPKPSPPYTYSSPPP 261

Query: 138 PVYSPPPP-YHYSSPPPPPKKPYYYHSPPPPVYS---PPPPYH------------YTSPP 7
           P  SPPPP Y+YSSPPPP        SPPPP YS   PPPP++            Y SPP
Sbjct: 262 PSPSPPPPTYYYSSPPPPSP------SPPPPTYSSPPPPPPFYENIPLPPVIGVSYASPP 315

Query: 6   PP 1
           PP
Sbjct: 316 PP 317

 Score =  135 bits (340), Expect = 3e-30
 Identities = 78/176 (44%), Positives = 85/176 (48%), Gaps = 19/176 (10%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYP---PVSPPPKVY--------PPVSPPYHY-- 376
           PP P    P +PP   +P   SPP   Y      SPP   Y        PP +P Y +  
Sbjct: 147 PPTPSYEHPKTPPSHEHPKTPSPPTPSYEHPKTPSPPTPSYEHPKTPSPPPPTPSYEHPQ 206

Query: 375 --SSPPPPV--YSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHV 208
             S PPPP   Y  PK P H + P PP   PPPP   S   P P  PY YSSPPPP    
Sbjct: 207 PQSPPPPPTPSYEHPKTPSHPTPPTPPCNEPPPPPPNSHWEPKPSPPYTYSSPPPPSPSP 266

Query: 207 SPKPYYHSPPPPKKPYYYHSPPPPVYS--PPPPYHYSSPPPPPKKPYYYHSPPPPV 46
            P  YY+S PPP  P    SPPPP YS  PPPP  Y + P PP     Y SPPPPV
Sbjct: 267 PPPTYYYSSPPPPSP----SPPPPTYSSPPPPPPFYENIPLPPVIGVSYASPPPPV 318

 Score =  123 bits (308), Expect = 1e-26
 Identities = 89/214 (41%), Positives = 97/214 (45%), Gaps = 29/214 (13%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPP----VYSPPPKVYPPVSPPPKVYPPVSP 388
           PS+I A  Y+    P PK  P   PPP           SPPP    P+ PPP  Y   SP
Sbjct: 11  PSVI-ALFYISFEKPKPKPKPRGPPPPTWKSSGSHNKRSPPPPKSTPL-PPPAPYKK-SP 67

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHV 208
            Y + SPPPP +      +H   PP PVY  P P   SSPPPP      Y SPPPP +H 
Sbjct: 68  TYQHRSPPPPTHKISPVTHHSPPPPSPVYDHPSP---SSPPPPV-----YYSPPPPVYHE 119

Query: 207 SPKPYY-HSPPPPKKPYYYHS------PPPPVYSPP--PPYHYSSPPPPPKKPYYYH--- 64
            P  Y   SPPPP  P Y H       PP P Y  P  PP H     P P  P Y H   
Sbjct: 120 PPPTYKPKSPPPPPTPSYEHPKTPSPLPPTPSYEHPKTPPSHEHPKTPSPPTPSYEHPKT 179

Query: 63  -SPPPPVY------SPPPP---YHY---TSPPPP 1
            SPP P Y      SPPPP   Y +    SPPPP
Sbjct: 180 PSPPTPSYEHPKTPSPPPPTPSYEHPQPQSPPPP 213

 Score =  114 bits (286), Expect = 5e-24
 Identities = 63/121 (52%), Positives = 68/121 (56%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP       P    +P   +PP    PP  P     P  SPPY YSSPPPP  SPP 
Sbjct: 209 SPPPPPTPSYEHPKTPSHPTPPTPPCNEPPPPPPNSHWEPKPSPPYTYSSPPPPSPSPPP 268

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
             Y+YSSPPPP  SPPPP  YSSPPPPP  P+  + P PP   VS    Y SPPPP  PY
Sbjct: 269 PTYYYSSPPPPSPSPPPP-TYSSPPPPP--PFYENIPLPPVIGVS----YASPPPPVIPY 321

Query: 159 Y 157
           Y
Sbjct: 322 Y 322

 Score =  106 bits (264), Expect = 2e-21
 Identities = 66/144 (45%), Positives = 74/144 (51%), Gaps = 15/144 (10%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKV-------YP-PVSPPYHYSSPP 364
           SPP P    P +P P    P Y  P    PP  P P         +P P +PP +   PP
Sbjct: 181 SPPTPSYEHPKTPSPPPPTPSYEHPQPQSPPPPPTPSYEHPKTPSHPTPPTPPCNEPPPP 240

Query: 363 PPV--YSP-PKKPYHYSSPPPPVYSPPPP-YHYSSPPPPPKKPYK--YSSPPPPEHHVSP 202
           PP   + P P  PY YSSPPPP  SPPPP Y+YSSPPPP   P    YSSPPPP      
Sbjct: 241 PPNSHWEPKPSPPYTYSSPPPPSPSPPPPTYYYSSPPPPSPSPPPPTYSSPPPPP----- 295

Query: 201 KPYYHS-PPPPKKPYYYHSPPPPV 133
            P+Y + P PP     Y SPPPPV
Sbjct: 296 -PFYENIPLPPVIGVSYASPPPPV 318

[102][TOP]
>UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S9_EHV86
          Length = 621

 Score =  155 bits (393), Expect = 2e-36
 Identities = 93/173 (53%), Positives = 93/173 (53%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP    SPPPP   PP 
Sbjct: 178 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPPS 233

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P    SPPPP  SPPPP    SPPPP   P     PPPP     P P   SPPPP  P 
Sbjct: 234 PPP--PSPPPP--SPPPP----SPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPP 285

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPP  SPPPP   S PPP P  P    SPPPP   PPPP    SPPPP
Sbjct: 286 --PSPPPP--SPPPP---SPPPPSPPPP----SPPPPSPPPPPPSPPPSPPPP 327

 Score =  155 bits (393), Expect = 2e-36
 Identities = 91/173 (52%), Positives = 91/173 (52%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP    SPPPP   PP 
Sbjct: 188 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPPS 243

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P    SPPPP  SPPPP    SPPPPP  P      PPP     P P   SPPPP  P 
Sbjct: 244 PPP--PSPPPP--SPPPP----SPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 295

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPP   PP P   S PPPPP  P     P PP  SPPPP    SPPPP
Sbjct: 296 --PSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPP----SPPPP 342

 Score =  155 bits (393), Expect = 2e-36
 Identities = 89/173 (51%), Positives = 89/173 (51%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP    SPPPP   PP 
Sbjct: 198 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPPS 253

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P     PPPP  SPPPP   S PPP P  P      PPP     P P   SPPPP  P 
Sbjct: 254 PPPPSPPPPPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 310

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPP  SPPP     SPPPP   P     P PP  SPPPP    SPPPP
Sbjct: 311 --PSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP 357

 Score =  155 bits (393), Expect = 2e-36
 Identities = 91/179 (50%), Positives = 91/179 (50%), Gaps = 6/179 (3%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP     PPPP  SPP 
Sbjct: 213 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPP 270

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPP--PPKKPYKYS----SPPPPEHHVSPKPYYHSPP 178
                 SPPPP   PP P   S PPP  PP  P   S    SPPPP     P P   SPP
Sbjct: 271 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPP 330

Query: 177 PPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           PP  P    SPPPP   PP P   S PPP P  P    SPPPP   PPPP    SPPPP
Sbjct: 331 PPSPPP--PSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPPPPSPPPSPPPP 383

 Score =  155 bits (393), Expect = 2e-36
 Identities = 93/175 (53%), Positives = 93/175 (53%), Gaps = 2/175 (1%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP    SPPPP  SPP 
Sbjct: 323 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPPPSPPP 378

Query: 339 KPYHYSSPPP--PVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
            P   S PPP  P  SPPPP      PPPP  P    SPPPP     P P   SPPPP  
Sbjct: 379 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP--PPSPPPPPSPPPPSPPPPSPPPPSP 436

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           P    SPPPP   PP P   S PPP P  P    SPPPP  SPPPP    SPPPP
Sbjct: 437 P----SPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP--SPPPP----SPPPP 477

 Score =  155 bits (391), Expect = 3e-36
 Identities = 91/173 (52%), Positives = 91/173 (52%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP SPPP   PP  SPPP   PP SPPP   PP SPP    SPPPP   PP 
Sbjct: 143 SPPPPSPPPPPSPPPPPPPP--SPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPPS 198

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P    SPPPP   PP P   S PPP P  P      PPP     P P   SPPPP  P 
Sbjct: 199 PPP--PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 256

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               PPPP  SPPPP   S PPP P  P    SPPPP  SPPPP    SPPPP
Sbjct: 257 PSPPPPPPPPSPPPP---SPPPPSPPPP----SPPPP--SPPPP----SPPPP 296

 Score =  154 bits (390), Expect = 4e-36
 Identities = 96/204 (47%), Positives = 101/204 (49%), Gaps = 1/204 (0%)
 Frame = -3

Query: 609 LMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYP 430
           L++ TT  ++   +  T P      S    SPPPP   PP  PPP   PP  SPPP   P
Sbjct: 98  LLSITTLDMMSCYIPPTTPPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPP--SPPPPPSP 155

Query: 429 PVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKK 250
           P  PPP   PP SPP    SPPPP   PP  P    SPPPP   PP P   S PPP P  
Sbjct: 156 PPPPPPPSPPPPSPPP--PSPPPPSPPPPSPPP--PSPPPPSPPPPSPPPPSPPPPSPPP 211

Query: 249 PYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPP-PPVYSPPPPYHYSSPPPPPKKPY 73
           P      PPP     P P   SPPPP  P     PP PP  SPPPP    SPPPPP  P 
Sbjct: 212 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPPPPP- 266

Query: 72  YYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPP  SPPPP    SPPPP
Sbjct: 267 ---SPPPP--SPPPP----SPPPP 281

 Score =  154 bits (390), Expect = 4e-36
 Identities = 90/174 (51%), Positives = 90/174 (51%), Gaps = 1/174 (0%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP    SPPPP   PP 
Sbjct: 248 SPPPPSPPPPSPPPP---PPPPSPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPPS 302

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPP-PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
            P    SPPPP   PPPP    SPPPP P  P      PPP     P P   SPPPP  P
Sbjct: 303 PPP--PSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 360

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               SPPPP   PPPP    SPPPP   P     P PP  SPPPP    SPPPP
Sbjct: 361 --PPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP 408

 Score =  154 bits (388), Expect = 7e-36
 Identities = 91/174 (52%), Positives = 91/174 (52%), Gaps = 1/174 (0%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP  PPP   PP  PP    SPPPP   PP 
Sbjct: 297 SPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPS 353

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP-PPPEHHVSPKPYYHSPPPPKKP 163
            P    SPPPP  SPPPP   S PPPPP  P     P PPP     P P   SPPPP  P
Sbjct: 354 PPP--PSPPPP--SPPPP---SPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 406

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               SPPPP   PPP     SPPPP   P    SPPPP  SPPPP    SPPPP
Sbjct: 407 P--PSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPP--SPPPP----SPPPP 452

 Score =  154 bits (388), Expect = 7e-36
 Identities = 90/172 (52%), Positives = 90/172 (52%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP SPPP   PP  SPPP   PP SPPP   PP SPP    SPPPP   PP 
Sbjct: 368 SPPPPPPSPPPSPPPPSPPPP-SPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPPSPPPP 424

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P   S PPP   SPPPP   S PPP P  P      PPP     P P   SPPPP  P 
Sbjct: 425 SPPPPSPPPPSPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 481

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
              SPPPP   PP P   S PPP P  P    SPPPP  SPPPP    SPPP
Sbjct: 482 --PSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP--SPPPPSPPPSPPP 525

 Score =  153 bits (387), Expect = 1e-35
 Identities = 91/174 (52%), Positives = 91/174 (52%), Gaps = 1/174 (0%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP    SPPPP   PP 
Sbjct: 193 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPPS 248

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPP-PPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
            P    SPPPP   PPPP     PP PPP  P   S PPP     SP P   SPPPP  P
Sbjct: 249 PPP--PSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPP 304

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               SPPPP   PPPP    SPPPP   P     P PP  SPPPP    SPPPP
Sbjct: 305 --PPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP 352

 Score =  153 bits (386), Expect = 1e-35
 Identities = 89/174 (51%), Positives = 89/174 (51%), Gaps = 1/174 (0%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP   PPP   PP SPPP   PP SPP    SPPPP   PP 
Sbjct: 238 SPPPPSPPPPSPPPPSPPPPSPPPPP---PPPSPPPPSPPPPSPPP--PSPPPPSPPPPS 292

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP-PPPEHHVSPKPYYHSPPPPKKP 163
            P    SPPPP   PP P   S PPPPP  P     P PPP     P P   SPPPP  P
Sbjct: 293 PPP--PSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 350

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               SPPPP   PP P   S PPPPP  P     P PP  SPPPP    SPPPP
Sbjct: 351 --PPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPP----SPPPP 398

 Score =  152 bits (385), Expect = 2e-35
 Identities = 91/175 (52%), Positives = 91/175 (52%), Gaps = 2/175 (1%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP    SPPPP   PP 
Sbjct: 358 SPPPPSPPPPSPPPPPPSPPP-SPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPPS 414

Query: 339 KPYHYSSPPP--PVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
            P   S PPP  P  SPPPP   S PPP P  P      PPP     P P   SPPPP  
Sbjct: 415 PPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 474

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           P    SPPPP   PP P   S PPP P  P    SPPPP  SPPPP    SPPPP
Sbjct: 475 P--PPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP--SPPPP----SPPPP 517

 Score =  152 bits (384), Expect = 2e-35
 Identities = 91/175 (52%), Positives = 91/175 (52%), Gaps = 2/175 (1%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP    SPPPP  SPP 
Sbjct: 267 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPPPSPPP 322

Query: 339 KPYHYSSPPP--PVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
            P   S PPP  P  SPPPP      PPPP  P    SPPPP    SP P    PPPP  
Sbjct: 323 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP--PPSPPPP----SPPPPSPPPPPPSP 376

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           P    SPPPP   PP P   S PPP P  P    SPPPP   PP P    SPPPP
Sbjct: 377 P---PSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPPSPPPPSPPPPPSPPPP 424

 Score =  152 bits (383), Expect = 3e-35
 Identities = 92/178 (51%), Positives = 92/178 (51%), Gaps = 5/178 (2%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP---PVYS 349
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP    SPPP   P   
Sbjct: 272 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSP 329

Query: 348 PPKKPYHYSSPPP--PVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPP 175
           PP  P   S PPP  P  SPPPP      PPPP  P     PPPP    SP P   SPPP
Sbjct: 330 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPP--PSPPP 387

Query: 174 PKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           P  P    SPPPP  SPPPP   S PPP P  P    SPPPP   PPP     SPPPP
Sbjct: 388 PSPP--PPSPPPP--SPPPP---SPPPPSPPPP----SPPPPPSPPPPSPPPPSPPPP 434

 Score =  151 bits (381), Expect = 5e-35
 Identities = 90/175 (51%), Positives = 90/175 (51%), Gaps = 2/175 (1%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP--PPVYSP 346
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP     PP  PP   P
Sbjct: 302 SPPPPSPPPPSPPPPPPSPPP-SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 360

Query: 345 PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
           P  P   S PPPP   PP P   S PPP P  P      PPP     P P   SPPPP  
Sbjct: 361 PPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPS 420

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           P    SPPPP  SPPPP   S PPP P  P    SPPPP  SPPPP    SPPPP
Sbjct: 421 P-PPPSPPPP--SPPPPSPPSPPPPSPPPP----SPPPP--SPPPP----SPPPP 462

 Score =  150 bits (380), Expect = 6e-35
 Identities = 90/174 (51%), Positives = 90/174 (51%), Gaps = 1/174 (0%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP SPPP   PP   PPP   PP  PPP   PP SPP    SPPPP   PP 
Sbjct: 338 SPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPP--PPSPPPPSPPPPS 394

Query: 339 KPYHYSSPP-PPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
            P     PP PP  SPPPP    SPPPPP  P     PP P     P P   SPPPP  P
Sbjct: 395 PPPPSPPPPSPPPPSPPPP----SPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPP 450

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               SPPPP   PP P   S PPP P  P    SPPPP  SPPPP    SPPPP
Sbjct: 451 --PPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP--SPPPP----SPPPP 492

 Score =  150 bits (380), Expect = 6e-35
 Identities = 91/173 (52%), Positives = 91/173 (52%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP  PPP   PP  PP    SPPPP   PP 
Sbjct: 353 SPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPS 409

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P    SPPPP  SPPPP    SPPPP   P    SPPPP     P P   SPPPP  P 
Sbjct: 410 PPP--PSPPPPP-SPPPP----SPPPPSPPPPSPPSPPPPS-PPPPSPPPPSPPPPSPP- 460

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPP   PP P   S PPP P  P    SPPPP  SPPPP    SPPPP
Sbjct: 461 -PPSPPPPSPPPPSPPPPSPPPPSPPPP----SPPPP--SPPPP----SPPPP 502

 Score =  127 bits (318), Expect = 1e-27
 Identities = 86/174 (49%), Positives = 86/174 (49%), Gaps = 2/174 (1%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVY--SPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           SPPPP   PP SPPP   PP    SPPP   PP SPPP   PP SPP    SPPPP   P
Sbjct: 414 SPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPP 471

Query: 345 PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
           P  P    SPPPP  SPPPP    SPPPP        SPPPP           SPPPP  
Sbjct: 472 PSPPP--PSPPPP--SPPPP----SPPPP--------SPPPP-----------SPPPP-- 502

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
                SPPPP  SPPPP    SPPPP   P    SPPP      PP H    PP
Sbjct: 503 -----SPPPP--SPPPP----SPPPPSPPP----SPPPSHPPSHPPMHPPMHPP 541

 Score =  110 bits (274), Expect = 1e-22
 Identities = 78/164 (47%), Positives = 79/164 (48%), Gaps = 2/164 (1%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP  PPP   PP  SPPP   PP SPPP   PP SPP    SPPPP      
Sbjct: 438 SPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPSPPPPSPP--PPSPPPP------ 487

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
                 SPPPP  SPPPP    SPPPP        SPPPP           SPPPP    
Sbjct: 488 ------SPPPP--SPPPP----SPPPP--------SPPPP-----------SPPPP---- 512

Query: 159 YYHSPPPPVYSPPPPYHYSSPPP--PPKKPYYYHSPPPPVYSPP 34
              SPPPP  SPPP     SPPP  PP  P   H P  P + PP
Sbjct: 513 ---SPPPP--SPPP-----SPPPSHPPSHP-PMHPPMHPPFLPP 545

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 43/87 (49%), Positives = 43/87 (49%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
           S PPP    PP SPPP   PP  SPPP   PP SPPP   PP SPP     PP P  SPP
Sbjct: 473 SPPPPSP--PPPSPPPP-SPPPPSPPPPSPPPPSPPPPSPPPPSPP-----PPSPPPSPP 524

Query: 342 KKPYHYSSPPPPVYSPPPPYHYSSPPP 262
             P H  S PP      PP H    PP
Sbjct: 525 --PSHPPSHPP----MHPPMHPPFLPP 545

[103][TOP]
>UniRef100_Q76KW4 Hydroxyproline-rich glycoprotein-1 (Fragment) n=1 Tax=Pisum sativum
           RepID=Q76KW4_PEA
          Length = 152

 Score =  155 bits (392), Expect = 3e-36
 Identities = 92/184 (50%), Positives = 102/184 (55%), Gaps = 9/184 (4%)
 Frame = -3

Query: 615 RSLMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKV 436
           RSLMAS + TL +A++  + PS ISAN Y YSSPPPP               V+SPPP  
Sbjct: 5   RSLMASASLTLALAILFFSFPSEISANQYSYSSPPPP---------------VHSPPP-- 47

Query: 435 YPPVSPPPKVYPPVSPPYHYSSPPPP---VYSPPKKPYHYSSPPPPVYS---PPPPYHYS 274
                  PK       PYHYSSPPPP    Y  P   YH  SPPPPV++   P P YH  
Sbjct: 48  -------PK------DPYHYSSPPPPPAHTYPHPHPVYH--SPPPPVHTYPHPHPVYHSP 92

Query: 273 SPPPPPKKPYKYSSPPPPEHHVSPKPY--YHSPPPP-KKPYYYHSPPPPVYSPPPPYHYS 103
            PP P KKPYKY SPPPP  H  P P+  YHSPPPP KKPY Y SPP     PPP + Y 
Sbjct: 93  PPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPP-----PPPVHTYP 147

Query: 102 SPPP 91
            P P
Sbjct: 148 HPSP 151

 Score =  141 bits (355), Expect = 5e-32
 Identities = 74/124 (59%), Positives = 80/124 (64%), Gaps = 14/124 (11%)
 Frame = -3

Query: 333 YHYSSPPPPVYSPPPP---YHYSSPPPPPKKPYK-----YSSPPPPEH-HVSPKPYYHSP 181
           Y YSSPPPPV+SPPPP   YHYSSPPPPP   Y      Y SPPPP H +  P P YHSP
Sbjct: 33  YSYSSPPPPVHSPPPPKDPYHYSSPPPPPAHTYPHPHPVYHSPPPPVHTYPHPHPVYHSP 92

Query: 180 PPP---KKPYYYHS-PPPPVYSPPPPYH-YSSPPPPPKKPYYYHSPPPPVYSPPPPYHYT 16
           PPP   KKPY Y S PPPPV++ P P+  Y SPPPP KKPY Y SPP     PPP + Y 
Sbjct: 93  PPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPP-----PPPVHTYP 147

Query: 15  SPPP 4
            P P
Sbjct: 148 HPSP 151

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 44/78 (56%), Positives = 46/78 (58%), Gaps = 24/78 (30%)
 Frame = -3

Query: 162 YYYHSPPPPVYSPPP---PYHYSSPPPPPKKPY-----YYHSPPPPV----------YSP 37
           Y Y SPPPPV+SPPP   PYHYSSPPPPP   Y      YHSPPPPV          +SP
Sbjct: 33  YSYSSPPPPVHSPPPPKDPYHYSSPPPPPAHTYPHPHPVYHSPPPPVHTYPHPHPVYHSP 92

Query: 36  PP------PYHYTSPPPP 1
           PP      PY Y SPPPP
Sbjct: 93  PPPTPHKKPYKYPSPPPP 110

[104][TOP]
>UniRef100_C4IYP5 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=C4IYP5_MAIZE
          Length = 441

 Score =  155 bits (392), Expect = 3e-36
 Identities = 90/191 (47%), Positives = 99/191 (51%), Gaps = 20/191 (10%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKP 334
           PPP   PP  PPP   PP+ SPPP   PP SPPP   P + PP    SPPPP+ SPP  P
Sbjct: 255 PPPSPPPPSPPPPSPPPPLMSPPPPSPPPPSPPPP--PLLPPPPQPHSPPPPLSSPPPPP 312

Query: 333 --YHYSSPPPPVYSPP----------PPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYY 190
                 SPPPP+ SPP          PP   SSPPPPP  P+   SPPPP    +P P Y
Sbjct: 313 PLPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPH---SPPPPS--PAPAPVY 367

Query: 189 HSPPPPKKPYYYHSPPP----PVYSPPPPYHYSSPPPPPKKPYYYHSPPPP----VYSPP 34
           H PPPP+ P     PPP    P +  PPP  Y   P PP  P  Y SPPPP     + P 
Sbjct: 368 HPPPPPQCPPCPVLPPPLPCTPTHPWPPPPPYYPGPFPPTDPVRYASPPPPQQHHPWPPV 427

Query: 33  PPYHYTSPPPP 1
            P  Y SPPPP
Sbjct: 428 YPVQYGSPPPP 438

 Score =  146 bits (369), Expect = 1e-33
 Identities = 84/185 (45%), Positives = 95/185 (51%), Gaps = 17/185 (9%)
 Frame = -3

Query: 504 KVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY--PPVSPPYHYSSPPPPVYSPPKKPY 331
           K + P  PPP++  P  SPPP   PP SPPP +   PP SPP     PPPP+  PP +P+
Sbjct: 241 KPFVPPMPPPRLPSPPPSPPPPSPPPPSPPPPLMSPPPPSPPPPS-PPPPPLLPPPPQPH 299

Query: 330 HYSSPPPPVYSPP----------PPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSP 181
              SPPPP+ SPP          PP   SSPPPPP  P  +S PPP      P P  HSP
Sbjct: 300 ---SPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPHSP 356

Query: 180 PPPK-KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY----SPPPPYHYT 16
           PPP   P   + PPPP   PP P     PPP P  P +   PPPP Y     P  P  Y 
Sbjct: 357 PPPSPAPAPVYHPPPPPQCPPCPV---LPPPLPCTPTHPWPPPPPYYPGPFPPTDPVRYA 413

Query: 15  SPPPP 1
           SPPPP
Sbjct: 414 SPPPP 418

 Score =  131 bits (330), Expect = 4e-29
 Identities = 79/179 (44%), Positives = 89/179 (49%), Gaps = 15/179 (8%)
 Frame = -3

Query: 492 PVSPPPKVYPPVYSPPP--------KVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           P    P+     Y+ PP        K + P  PPP++  P  PP    SPPPP   PP  
Sbjct: 216 PAQRTPQQCAAFYARPPVNCAAFHCKPFVPPMPPPRL--PSPPP----SPPPPSPPPP-- 267

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
                SPPPP+ SPPPP      PPPP  P     PPPP+ H  P P    PPPP  P  
Sbjct: 268 -----SPPPPLMSPPPP-----SPPPPSPPPPPLLPPPPQPHSPPPPLSSPPPPPPLP-Q 316

Query: 156 YHSPPPPVYSPPP----PYHYSSPPP---PPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            HSPPPP+ SPPP    P  +S PPP   PP  P   HSPPPP  +P P YH   PPPP
Sbjct: 317 PHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPHSPPPPSPAPAPVYH---PPPP 372

 Score =  117 bits (292), Expect = 1e-24
 Identities = 72/157 (45%), Positives = 78/157 (49%), Gaps = 9/157 (5%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
           L S PPPP +  P SPP    PP+ SPPP   PP  P P             SPPPP+ S
Sbjct: 305 LSSPPPPPPLPQPHSPP----PPLSSPPP---PPPLPQP------------HSPPPPLSS 345

Query: 348 PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPP----PEH-HVSPKPYYHS 184
           PP  P    SPPPP  +P P YH   PPPPP+ P     PPP    P H    P PYY  
Sbjct: 346 PPPPPPLPHSPPPPSPAPAPVYH---PPPPPQCPPCPVLPPPLPCTPTHPWPPPPPYYPG 402

Query: 183 PPPPKKPYYYHSPPPP----VYSPPPPYHYSSPPPPP 85
           P PP  P  Y SPPPP     + P  P  Y SPPPPP
Sbjct: 403 PFPPTDPVRYASPPPPQQHHPWPPVYPVQYGSPPPPP 439

 Score = 79.0 bits (193), Expect = 3e-13
 Identities = 54/137 (39%), Positives = 61/137 (44%), Gaps = 21/137 (15%)
 Frame = -3

Query: 558 LPSLISANSYLYSSPPPPKVYPPVSPPPKVY-------------PPVYSPPPKVY---PP 427
           LP   S    L S PPPP +  P SPPP +              PP  +P P  +   PP
Sbjct: 314 LPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPHSPPPPSPAPAPVYHPPPPP 373

Query: 426 VSPPPKVYPPVSP--PYHYSSPPPPVYS---PPKKPYHYSSPPPPVYSPPPPYHYSSPPP 262
             PP  V PP  P  P H   PPPP Y    PP  P  Y+SPP     PP  +H    P 
Sbjct: 374 QCPPCPVLPPPLPCTPTHPWPPPPPYYPGPFPPTDPVRYASPP-----PPQQHH----PW 424

Query: 261 PPKKPYKYSSPPPPEHH 211
           PP  P +Y SPPPP  H
Sbjct: 425 PPVYPVQYGSPPPPPLH 441

[105][TOP]
>UniRef100_B9EXV1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9EXV1_ORYSJ
          Length = 532

 Score =  155 bits (392), Expect = 3e-36
 Identities = 86/173 (49%), Positives = 92/173 (53%), Gaps = 11/173 (6%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSP--PPKVYPPVSPPYHYSSPPPPVYSPP 343
           PPPP   PP  PPP   PP  SPPP   PP SP  PP   PP SPP    SPPPP   PP
Sbjct: 364 PPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPP 423

Query: 342 K----KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPP 175
                 P +YSSPPPP Y   P   Y SPPPPP     + +PPPP + VSP+  Y SPPP
Sbjct: 424 SPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPPPAY---HEAPPPPYYEVSPEDRYLSPPP 480

Query: 174 PKKPYYYHSPPPPVYSPPPPYHYSSPPPPP----KKPYY-YHSPPPPVYSPPP 31
           P   Y    PPPP Y   P   Y SPPPP     K P Y Y SPPPP  +  P
Sbjct: 481 PPA-YQETPPPPPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPPAATWKP 532

 Score =  152 bits (385), Expect = 2e-35
 Identities = 96/202 (47%), Positives = 104/202 (51%), Gaps = 25/202 (12%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVY 352
           ++  SPPPP   PP  PPP   PP  SPPP   PP SPPP      SP     SPPPP  
Sbjct: 357 FVLPSPPPP---PPSPPPPSPPPPSPSPPPPSPPPPSPPPP-----SP-----SPPPPSP 403

Query: 351 SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP 172
            PP  P    SPPPP  SPPPP    SPPPP   P  YSSPPPP + VSP+  Y SPPPP
Sbjct: 404 PPPSPPPPSPSPPPP--SPPPP----SPPPP--SPVYYSSPPPPYYEVSPEDRYLSPPPP 455

Query: 171 KKPYYYHSPPPPVYSPPPPYH-------YSSPPPPPKKPYYYHSPPPPVY---------S 40
             P Y+ +PPPP       Y+       Y SPPPPP   Y    PPPP Y         S
Sbjct: 456 --PAYHEAPPPP-------YYEVSPEDRYLSPPPPP--AYQETPPPPPQYEVSPEDRYLS 504

Query: 39  PPPP---------YHYTSPPPP 1
           PPPP         Y Y+SPPPP
Sbjct: 505 PPPPSPVKWKLPVYEYSSPPPP 526

 Score =  139 bits (350), Expect = 2e-31
 Identities = 77/155 (49%), Positives = 88/155 (56%), Gaps = 21/155 (13%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSP--PPKVYPPVSPP----YHYSSPPPP 358
           SPPPP   PP  PPP   PP  SPPP   PP SP  PP   PP SPP     +YSSPPPP
Sbjct: 380 SPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPP 439

Query: 357 VYSPPKKPYHYSSPPPPVY--SPPPPYH-------YSSPPPPPKKPYKYSSPPPPEHHVS 205
            Y    +  + S PPPP Y  +PPPPY+       Y SPPPPP   Y+ + PPPP++ VS
Sbjct: 440 YYEVSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPA--YQETPPPPPQYEVS 497

Query: 204 PKPYYHSPPPP-----KKPYY-YHSPPPPVYSPPP 118
           P+  Y SPPPP     K P Y Y SPPPP  +  P
Sbjct: 498 PEDRYLSPPPPSPVKWKLPVYEYSSPPPPAATWKP 532

 Score =  112 bits (280), Expect = 2e-23
 Identities = 61/115 (53%), Positives = 62/115 (53%), Gaps = 2/115 (1%)
 Frame = -3

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
           K +   SPPPP  SPPPP    SPPPP   P   S PPP     SP P   SPPPP    
Sbjct: 355 KKFVLPSPPPPPPSPPPP----SPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPP---- 406

Query: 159 YYHSPPPPVYSPPPPYHYSSPP--PPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPP  SPPPP   S PP  PPP  P YY SPPPP Y   P   Y SPPPP
Sbjct: 407 ---SPPPPSPSPPPP---SPPPPSPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPP 455

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 54/117 (46%), Positives = 58/117 (49%), Gaps = 5/117 (4%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           PS    +   YSSPPPP  Y  VSP  +   P   PPP  Y    PPP  Y  VSP   Y
Sbjct: 423 PSPPPPSPVYYSSPPPP--YYEVSPEDRYLSP---PPPPAYHEAPPPP--YYEVSPEDRY 475

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPP----KKP-YKYSSPPPP 220
            SPPPP        Y  + PPPP Y   P   Y SPPPP     K P Y+YSSPPPP
Sbjct: 476 LSPPPP------PAYQETPPPPPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPP 526

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 40/85 (47%), Positives = 43/85 (50%), Gaps = 6/85 (7%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPP--KVYPP---VYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP 361
           Y SPPPP  Y    PPP  +V P    +  PPP  Y    PPP  Y  VSP   Y SPPP
Sbjct: 449 YLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYE-VSPEDRYLSPPP 507

Query: 360 PVYSPPKKP-YHYSSPPPPVYSPPP 289
           P     K P Y YSSPPPP  +  P
Sbjct: 508 PSPVKWKLPVYEYSSPPPPAATWKP 532

[106][TOP]
>UniRef100_Q8L3T8 cDNA clone:001-201-A04, full insert sequence n=2 Tax=Oryza sativa
           RepID=Q8L3T8_ORYSJ
          Length = 570

 Score =  155 bits (392), Expect = 3e-36
 Identities = 86/173 (49%), Positives = 92/173 (53%), Gaps = 11/173 (6%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSP--PPKVYPPVSPPYHYSSPPPPVYSPP 343
           PPPP   PP  PPP   PP  SPPP   PP SP  PP   PP SPP    SPPPP   PP
Sbjct: 402 PPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPP 461

Query: 342 K----KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPP 175
                 P +YSSPPPP Y   P   Y SPPPPP     + +PPPP + VSP+  Y SPPP
Sbjct: 462 SPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPPPAY---HEAPPPPYYEVSPEDRYLSPPP 518

Query: 174 PKKPYYYHSPPPPVYSPPPPYHYSSPPPPP----KKPYY-YHSPPPPVYSPPP 31
           P   Y    PPPP Y   P   Y SPPPP     K P Y Y SPPPP  +  P
Sbjct: 519 PPA-YQETPPPPPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPPAATWKP 570

 Score =  152 bits (385), Expect = 2e-35
 Identities = 96/202 (47%), Positives = 104/202 (51%), Gaps = 25/202 (12%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVY 352
           ++  SPPPP   PP  PPP   PP  SPPP   PP SPPP      SP     SPPPP  
Sbjct: 395 FVLPSPPPP---PPSPPPPSPPPPSPSPPPPSPPPPSPPPP-----SP-----SPPPPSP 441

Query: 351 SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP 172
            PP  P    SPPPP  SPPPP    SPPPP   P  YSSPPPP + VSP+  Y SPPPP
Sbjct: 442 PPPSPPPPSPSPPPP--SPPPP----SPPPP--SPVYYSSPPPPYYEVSPEDRYLSPPPP 493

Query: 171 KKPYYYHSPPPPVYSPPPPYH-------YSSPPPPPKKPYYYHSPPPPVY---------S 40
             P Y+ +PPPP       Y+       Y SPPPPP   Y    PPPP Y         S
Sbjct: 494 --PAYHEAPPPP-------YYEVSPEDRYLSPPPPP--AYQETPPPPPQYEVSPEDRYLS 542

Query: 39  PPPP---------YHYTSPPPP 1
           PPPP         Y Y+SPPPP
Sbjct: 543 PPPPSPVKWKLPVYEYSSPPPP 564

 Score =  139 bits (350), Expect = 2e-31
 Identities = 77/155 (49%), Positives = 88/155 (56%), Gaps = 21/155 (13%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSP--PPKVYPPVSPP----YHYSSPPPP 358
           SPPPP   PP  PPP   PP  SPPP   PP SP  PP   PP SPP     +YSSPPPP
Sbjct: 418 SPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPVYYSSPPPP 477

Query: 357 VYSPPKKPYHYSSPPPPVY--SPPPPYH-------YSSPPPPPKKPYKYSSPPPPEHHVS 205
            Y    +  + S PPPP Y  +PPPPY+       Y SPPPPP   Y+ + PPPP++ VS
Sbjct: 478 YYEVSPEDRYLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPA--YQETPPPPPQYEVS 535

Query: 204 PKPYYHSPPPP-----KKPYY-YHSPPPPVYSPPP 118
           P+  Y SPPPP     K P Y Y SPPPP  +  P
Sbjct: 536 PEDRYLSPPPPSPVKWKLPVYEYSSPPPPAATWKP 570

 Score =  112 bits (280), Expect = 2e-23
 Identities = 61/115 (53%), Positives = 62/115 (53%), Gaps = 2/115 (1%)
 Frame = -3

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
           K +   SPPPP  SPPPP    SPPPP   P   S PPP     SP P   SPPPP    
Sbjct: 393 KKFVLPSPPPPPPSPPPP----SPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPP---- 444

Query: 159 YYHSPPPPVYSPPPPYHYSSPP--PPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPP  SPPPP   S PP  PPP  P YY SPPPP Y   P   Y SPPPP
Sbjct: 445 ---SPPPPSPSPPPP---SPPPPSPPPPSPVYYSSPPPPYYEVSPEDRYLSPPPP 493

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 54/117 (46%), Positives = 58/117 (49%), Gaps = 5/117 (4%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           PS    +   YSSPPPP  Y  VSP  +   P   PPP  Y    PPP  Y  VSP   Y
Sbjct: 461 PSPPPPSPVYYSSPPPP--YYEVSPEDRYLSP---PPPPAYHEAPPPP--YYEVSPEDRY 513

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPP----KKP-YKYSSPPPP 220
            SPPPP        Y  + PPPP Y   P   Y SPPPP     K P Y+YSSPPPP
Sbjct: 514 LSPPPP------PAYQETPPPPPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPP 564

 Score = 66.6 bits (161), Expect = 2e-09
 Identities = 40/85 (47%), Positives = 43/85 (50%), Gaps = 6/85 (7%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPP--KVYPP---VYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP 361
           Y SPPPP  Y    PPP  +V P    +  PPP  Y    PPP  Y  VSP   Y SPPP
Sbjct: 487 YLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYE-VSPEDRYLSPPP 545

Query: 360 PVYSPPKKP-YHYSSPPPPVYSPPP 289
           P     K P Y YSSPPPP  +  P
Sbjct: 546 PSPVKWKLPVYEYSSPPPPAATWKP 570

[107][TOP]
>UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2B5_EHV86
          Length = 2332

 Score =  155 bits (391), Expect = 3e-36
 Identities = 90/177 (50%), Positives = 96/177 (54%), Gaps = 4/177 (2%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPP-VSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            +PPPP   PP +P P   PP  SPPP + PP + PPP   PP+ PP    SPPPP   PP
Sbjct: 1685 APPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPP 1744

Query: 342  KKPYHYS-SPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
              P     SPPPP  SPPPP    SPPPP   P    SPPPP    SP P   SP PP  
Sbjct: 1745 SPPPSPPPSPPPP--SPPPPSLSPSPPPPSTSP----SPPPPSASPSPPPPSASPSPPP- 1797

Query: 165  PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY--SPPPPYHYTSPPPP 1
            P    SPPPP  SP PP   +SP PPP  P    SPPPP    SPPPP    SPPPP
Sbjct: 1798 PSLSPSPPPPSTSPSPPPPPASPSPPP--PSASPSPPPPSSSPSPPPPSSSPSPPPP 1852

 Score =  150 bits (380), Expect = 6e-35
 Identities = 91/180 (50%), Positives = 94/180 (52%), Gaps = 7/180 (3%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVY------SPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPP 358
            SPPPP   PP+ PPP   PP+       SPPP   PP SPPP   PP SPP    SPPPP
Sbjct: 1707 SPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPS--PPPSPPP--PSPPPP 1762

Query: 357  VYSP-PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSP 181
              SP P  P    SPPPP  SP PP   +SP PPP  P    SPPPP    SP P   SP
Sbjct: 1763 SLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPP--PSLSPSPPPPSTSPSPPPPPASP 1820

Query: 180  PPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             PP  P    SPPPP  SP PP   SSP PPP        P PP  SPPPP   T P PP
Sbjct: 1821 SPPP-PSASPSPPPPSSSPSPPPPSSSPSPPPPSLSPSPPPSPPPSSPPPPSPPTPPAPP 1879

 Score =  150 bits (379), Expect = 8e-35
 Identities = 93/187 (49%), Positives = 98/187 (52%), Gaps = 2/187 (1%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
            P+  S +S   S  PPP + PP  PPP   PP   PPP   PP  PPP   PP  PP   
Sbjct: 1694 PNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPS--PPSPPPPSPPPPSPPPSPP 1751

Query: 375  SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
             SPPPP  SPP  P    SPPPP  SP PP   +SP PPP  P    SPPPP    SP P
Sbjct: 1752 PSPPPP--SPPP-PSLSPSPPPPSTSPSPPPPSASPSPPP--PSASPSPPPPSLSPSPPP 1806

Query: 195  YYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYH-- 22
               SP PP  P    SPPPP  SP PP   SSP PPP  P    SPPPP  SP PP    
Sbjct: 1807 PSTSPSPPPPP-ASPSPPPPSASPSPPPPSSSPSPPP--PSSSPSPPPPSLSPSPPPSPP 1863

Query: 21   YTSPPPP 1
             +SPPPP
Sbjct: 1864 PSSPPPP 1870

 Score =  145 bits (366), Expect = 3e-33
 Identities = 84/177 (47%), Positives = 91/177 (51%), Gaps = 5/177 (2%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            +PPPP   PP  PPP   PP  SPPP + PP  PPP + PP SPP   S PP P  SPP 
Sbjct: 990  APPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPP--SPPPSPPPSPPP 1047

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPP--PPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
             P   + PPP   +PPPP    SPPP  PP  P   + PPP     SP P    PPPP  
Sbjct: 1048 SPPPPTPPPP---APPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSP 1104

Query: 165  PYYYHSPP-PPVYSPPPPYHYSSPP--PPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
            P     PP PP   PPPP    SPP  PPP  P     P PP  +PPPP    SPPP
Sbjct: 1105 PPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPP 1161

 Score =  145 bits (365), Expect = 3e-33
 Identities = 90/178 (50%), Positives = 95/178 (53%), Gaps = 2/178 (1%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
           L  SPPPP + P   PPP + P   SPPP    P  PPP V P   PP    SPPPP  S
Sbjct: 231 LSPSPPPPSLSPS-PPPPSISP---SPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLS 286

Query: 348 PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYS-SPPPPEHHVSPKPYYHSPPPP 172
           P   P   S  PPP  SPPPP   +SP PPP+ P   S SPPPP    SP P   SP PP
Sbjct: 287 PSPPPPSLSPSPPP--SPPPP--STSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPP 342

Query: 171 KKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPY-HYTSPPPP 1
             P    SPPPP +SP PP    SP PPP  P    SPPPP  SPPPP     SPPPP
Sbjct: 343 -PPSLSPSPPPPSFSPSPPPPSLSPSPPPATP--PPSPPPP--SPPPPLPPPPSPPPP 395

 Score =  144 bits (364), Expect = 4e-33
 Identities = 84/176 (47%), Positives = 89/176 (50%), Gaps = 4/176 (2%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            +PPPP   PP  PPP   PP  SPPP + PP  PPP V PP SPP     PPPP+  PP 
Sbjct: 903  APPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPP---PLPPPPLPPPPL 959

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPP-PPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
             P     PP P  SPPP    S PP PPP  P   + PPP     SP P    PPPP  P
Sbjct: 960  PP-----PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPP 1014

Query: 162  YYYHSPP-PPVYSPPPPYHYSSPP--PPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
                 PP PP   PPPP    SPP  PPP  P     P PP  +PPPP    SPPP
Sbjct: 1015 PPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPP 1070

 Score =  144 bits (363), Expect = 6e-33
 Identities = 83/173 (47%), Positives = 90/173 (52%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            SPPPP   PP  PPP   PP   PP  + PP SPPP + PP  PP     PP P  SPP 
Sbjct: 802  SPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPP 861

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
             P     P PP  +PPPP    +PPPP   P    SPPPP    +P P   +PPPP  P 
Sbjct: 862  SPPPSPPPSPPPPTPPPP----APPPPAPPPSPPPSPPPP----TPPP--PAPPPPNPPP 911

Query: 159  YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               SPPPP+  PPPP   S PPP P  P     PPPPV  PPPP     PPPP
Sbjct: 912  --PSPPPPLPLPPPP---SPPPPLPPPPL----PPPPV--PPPPSPPPLPPPP 953

 Score =  144 bits (362), Expect = 8e-33
 Identities = 82/176 (46%), Positives = 89/176 (50%), Gaps = 3/176 (1%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            SPPPP   PP  PPP   PP   PP  + PP SPPP + PP  PP     PP P  SPP 
Sbjct: 980  SPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPP 1039

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
             P     P PP  +PPPP    +PPPP   P    SPPPP    +P P   +PPPP  P 
Sbjct: 1040 SPPPSPPPSPPPPTPPPP----APPPPAPPPSPPPSPPPP----TPPP--PAPPPPNPPP 1089

Query: 159  YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSP---PPPYHYTSPPPP 1
               SPPPP+  PPPP      PPPP  P     PP P  SP   PPP    SPPPP
Sbjct: 1090 --PSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPP 1143

 Score =  143 bits (361), Expect = 1e-32
 Identities = 80/172 (46%), Positives = 87/172 (50%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            +PPPP   PP  PPP   PP  SPPP + PP  PPP + PP SPP   S PP P  SPP 
Sbjct: 1081 APPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPP--SPPPSPPPSPPP 1138

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
             P   + PPP   +PPPP    SPPP P  P      PPP +   P P    PPPP    
Sbjct: 1139 SPPPPTPPPP---APPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPP---- 1191

Query: 159  YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
               SPPPP+  PPPP      PPPP  P     P PP   PPPP    SPPP
Sbjct: 1192 ---SPPPPL--PPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPP 1238

 Score =  143 bits (361), Expect = 1e-32
 Identities = 88/188 (46%), Positives = 90/188 (47%), Gaps = 14/188 (7%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PP P   PP SPPP   PP+  PPP   PP  PPP V PP SPP     P PP  SPP
Sbjct: 1584 SPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPP 1643

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPP-PPPKKPYKYSSP--------PPPEHHVSPK--P 196
              P     P PP   PP P     PP PPP  P   S P        PPP +  SP   P
Sbjct: 1644 PSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMP 1703

Query: 195  YYHSPPPPKKPYYYHSPP-PPVYSPPPPYHYSSPPPPPKKPYYYHSPP--PPVYSPPPPY 25
               SPPPP  P     PP PP   PPPP   S PPP P  P    SPP  PP  SPPPP 
Sbjct: 1704 PSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPS 1763

Query: 24   HYTSPPPP 1
               SPPPP
Sbjct: 1764 LSPSPPPP 1771

 Score =  143 bits (360), Expect = 1e-32
 Identities = 87/189 (46%), Positives = 89/189 (47%), Gaps = 16/189 (8%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP-PVYSPP 343
            SPPPP   PP   PP   PP   PPP   PP+ PPP   PP  PP    SPPP P  SPP
Sbjct: 1600 SPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPP 1659

Query: 342  KKPYHYSSPP------PPVYSPPPPYHYSSPPPPPKKPYKYSSPP---------PPEHHV 208
              P     PP      PP+ SPP P      PPPP  P   S PP         PP    
Sbjct: 1660 PSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPP 1719

Query: 207  SPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPP 28
             P P    PPPP  P    SPPPP  SPPPP    SPPP P  P    SPPPP  SP PP
Sbjct: 1720 PPNPPPPLPPPPSPP----SPPPP--SPPPPSPPPSPPPSPPPP----SPPPPSLSPSPP 1769

Query: 27   YHYTSPPPP 1
               TSP PP
Sbjct: 1770 PPSTSPSPP 1778

 Score =  143 bits (360), Expect = 1e-32
 Identities = 90/192 (46%), Positives = 92/192 (47%), Gaps = 18/192 (9%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYP-PVSPPYHYSSPPP----P 358
            S PP P   PP   PP   PP+ SPP    PP SPPP   P P S P   S PPP    P
Sbjct: 1657 SPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPP 1716

Query: 357  VYSPPKKPYHYSSPP---------PPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVS 205
            +  PP  P     PP         PP  SPPP    S PPP P  P    SPPPP    S
Sbjct: 1717 LPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPS 1776

Query: 204  PKPYYHSPPPPKKPYYYHSPPPPVY--SPPPPYHYSSPPPPPKKPYYYHSPPPPVY--SP 37
            P P   SP PP  P    SPPPP    SPPPP    SPPPPP  P    SPPPP    SP
Sbjct: 1777 PPPPSASPSPP-PPSASPSPPPPSLSPSPPPPSTSPSPPPPPASP----SPPPPSASPSP 1831

Query: 36   PPPYHYTSPPPP 1
            PPP    SPPPP
Sbjct: 1832 PPPSSSPSPPPP 1843

 Score =  142 bits (359), Expect = 2e-32
 Identities = 84/174 (48%), Positives = 91/174 (52%), Gaps = 1/174 (0%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            SPPPP   PP SPPP   PP   PPP   PP+ PPP   PP+ PP   S PP P  SPP 
Sbjct: 684  SPPPPSPSPPPSPPPPS-PPPSPPPPSPPPPLPPPPLPPPPLPPP---SPPPSPPPSPPP 739

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPP-PPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
             P   + PPP   +PPPP    +PPP PP  P     P PP     P P   +PPPP  P
Sbjct: 740  SPPPPTPPPP---APPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPP 796

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                SPPP   SPPPP      PPPP  P    SPPPP+  PPPP    SPPPP
Sbjct: 797  ---PSPPP---SPPPPTPPPPAPPPPNPP--PPSPPPPLPLPPPP----SPPPP 838

 Score =  142 bits (358), Expect = 2e-32
 Identities = 85/176 (48%), Positives = 87/176 (49%), Gaps = 2/176 (1%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PP P   PP SPPP   PP   PPP   PP SPPP   PP  PP    +PPPP   PP
Sbjct: 767  SPPPSPPPSPPPSPPPPTPPPPAPPPPT--PPPSPPPSPPPPTPPP---PAPPPPNPPPP 821

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP-PPPEHHVSPKPYYHSP-PPPK 169
              P     PPPP  SPPPP      PPPP  P     P PPP    SP P    P PPP 
Sbjct: 822  SPPPPLPLPPPP--SPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPP 879

Query: 168  KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             P     PP P  SPPPP      PPPP  P    SPPPP+  PPPP    SPPPP
Sbjct: 880  APPPPAPPPSPPPSPPPPTPPPPAPPPPNPP--PPSPPPPLPLPPPP----SPPPP 929

 Score =  142 bits (358), Expect = 2e-32
 Identities = 80/172 (46%), Positives = 86/172 (50%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            +PPPP   PP  PPP   PP  SPPP + PP  PPP + PP SPP   S PP P  SPP 
Sbjct: 812  APPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPP--SPPPSPPPSPPP 869

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
             P    +PPPP   PP P     P PPP  P   + PPP     SP P    PPPP    
Sbjct: 870  SPPP-PTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPP---- 924

Query: 159  YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
               SPPPP+  PPPP      PPPP  P     P PP   PPPP    SPPP
Sbjct: 925  ---SPPPPL--PPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPP 971

 Score =  142 bits (358), Expect = 2e-32
 Identities = 85/180 (47%), Positives = 88/180 (48%), Gaps = 9/180 (5%)
 Frame = -3

Query: 513  PPPKVYPPVSPPPKVYP-PVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPP + PP SPPP   P P  SPPP   PP  PPP   PP  PP    SPPPP   PP  
Sbjct: 845  PPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAP 904

Query: 336  PYHYS---SPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
            P       SPPPP+  PPPP      PPPP  P     PPPP     P P    PP P  
Sbjct: 905  PPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPV--PPPPSPPPLPPPPLPPPPLPPP 962

Query: 165  PYYYHSPPP-----PVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            P    SPPP     P  SPPPP      PPPP  P    SPPPP+  PPPP    SPPPP
Sbjct: 963  PSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPP--PSPPPPLPLPPPP----SPPPP 1016

 Score =  142 bits (357), Expect = 3e-32
 Identities = 79/176 (44%), Positives = 84/176 (47%), Gaps = 3/176 (1%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            SPPPP   PP+ PPP   PP+  P P   PP SPPP   PP  PP    +PPPP   P  
Sbjct: 704  SPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPP---PAPPPPAPPPAP 760

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
             P    SPPP     PPP      PPPP  P     P PP     P P   +PPPP  P 
Sbjct: 761  PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPP 820

Query: 159  YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSP---PPPYHYTSPPPP 1
               SPPPP+  PPPP      PPPP  P     PP P  SP   PPP    SPPPP
Sbjct: 821  --PSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPP 874

 Score =  142 bits (357), Expect = 3e-32
 Identities = 86/180 (47%), Positives = 89/180 (49%), Gaps = 7/180 (3%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYP-PVYSPPPKVYPPVSPPPKVYPPVSPPYHYS-----SPPPP 358
            SPPPP   PP  PPP   P P  SPPP   PP +PPP   PP SPP         SPPPP
Sbjct: 1048 SPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPP 1107

Query: 357  VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPP 178
            +  PP  P     PP P  SPPP    S PP PP       +PPPP    SP P   SPP
Sbjct: 1108 LPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPP---SPP 1164

Query: 177  PPKKPYYYHSPP-PPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            PP  P     PP PP  SPPPP      PPPP  P     PPPPV  PPPP     PPPP
Sbjct: 1165 PPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPP--PPLPPPPV--PPPPSPPPLPPPP 1220

 Score =  141 bits (355), Expect = 5e-32
 Identities = 86/184 (46%), Positives = 90/184 (48%), Gaps = 12/184 (6%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYP-----PVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP-P 358
            SPPPP   PP+ PPP   P     P  SPPP   PP  PPP   PP  PP    SPPP P
Sbjct: 709  SPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSP 768

Query: 357  VYSPPKKPYHYSSPP-PPVYSPPPPYHYSSPPP--PPKKPYKYSSPPPPEHHVSPKPYYH 187
              SPP  P     PP PP  +PPPP    SPPP  PP  P   + PPP     SP P   
Sbjct: 769  PPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLP 828

Query: 186  SPPPPKKPYYYHSPP-PPVYSPPPPYHYSSPP--PPPKKPYYYHSPPPPVYSPPPPYHYT 16
             PPPP  P     PP PP   PPPP    SPP  PPP  P     P PP  +PPPP    
Sbjct: 829  LPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPP 888

Query: 15   SPPP 4
            SPPP
Sbjct: 889  SPPP 892

 Score =  140 bits (354), Expect = 6e-32
 Identities = 92/195 (47%), Positives = 96/195 (49%), Gaps = 13/195 (6%)
 Frame = -3

Query: 546 ISANSYLYSSPPPPKVYPPV---SPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           I +  Y  S P PP + PP    SPPP    P  SPPP    P  PPP + P   PP   
Sbjct: 202 IPSPPYPPSLPSPPSLPPPSASPSPPPPSLSP--SPPPPSLSPSPPPPSISPSPPPPSLS 259

Query: 375 SSPPPPVYSP-PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP-----PPPEH 214
            SPPPP  SP P  P    SPPPP  SP PP    SP PPP  P   +SP     PPP  
Sbjct: 260 PSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSA 319

Query: 213 HVSPKPYYHSPPPPKKPYYYHSPPPPVYSP--PPPYHYSSPPPPPKKPYYYHSPPP--PV 46
             SP P   SP PP  P    SPPPP  SP  PPP    SPPPP   P    SPPP  P 
Sbjct: 320 SPSPPPPSLSPSPPP-PSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSP----SPPPATPP 374

Query: 45  YSPPPPYHYTSPPPP 1
            SPPPP    SPPPP
Sbjct: 375 PSPPPP----SPPPP 385

 Score =  140 bits (354), Expect = 6e-32
 Identities = 86/181 (47%), Positives = 90/181 (49%), Gaps = 10/181 (5%)
 Frame = -3

Query: 513  PPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKP 334
            PPP V PP SPPP   PP+  PPP + PP SPPP   PP  PP    SPPPP   PP  P
Sbjct: 936  PPPPVPPPPSPPPLPPPPL--PPPPLPPPPSPPPSP-PPSPPPSPPPSPPPPTPPPPAPP 992

Query: 333  YHYS---SPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP------PPPEHHVSPKPYYHSP 181
                   SPPPP+  PPPP      PPPP  P     P      PPP    SP P    P
Sbjct: 993  PPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPP 1052

Query: 180  -PPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
             PPP  P     PP P  SPPPP      PPPP  P    SPPPP+  PPPP    SPPP
Sbjct: 1053 TPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPP--PPSPPPPLPLPPPP----SPPP 1106

Query: 3    P 1
            P
Sbjct: 1107 P 1107

 Score =  140 bits (354), Expect = 6e-32
 Identities = 85/175 (48%), Positives = 91/175 (52%), Gaps = 4/175 (2%)
 Frame = -3

Query: 513  PPPKVYPPVSPPPKVYP-PVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPP + PP SPPP   P P  SPPP   PP  PPP   PP  PP    SPPPP   PP  
Sbjct: 1023 PPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAP 1082

Query: 336  PYHYS---SPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
            P       SPPPP+  PPPP      PPPP  P     PPPP    SP P   SPPP   
Sbjct: 1083 PPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPL--PPPPSPPPSPPP---SPPPSPP 1137

Query: 165  PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            P    SPPPP  +PPPP    +PPPP   P    SPPPP  +PPPP    +PPPP
Sbjct: 1138 P----SPPPP--TPPPP----APPPPAPPPSPPPSPPPP--TPPPP----APPPP 1176

 Score =  140 bits (353), Expect = 8e-32
 Identities = 83/175 (47%), Positives = 85/175 (48%), Gaps = 1/175 (0%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PP P   PP SPPP   PP   PPP   PP SPPP   PP  PP    +PPPP   PP
Sbjct: 1036 SPPPSPPPSPPPSPPPPTPPPPAPPPPA--PPPSPPPSPPPPTPPP---PAPPPPNPPPP 1090

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP-PPPEHHVSPKPYYHSPPPPKK 166
              P     PPPP  SPPPP      PPPP  P     P PPP    SP P   SPPPP  
Sbjct: 1091 SPPPPLPLPPPP--SPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPP---SPPPPTP 1145

Query: 165  PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            P     PP P  SPPP     +PPPP   P     P PP   PPPP    SPPPP
Sbjct: 1146 PPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPP----SPPPP 1196

 Score =  140 bits (353), Expect = 8e-32
 Identities = 82/173 (47%), Positives = 85/173 (49%), Gaps = 2/173 (1%)
 Frame = -3

Query: 513  PPPKVYPPVSPPPKVYP-PVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPP + PP SPPP   P P  SPPP   PP  PPP   PP  PP    SPPPP   PP  
Sbjct: 1114 PPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAP 1173

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPP-PPEHHVSPKPYYHSPPPPKKPY 160
            P    +PPPP  SPPPP      PPPP  P     PP PP     P P    PPPP  P 
Sbjct: 1174 P--PPNPPPP--SPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPP- 1228

Query: 159  YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                PP P  SPPP    S PP PP  P     P PP  +PPPP    SPPPP
Sbjct: 1229 ----PPSPPPSPPPSPPPSPPPSPPPSP---PPPTPPPPAPPPPTPPPSPPPP 1274

 Score =  140 bits (352), Expect = 1e-31
 Identities = 88/192 (45%), Positives = 96/192 (50%), Gaps = 4/192 (2%)
 Frame = -3

Query: 564 LTLPSLISANSYLYSSPPPPKV-YPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSP 388
           LT+    +  + + S P PP +  PP  PPP   P   SPPP    P  PPP + P   P
Sbjct: 190 LTICKFFAFATDIPSPPYPPSLPSPPSLPPPSASP---SPPPPSLSPSPPPPSLSPSPPP 246

Query: 387 PYHYSSPPPPVYSP-PKKPYHYSSPPPP-VY-SPPPPYHYSSPPPPPKKPYKYSSPPPPE 217
           P    SPPPP  SP P  P    SPPPP +  SPPPP    SPPPP   P    SPPPP 
Sbjct: 247 PSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPS 306

Query: 216 HHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSP 37
              SP P    PPP   P    SPPPP  SP PP    SP PPP  P    SPPPP +SP
Sbjct: 307 TSPSPPP---RPPPSASP----SPPPPSLSPSPPPPSLSPSPPP--PSLSPSPPPPSFSP 357

Query: 36  PPPYHYTSPPPP 1
            PP    SP PP
Sbjct: 358 SPPPPSLSPSPP 369

 Score =  140 bits (352), Expect = 1e-31
 Identities = 90/188 (47%), Positives = 95/188 (50%), Gaps = 17/188 (9%)
 Frame = -3

Query: 513  PPPKVYPPVSPPPKVYP-PVYSPPPKVYPPVSP--PPKVYPPVSPPYH---YSSPPPPVY 352
            PPP + PP SPPP   P P  SPPP   P  SP  PP   PP SPP       +PPPP  
Sbjct: 1632 PPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSP 1691

Query: 351  SPPKKPYHYS-----SPPPPVYSPPPPYHYSSPPPPPKKPYKYS----SPPPPEHHVSPK 199
             PP  P   S     SPPPP+  PP P   + PPP P  P   S    SPPPP    SP 
Sbjct: 1692 PPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPP 1751

Query: 198  PYYHSPPPPKKP--YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPY 25
            P   SPPPP  P      SPPPP  SP PP   +SP PPP  P    SPPPP  SP PP 
Sbjct: 1752 P---SPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPP--PSASPSPPPPSLSPSPPP 1806

Query: 24   HYTSPPPP 1
              TSP PP
Sbjct: 1807 PSTSPSPP 1814

 Score =  139 bits (351), Expect = 1e-31
 Identities = 90/190 (47%), Positives = 92/190 (48%), Gaps = 19/190 (10%)
 Frame = -3

Query: 513  PPPKVYPPVSPPPKVYPPVYSPP-PKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPP V PP SPPP   PP+  PP P   PP SPPP   PP  PP     PPPP   PP  
Sbjct: 1618 PPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSP-PPSPPPSPSPLPPPPTPPPPSP 1676

Query: 336  PYHYSSPP---PPVYSPPPP-------YHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYH 187
            P    SPP   PP  SPPPP          S  PPPP  P     PP P   + P P   
Sbjct: 1677 PL--PSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPP 1734

Query: 186  SPPPPKKPYYYH------SPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY--SPPP 31
            SPPPP  P          SPPPP  SPPPP    SPPPP   P    SPPPP    SPPP
Sbjct: 1735 SPPPPSPPPPSPPPSPPPSPPPP--SPPPPSLSPSPPPPSTSP----SPPPPSASPSPPP 1788

Query: 30   PYHYTSPPPP 1
            P    SPPPP
Sbjct: 1789 PSASPSPPPP 1798

 Score =  139 bits (350), Expect = 2e-31
 Identities = 82/176 (46%), Positives = 85/176 (48%), Gaps = 3/176 (1%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            SPPPP   PP   PP   PP   PPP V PP SPPP   PP+ PP     PP P  SPP 
Sbjct: 913  SPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPP-PLPPPPSPPPSPPP 971

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
             P     P PP  +PPPP      PPPP  P     PPPP    SP P    PP P  P 
Sbjct: 972  SPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPP----SPPPPLPPPPLPPPPL 1027

Query: 159  YYHSPPPPVYSP-PPPYHYSSPPPPPKKPYYYHSPPPPVYSP--PPPYHYTSPPPP 1
                PPPP   P PPP    SPPP P  P    +PPPP   P  PPP    SPPPP
Sbjct: 1028 ----PPPPSPPPSPPPSPPPSPPPSPPPP----TPPPPAPPPPAPPPSPPPSPPPP 1075

 Score =  139 bits (350), Expect = 2e-31
 Identities = 82/174 (47%), Positives = 85/174 (48%), Gaps = 1/174 (0%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PP P   PP SPPP   PP   PPP   PP  PPP   PP  PP    SPPPP+  PP
Sbjct: 968  SPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPP--PP----SPPPPLPPPP 1021

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P     PP P  SPPP    S PP PP       +PPPP    SP P   SPPPP  P
Sbjct: 1022 LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPP---SPPPPTPP 1078

Query: 162  YYYHSPP-PPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
                 PP PP  SPPPP     PP PP        PPPP+  PPPP    SPPP
Sbjct: 1079 PPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPL--PPPPSPPPSPPP 1130

 Score =  137 bits (346), Expect = 5e-31
 Identities = 82/176 (46%), Positives = 88/176 (50%), Gaps = 3/176 (1%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            SPPPP   PP  PPP   PP  SPPP +  P+ PPP   PP+ PP     PPPPV  PP 
Sbjct: 893  SPPPPTPPPPAPPPPNPPPP--SPPPPL--PLPPPPSPPPPLPPP---PLPPPPVPPPPS 945

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
             P     PPPP+  PP P   S PP PP  P     P PP     P P   +PPPP  P 
Sbjct: 946  PP---PLPPPPLPPPPLPPPPSPPPSPPPSP----PPSPPPSPPPPTPPPPAPPPPNPP- 997

Query: 159  YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSP---PPPYHYTSPPPP 1
               SPPPP+  PPPP      PPPP  P     PP P  SP   PPP    SPPPP
Sbjct: 998  -PPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPP 1052

 Score =  137 bits (344), Expect = 9e-31
 Identities = 84/174 (48%), Positives = 88/174 (50%), Gaps = 1/174 (0%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYP-PVSPPYHYSSPPPPVYSPP 343
            SPPPP   PP SPPP   PP  SPPP   PP  PPP V P P+ PP   S PP P  SPP
Sbjct: 1540 SPPPPSPSPPPSPPPPSPPP--SPPPPSPPPPLPPPPVPPSPLPPP---SPPPSPPPSPP 1594

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P    SPPPP+  PPPP    SPPPP   P     P PP     P P   SPPP   P
Sbjct: 1595 PSPP--PSPPPPLPLPPPP----SPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPP 1648

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                SPPP     PPP     PPPP   P     P PP+ +PPPP    SPPPP
Sbjct: 1649 ----SPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPP----SPPPP 1694

 Score =  136 bits (342), Expect = 2e-30
 Identities = 85/177 (48%), Positives = 88/177 (49%), Gaps = 5/177 (2%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPP-PKVYPPVSPPYHYSSPPPPVYSPP 343
            SPPPP   PP SPPP   PP   PPP   PP+ PP P   PP SPP    SPPPP   PP
Sbjct: 695  SPPPPS--PPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPP---PSPPPPTPPPP 749

Query: 342  KKPYHYSSPPPPVYSP--PPPYHYSSPPPPPKKPY-KYSSPPPPEHHVSPKPYYHSPPPP 172
              P     P PP   P  PPP    SPPP P  P     +PPPP    SP P   SPPPP
Sbjct: 750  APPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPP---SPPPP 806

Query: 171  KKPYYYHSPP-PPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
              P     PP PP  SPPPP     PP PP        PPPP+  PPPP    SPPP
Sbjct: 807  TPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPL--PPPPSPPPSPPP 861

 Score =  136 bits (342), Expect = 2e-30
 Identities = 84/174 (48%), Positives = 89/174 (51%), Gaps = 2/174 (1%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP   PPV PPP   PP   PPP   PP+ PPP   PP SPP      PPP   PP  
Sbjct: 931  PPPPLPPPPVPPPPS--PPPLPPPPLPPPPLPPPPS--PPPSPPPSPPPSPPPSPPPPTP 986

Query: 336  PYHYSSPP-PPVYSPPPPYHYSSPP-PPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
            P     PP PP  SPPPP     PP PPP  P     PPP     SP P   SPPP   P
Sbjct: 987  PPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPP---SPPPSPPP 1043

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                SPPPP  +PPPP    +PPPP   P    SPPPP  +PPPP    +PPPP
Sbjct: 1044 SPPPSPPPP--TPPPP----APPPPAPPPSPPPSPPPP--TPPPP----APPPP 1085

 Score =  135 bits (340), Expect = 3e-30
 Identities = 81/178 (45%), Positives = 87/178 (48%), Gaps = 5/178 (2%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            SPPPP   PP+ PPP    P+  P P   PP SPPP   PP SPP     PPPP   PP 
Sbjct: 1560 SPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPS--PPPSPPPPLPLPPPPSPPPPL 1617

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPP-PEHHVSPKPYYHSPPPPKKP 163
             P     PP P   PPPP      PPP   P    SPPP P    SP P   +PPPP  P
Sbjct: 1618 PPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPP 1677

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPP----PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                 P PP+ +PPPP    SPPPP    P       SPPPP+  PPPP     PPPP
Sbjct: 1678 L----PSPPLPAPPPP----SPPPPNAPSPSSMPPSQSPPPPL--PPPPL----PPPP 1721

 Score =  134 bits (337), Expect = 6e-30
 Identities = 84/176 (47%), Positives = 85/176 (48%), Gaps = 2/176 (1%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PP P   PP SPPP   PP   PPP   PP SPPP   PP  PP    +PPPP   PP
Sbjct: 1127 SPPPSPPPSPPPSPPPPTPPPPAPPPPA--PPPSPPPSPPPPTPPP---PAPPPPNPPPP 1181

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP-PPPEHHVSPKPYYHSPPPPKK 166
              P     P PP  SPPPP      PPPP  P     P PPP     P P   SPPP   
Sbjct: 1182 SPP----PPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPP 1237

Query: 165  PYYYHSPPP-PVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            P    SPPP P  SPPPP      PPPP  P     PP P  SPPPP   T PPPP
Sbjct: 1238 PSPPPSPPPSPPPSPPPP-----TPPPPAPP-----PPTPPPSPPPP---TPPPPP 1280

 Score =  134 bits (337), Expect = 6e-30
 Identities = 79/163 (48%), Positives = 83/163 (50%), Gaps = 1/163 (0%)
 Frame = -3

Query: 513  PPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKP 334
            PPP   PP +PPP   PP  SPPP   PP  PPP   PP  PP    SPPPP+  PP  P
Sbjct: 1140 PPPPTPPPPAPPPPAPPP--SPPPSPPPPTPPPPAPPPPNPPP---PSPPPPLPPPPSPP 1194

Query: 333  YHYSSPP-PPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYY 157
                 PP PP   PPPP     PPPP   P     PPPP    SP P   SPPP   P  
Sbjct: 1195 PPLPPPPLPPPPVPPPPSPPPLPPPPLPPP---PLPPPPSPPPSPPP---SPPPSPPPSP 1248

Query: 156  YHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPP 28
              SPPPP  +PPPP    +PPPP   P    SPPPP   PPPP
Sbjct: 1249 PPSPPPP--TPPPP----APPPPTPPP----SPPPPTPPPPPP 1281

 Score =  133 bits (334), Expect = 1e-29
 Identities = 85/185 (45%), Positives = 89/185 (48%), Gaps = 12/185 (6%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYP-----PVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPV 355
            SPPPP   PP  PPP   P     P  SPPP   PP SPPP   PP  PP     P PP 
Sbjct: 740  SPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPS--PPPSPPPSPPPPTPPPPAPPPPTPPP 797

Query: 354  YSPPKKPYHYSSPP------PPVYSPPPPYHYSSPP-PPPKKPYKYSSPPPPEHHVSPKP 196
              PP  P     PP      PP  SPPPP     PP PPP  P     PPP     SP P
Sbjct: 798  SPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPP 857

Query: 195  YYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYT 16
               SPPP   P    SPPPP  +PPPP    +PPPP   P    SPPPP  +PPPP    
Sbjct: 858  ---SPPPSPPPSPPPSPPPP--TPPPP----APPPPAPPPSPPPSPPPP--TPPPP---- 902

Query: 15   SPPPP 1
            +PPPP
Sbjct: 903  APPPP 907

 Score =  132 bits (332), Expect = 2e-29
 Identities = 91/181 (50%), Positives = 94/181 (51%), Gaps = 5/181 (2%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
           L  SPPPP V P  SPPP    P  SPPP    P  PPP + P  SPP    SPPPP  S
Sbjct: 258 LSPSPPPPSVSP--SPPPPSLSP--SPPPPSLSPSPPPPSLSP--SPP---PSPPPPSTS 308

Query: 348 ---PPKKPYHYS-SPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSP 181
              PP+ P   S SPPPP  SP PP    SP PPP  P    SPPPP    SP P   SP
Sbjct: 309 PSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPP--PSLSPSPPPPSFSPSPPPPSLSP 366

Query: 180 -PPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
            PPP  P    SPPPP  SPPPP     PPP P  P     PPPP+  PPPP     PPP
Sbjct: 367 SPPPATP--PPSPPPP--SPPPPL---PPPPSPPPPL----PPPPI--PPPPSPPPPPPP 413

Query: 3   P 1
           P
Sbjct: 414 P 414

 Score =  131 bits (330), Expect = 4e-29
 Identities = 86/190 (45%), Positives = 87/190 (45%), Gaps = 18/190 (9%)
 Frame = -3

Query: 519  SPPPPKVYPPVSP---PPKVYPPVYSPPPKVYPPVSPPPKVY--PPVSPPYHYSSPPPPV 355
            SPPPP   PPV P   PP   PP   P P   PP SPPP +   PP SPP     PPPPV
Sbjct: 1565 SPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPL--PPPPV 1622

Query: 354  YSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP-PPPEHHVSPKPYYHSPP 178
              PP  P     P PP  SPPP    S PP PP  P    SP PPP     P P   SPP
Sbjct: 1623 PPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPP 1682

Query: 177  PPKKPYYYHSPP--------PPVYSPPPPYHYSSPPPPPKKPYYYHSPP----PPVYSPP 34
             P  P     PP        PP  SPPPP      PPPP  P     PP    PP  SPP
Sbjct: 1683 LPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPP 1742

Query: 33   PPYHYTSPPP 4
            PP    SPPP
Sbjct: 1743 PPSPPPSPPP 1752

 Score =  128 bits (321), Expect = 4e-28
 Identities = 72/153 (47%), Positives = 76/153 (49%), Gaps = 4/153 (2%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYP-PVYSPPPKVYPPVSPPPKVYPPVSPPYHYS---SPPPPVY 352
            SPPPP   PP  PPP   P P  SPPP   PP +PPP   PP SPP       SPPPP+ 
Sbjct: 1139 SPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLP 1198

Query: 351  SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP 172
             PP  P     PP P   PPPP      PPPP  P      PPP    SP P   SPPPP
Sbjct: 1199 PPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPP---SPPPP 1255

Query: 171  KKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPY 73
              P     PP P  SPPPP   + PPPPP  P+
Sbjct: 1256 TPPPPAPPPPTPPPSPPPP---TPPPPPPLAPF 1285

 Score =  124 bits (311), Expect = 6e-27
 Identities = 77/162 (47%), Positives = 82/162 (50%)
 Frame = -3

Query: 486  SPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPP 307
            SP P   PP   PPP   PP SPPP   PP  PP    SPPPP+  PP  P     P PP
Sbjct: 677  SPSP---PPPSPPPPSPSPPPSPPPPSPPPSPPP---PSPPPPLPPPPLPPPPLPPPSPP 730

Query: 306  VYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYS 127
              SPPP    S PPP P  P      PPP    SP P   SPPP   P    SPPPP  +
Sbjct: 731  P-SPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPP---SPPPSPPPSPPPSPPPP--T 784

Query: 126  PPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            PPPP    +PPPP   P    SPPPP  +PPPP    +PPPP
Sbjct: 785  PPPP----APPPPTPPPSPPPSPPPP--TPPPP----APPPP 816

 Score =  123 bits (309), Expect = 1e-26
 Identities = 82/173 (47%), Positives = 87/173 (50%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            SPPPP   PP SP P   PP  SPPP   PP SPPP + PP  PP     P PP   PP 
Sbjct: 679  SPPPPSP-PPPSPSPPPSPPPPSPPPSP-PPPSPPPPLPPPPLPPPPLPPPSPPPSPPPS 736

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
             P    SPPPP  +PPPP    +PPPP   P    SPPP     SP P   SPPP     
Sbjct: 737  PP---PSPPPP--TPPPP----APPPPAPPPAPPPSPPP-----SPPP---SPPP----- 774

Query: 159  YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               SPPP   SPPPP    +PPPP        +PPPP   P PP    SPPPP
Sbjct: 775  ---SPPP---SPPPP----TPPPP--------APPPPTPPPSPP---PSPPPP 806

 Score =  122 bits (305), Expect = 3e-26
 Identities = 76/164 (46%), Positives = 78/164 (47%)
 Frame = -3

Query: 492  PVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPP 313
            P  PPP   PP  SPPP   PP SPPP   PP  PP     PPPPV   P  P   S PP
Sbjct: 1534 PSPPPPSPPPPSPSPPPSP-PPPSPPPSPPPPSPPP---PLPPPPVPPSPLPP--PSPPP 1587

Query: 312  PPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV 133
             P  SPPP     SPPP P  P     PP P   + P P    PPPP  P     P PP 
Sbjct: 1588 SPPPSPPP-----SPPPSPPPPLPLPPPPSPPPPLPPPPV---PPPPSPPPLPPPPLPPP 1639

Query: 132  YSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             SPPP    S PP PP  P    SP PP  +PPPP    SPP P
Sbjct: 1640 PSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPP----SPPLP 1679

 Score =  119 bits (297), Expect = 3e-25
 Identities = 79/175 (45%), Positives = 81/175 (46%)
 Frame = -3

Query: 528  LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
            L S PPPP   PP  P     PP  SPP    PP  PPP V PP +PP      PPP   
Sbjct: 2084 LMSVPPPPSP-PPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTP 2142

Query: 348  PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
            PP  P     P PP  SPP P   S PPP P  P     PP P    SP P    PPPP 
Sbjct: 2143 PPSPPPLPPPPTPPPQSPPLP---SPPPPSPPTP-----PPLPPPSPSPLPPPPIPPPPS 2194

Query: 168  KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
             P     P PP  SP PP    SPPPPP        PPPP+  PPPP    SPPP
Sbjct: 2195 PP-----PHPPPQSPLPP----SPPPPP--------PPPPL--PPPP----SPPP 2226

 Score =  118 bits (295), Expect = 4e-25
 Identities = 71/153 (46%), Positives = 75/153 (49%), Gaps = 1/153 (0%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
           L  SPPPP + P  SPPP   PP  SP P    P  PPP   P   PP    SPPPP  S
Sbjct: 285 LSPSPPPPSLSP--SPPPSPPPPSTSPSP----PPRPPPSASPSPPPPSLSPSPPPPSLS 338

Query: 348 P-PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP 172
           P P  P    SPPPP +SP PP    SP PPP  P     PP P   + P P   SPPPP
Sbjct: 339 PSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPSPPPPLPPPP---SPPPP 395

Query: 171 KKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPY 73
             P     P PP  SPPP      PPPPP  P+
Sbjct: 396 LPP----PPIPPPPSPPP------PPPPPLAPF 418

 Score =  115 bits (289), Expect = 2e-24
 Identities = 75/173 (43%), Positives = 80/173 (46%), Gaps = 6/173 (3%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            SPPPP + P  SPPP    P  SPPP    P  PPP   P   PP    SPPPP  SP  
Sbjct: 1758 SPPPPSLSP--SPPPPSTSP--SPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSP-- 1811

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
                  SPPPP  SP PP   +SP PPP  P    SPPPP    SP P   SP PP    
Sbjct: 1812 ------SPPPPPASPSPPPPSASPSPPP--PSSSPSPPPPSSSPSPPPPSLSPSPP---- 1859

Query: 159  YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYY------HSPPPPVYSPPPPYHY 19
                P PP  SPPPP    SPP PP  P  +       +  P   +PP  Y Y
Sbjct: 1860 ----PSPPPSSPPPP----SPPTPPAPPRPFLVSLDIIATQPSSSNPPERYPY 1904

 Score =  115 bits (287), Expect = 4e-24
 Identities = 79/173 (45%), Positives = 82/173 (47%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            SP PP   PP  PPP   PP  SPPP   PP  PPP   PP+ PP    SP PP   PP 
Sbjct: 1533 SPSPP---PPSPPPPSPSPPP-SPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPS 1588

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
             P   S PP P  SPPPP      PPPP       SPPPP   + P P    PPPP  P 
Sbjct: 1589 PPP--SPPPSPPPSPPPPLPL---PPPP-------SPPPP---LPPPPV---PPPPSPPP 1630

Query: 159  YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                PPPP+  PPPP    SPPP P        P PP   PP P    SP PP
Sbjct: 1631 L---PPPPL--PPPP----SPPPSPP-------PSPPPSPPPSPPPSPSPLPP 1667

 Score =  105 bits (261), Expect = 4e-21
 Identities = 74/152 (48%), Positives = 75/152 (49%)
 Frame = -3

Query: 459  VYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYH 280
            V SP P   PP SPPP   P  SPP    SPPPP  SPP       SPPPP  SPPPP  
Sbjct: 1531 VPSPSP---PPPSPPP---PSPSPP---PSPPPP--SPPP------SPPPP--SPPPPL- 1570

Query: 279  YSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSS 100
               PPP P  P    SPPP     SP P   SPPP   P    SPPPP+  PPPP     
Sbjct: 1571 --PPPPVPPSPLPPPSPPP-----SPPP---SPPPSPPP----SPPPPLPLPPPPSPPPP 1616

Query: 99   PPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
             PPPP  P     P PP   PPPP    SPPP
Sbjct: 1617 LPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPP 1648

 Score =  105 bits (261), Expect = 4e-21
 Identities = 66/145 (45%), Positives = 67/145 (46%), Gaps = 1/145 (0%)
 Frame = -3

Query: 432  PPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPK 253
            P  SPPP   PP SP    S PPP   SPP  P    SPPPP+  PP P    SP PPP 
Sbjct: 1532 PSPSPPPPSPPPPSPSPPPSPPPP---SPPPSP-PPPSPPPPLPPPPVP---PSPLPPPS 1584

Query: 252  KPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPP-PPVYSPPPPYHYSSPPPPPKKP 76
             P      PPP    SP P    PPPP  P     PP PP  SPPP      PPPP   P
Sbjct: 1585 PPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPP 1644

Query: 75   YYYHSPPPPVYSPPPPYHYTSPPPP 1
                SPPP     PPP     PPPP
Sbjct: 1645 SPPPSPPPSPPPSPPPSPSPLPPPP 1669

 Score =  103 bits (258), Expect = 9e-21
 Identities = 73/162 (45%), Positives = 77/162 (47%), Gaps = 10/162 (6%)
 Frame = -3

Query: 528  LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
            L  SPPPP   P  SPPP    P  SPPP    P  PPP + P   PP    SPPPP  S
Sbjct: 1764 LSPSPPPPSTSP--SPPPPSASP--SPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPAS 1819

Query: 348  P-PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP 172
            P P  P    SPPPP  SP PP   SSP PPP  P    SPPP     SP P   SPPPP
Sbjct: 1820 PSPPPPSASPSPPPPSSSPSPPPPSSSPSPPP--PSLSPSPPP-----SPPP--SSPPPP 1870

Query: 171  KKPYYYHSPPPPVYSPPPPY---------HYSSPPPPPKKPY 73
                   SPP P  +PP P+           SS  PP + PY
Sbjct: 1871 -------SPPTPP-APPRPFLVSLDIIATQPSSSNPPERYPY 1904

 Score =  102 bits (253), Expect = 3e-20
 Identities = 66/145 (45%), Positives = 71/145 (48%), Gaps = 2/145 (1%)
 Frame = -3

Query: 513  PPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKP 334
            PPP V PP +PPP   PP   PPP   PP SPPP   PP  PP     P PP  SPP  P
Sbjct: 2119 PPPPVPPPPTPPPS--PPPLPPPPT--PPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPP 2174

Query: 333  YHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYY 154
                 PP P   PPPP     PPPP   P+     PPP+  + P P    PPPP      
Sbjct: 2175 --PLPPPSPSPLPPPPI----PPPPSPPPH-----PPPQSPLPPSP----PPPP------ 2213

Query: 153  HSPPPPVYSPPPPYHYSSPPP--PP 85
              PPPP+  PPPP    SPPP  PP
Sbjct: 2214 --PPPPL--PPPP----SPPPSQPP 2230

 Score = 97.1 bits (240), Expect = 1e-18
 Identities = 68/153 (44%), Positives = 73/153 (47%), Gaps = 2/153 (1%)
 Frame = -3

Query: 453  SPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYS 274
            +P P   PP  PPP   PP SPP     PP P  SPP       SPPPP+  PPPP    
Sbjct: 675  APSPSPPPPSPPPPSPSPPPSPP-----PPSPPPSPPPP-----SPPPPL--PPPPL--- 719

Query: 273  SPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPP 94
             PPPP   P    SPPP     SP P   SPPPP       +PPPP  +PPPP    +PP
Sbjct: 720  -PPPPLPPPSPPPSPPP-----SPPP---SPPPP-------TPPPP--APPPP----APP 757

Query: 93   PPPKKPYYYHSPPPPVYSP--PPPYHYTSPPPP 1
            P P        P PP   P  PPP    SPPPP
Sbjct: 758  PAPP-------PSPPPSPPPSPPPSPPPSPPPP 783

 Score = 84.7 bits (208), Expect = 5e-15
 Identities = 53/121 (43%), Positives = 58/121 (47%), Gaps = 3/121 (2%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPK---VYPPVSPPYHYSSPPPPVYSP 346
            PPPP   PP SPPP   PP  +PPP+  P  SPPP      PP+ PP     PPPP+  P
Sbjct: 2137 PPPPT--PPPSPPP--LPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPP 2192

Query: 345  PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
            P  P H   PPP    PP P     PPPPP  P     PPPP           SPPP + 
Sbjct: 2193 PSPPPH---PPPQSPLPPSP-----PPPPPPPPL----PPPP-----------SPPPSQP 2229

Query: 165  P 163
            P
Sbjct: 2230 P 2230

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 56/164 (34%), Positives = 62/164 (37%), Gaps = 32/164 (19%)
 Frame = -3

Query: 513  PPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSP----PPKVYPPVSPPYHY--SSPPPPVY 352
            PPP   PP SPP    PP   P P   PP SP    PP + PP SPP H    SP PP  
Sbjct: 2150 PPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPPPHPPPQSPLPPSP 2209

Query: 351  SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPP--------------------KKPYKYSS 232
             PP  P     PP P  S PP    +S    P                     K   Y S
Sbjct: 2210 PPPPPPPPLPPPPSPPPSQPPSLENASQSLVPIFVSVGCIVIIIVLIGFGYWLKCKYYQS 2269

Query: 231  P--PPPEHHVSPKPYYHSPP----PPKKPYYYHSPPPPVYSPPP 118
            P    PE  +  +P     P     P +   +H  PPPVY P P
Sbjct: 2270 PLQIQPEAELEDEPIQEDEPIQEDEPIQAEIHH--PPPVYVPVP 2311

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 46/117 (39%), Positives = 52/117 (44%), Gaps = 11/117 (9%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP--PVYSP 346
            SPPPP   P  SPPP    P  SPPP    P  PPP   P   PP    SPPP  P  SP
Sbjct: 1812 SPPPPPASP--SPPPPSASP--SPPPPSSSPSPPPPSSSPSPPPPSLSPSPPPSPPPSSP 1867

Query: 345  PKKPYHYSSPPPPVYSPPPPY---------HYSSPPPPPKKPYKYSSPPPPEHHVSP 202
            P      S P PP  +PP P+           SS  PP + PY   S   P++ + P
Sbjct: 1868 PPP----SPPTPP--APPRPFLVSLDIIATQPSSSNPPERYPY-IGSGATPDNKIVP 1917

[108][TOP]
>UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO
          Length = 1765

 Score =  154 bits (390), Expect = 4e-36
 Identities = 90/177 (50%), Positives = 93/177 (52%), Gaps = 4/177 (2%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVY--PPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
            SPPPP   PP SPPP   PP  SPPP V+  PP  PPP   PP +P     SPPPP  SP
Sbjct: 1101 SPPPP---PPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPDAPPPSPPPPPPSP 1157

Query: 345  PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
            P  P   S PPPP   PPPP     P PPP +P    SPPPP H   P     SPPPP  
Sbjct: 1158 PPSPPP-SPPPPPSPMPPPP-----PSPPPPRPPPPPSPPPPVHEPPP-----SPPPPPN 1206

Query: 165  PYYYHSPPPPVYSPPPPYHYSSP--PPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            P    SPPPP   PPPP     P  PPPP  P     PPPP  SPPPP     PPPP
Sbjct: 1207 P----SPPPPSPMPPPPSPMPPPPSPPPPSPPPPSPMPPPP--SPPPPIPSPPPPPP 1257

 Score =  151 bits (381), Expect = 5e-35
 Identities = 92/177 (51%), Positives = 97/177 (54%), Gaps = 5/177 (2%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            PPPP    P SPP    PP  SPPP   PP SPPP   PP  PP    SPPPPV+ PP  
Sbjct: 1080 PPPPSPPSPPSPPSPPPPPPPSPPPP--PPPSPPPPRPPP--PP----SPPPPVHEPPPS 1131

Query: 336  PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYS-SPPPPEHHVSPKPYYHSPPPPKKPY 160
            P    SPPPP    PPP   S PPPPP  P     SPPPP   + P P   SPPPP+ P 
Sbjct: 1132 PPPPPSPPPPTPDAPPP---SPPPPPPSPPPSPPPSPPPPPSPMPPPP--PSPPPPRPPP 1186

Query: 159  YYHSPPPPVY----SPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               SPPPPV+    SPPPP + S PPP P  P     PPPP  SPPPP    SPPPP
Sbjct: 1187 P-PSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPSPMPPPP--SPPPP----SPPPP 1236

 Score =  142 bits (359), Expect = 2e-32
 Identities = 87/174 (50%), Positives = 88/174 (50%), Gaps = 1/174 (0%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            SPPPP   PP SPPP   PP   P P   PP  PPP   PP SPP   S PPPP   PP 
Sbjct: 1120 SPPPPVHEPPPSPPPPPSPP--PPTPDAPPPSPPPPPPSPPPSPP--PSPPPPPSPMPPP 1175

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSP-PPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
             P      PPP  SPPPP H   P PPPP  P    SPPPP     P P    PPPP   
Sbjct: 1176 PPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNP----SPPPPS--PMPPPPSPMPPPP--- 1226

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                SPPPP  SPPPP   S  PPPP       SPPPP+ SPPPP      PPP
Sbjct: 1227 ----SPPPP--SPPPP---SPMPPPP-------SPPPPIPSPPPPPPTPRSPPP 1264

 Score =  129 bits (324), Expect = 2e-28
 Identities = 83/177 (46%), Positives = 86/177 (48%), Gaps = 5/177 (2%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
            P PP       P  K  PP  SPP    PP  PPP   PP SPP     PPPP   PP +
Sbjct: 1065 PAPPAAAMDNRPCEKPPPP--SPPSPPSPPSPPPP---PPPSPP-----PPPPPSPPPPR 1114

Query: 336  PYHYSSPPPPVYSPPPPYHY--SSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
            P     PPPP  SPPPP H    SPPPPP  P      PPP    SP P   SPPP   P
Sbjct: 1115 P-----PPPP--SPPPPVHEPPPSPPPPPSPPPPTPDAPPP----SPPPPPPSPPPSPPP 1163

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSP---PPPYHYTSPPPP 1
                 PPPP   PPPP     P PPP +P    SPPPPV+ P   PPP    SPPPP
Sbjct: 1164 ---SPPPPPSPMPPPP-----PSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPP 1212

 Score =  108 bits (269), Expect = 5e-22
 Identities = 73/164 (44%), Positives = 76/164 (46%), Gaps = 1/164 (0%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY-PPVSPPYHYSSPPPPVYSP 346
            S PPPP   PP  P P        PPP+  PP SPPP V+ PP SPP     PPP    P
Sbjct: 1164 SPPPPPSPMPPPPPSP--------PPPRPPPPPSPPPPVHEPPPSPP-----PPPNPSPP 1210

Query: 345  PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
            P  P     PPPP   PPPP    SPPPP        SPPPP    SP P    PPP   
Sbjct: 1211 PPSP----MPPPPSPMPPPP----SPPPP--------SPPPP----SPMP----PPP--- 1243

Query: 165  PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPP 34
                 SPPPP+ SPPPP      PPP   P      P P  SPP
Sbjct: 1244 -----SPPPPIPSPPPPPPTPRSPPPAPPPLPGDVDPTPA-SPP 1281

[109][TOP]
>UniRef100_B9RL73 LRX2, putative n=1 Tax=Ricinus communis RepID=B9RL73_RICCO
          Length = 766

 Score =  154 bits (389), Expect = 6e-36
 Identities = 101/227 (44%), Positives = 115/227 (50%), Gaps = 42/227 (18%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKV------YPPVSPPP----KVYPPVYSPPPKVYPPV---SPP 415
            P+  S+ S     PPPP        +PP SPPP    +V P  + PPP   PPV   SPP
Sbjct: 428  PTSKSSPSTRSHPPPPPPQTPAKSYHPPPSPPPPPTKRVSPKTHLPPPPPPPPVVEQSPP 487

Query: 414  PKVY-----PP-----VSPPYHYSSPPPPVYSPPKKPYHYSSPPPPV-YSPPPPYHYSSP 268
            P  +     PP     VSP  H++ PPPP       P H  SPPPPV Y+P PP H SSP
Sbjct: 488  PPAHYHSYAPPPPTKKVSPSTHHAPPPPPPVDYTPTPKH--SPPPPVEYTPSPPKH-SSP 544

Query: 267  PP----PPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPP------PPVYSPPP 118
            PP    PP   ++ S PPPP       PY+H PPPP  P  Y SPP      PP   PPP
Sbjct: 545  PPVEYYPPPYQHQTSPPPPPPVQYQSPPYHHKPPPPPPPIEYQSPPYQHKTSPP---PPP 601

Query: 117  PYH-YSSPPPPPKKPYYYHSP------PPPVYSPPPPYH-YTSPPPP 1
             Y  YSSPPPPPK  Y +  P      PP   SPPPP + YT  PPP
Sbjct: 602  GYDTYSSPPPPPKNEYAHSPPPTHGHYPPKRESPPPPKNEYTHSPPP 648

 Score =  149 bits (376), Expect = 2e-34
 Identities = 100/241 (41%), Positives = 121/241 (50%), Gaps = 59/241 (24%)
 Frame = -3

Query: 546  ISANSYLYSSPPPPKVYPPV---SPPPKVY----PPVYSPPPKV--YPP-----VSPPPK 409
            +S +++    PPPP  Y P    SPPP V     PP +S PP V  YPP      SPPP 
Sbjct: 504  VSPSTHHAPPPPPPVDYTPTPKHSPPPPVEYTPSPPKHSSPPPVEYYPPPYQHQTSPPPP 563

Query: 408  VYPPV---SPPYHYSSPPPPV------------YSPPKKPYH--YSSPPPP-----VYSP 295
              PPV   SPPYH+  PPPP              SPP  P +  YSSPPPP      +SP
Sbjct: 564  --PPVQYQSPPYHHKPPPPPPPIEYQSPPYQHKTSPPPPPGYDTYSSPPPPPKNEYAHSP 621

Query: 294  PPPYHYSSP----PPPPKKPYKYSSPPPPEHHVSPK---PYYHSPPPPKKPYYYHSPPPP 136
            PP + +  P    PPPPK  Y +S PPP   H  PK   P    PPPP++P++    PPP
Sbjct: 622  PPTHGHYPPKRESPPPPKNEYTHS-PPPTHGHYPPKRESPPPPPPPPPQEPFHPLPSPPP 680

Query: 135  ---VYSPPPP------YHYSSPPPPPKKPYYYHSPPPPVYS------PPPPYH-YTSPPP 4
               + +PP P      YH+S  PPPP    ++H P PP YS      PPPP   + SPPP
Sbjct: 681  TGCITTPPSPPSSTPSYHHSPSPPPPPPEQHWHYPTPPSYSHHQSPPPPPPLSPFPSPPP 740

Query: 3    P 1
            P
Sbjct: 741  P 741

 Score =  140 bits (354), Expect = 6e-32
 Identities = 93/227 (40%), Positives = 112/227 (49%), Gaps = 47/227 (20%)
 Frame = -3

Query: 540  ANSYLYSSPPPPKV------YPPVSPPPKVYPPV--YSPPPKV-YPPV-----SPPPKVY 403
            A+ + Y+ PPP K       + P  PPP  Y P   +SPPP V Y P      SPPP  Y
Sbjct: 490  AHYHSYAPPPPTKKVSPSTHHAPPPPPPVDYTPTPKHSPPPPVEYTPSPPKHSSPPPVEY 549

Query: 402  PPVSPPYHY--SSPPPPVYSPPKKPYHYSSPPPPVYSPP-----PPYHYSSPPPPPKKPY 244
             P  PPY +  S PPPP       PYH+  PPPP   PP     PPY + + PPPP    
Sbjct: 550  YP--PPYQHQTSPPPPPPVQYQSPPYHHKPPPPP---PPIEYQSPPYQHKTSPPPPPGYD 604

Query: 243  KYSSPPPP---EHHVSPKPYY-------HSPPPPKKPYYYHSP------PPPVYSPPPPY 112
             YSSPPPP   E+  SP P +        SPPPPK  Y +  P      PP   SPPPP 
Sbjct: 605  TYSSPPPPPKNEYAHSPPPTHGHYPPKRESPPPPKNEYTHSPPPTHGHYPPKRESPPPP- 663

Query: 111  HYSSPPPPPKKPYYYHSPPPP---VYSPPPP-------YHYTSPPPP 1
                PPPPP++P++    PPP   + +PP P       +H  SPPPP
Sbjct: 664  ----PPPPPQEPFHPLPSPPPTGCITTPPSPPSSTPSYHHSPSPPPP 706

 Score =  136 bits (343), Expect = 1e-30
 Identities = 94/231 (40%), Positives = 113/231 (48%), Gaps = 56/231 (24%)
 Frame = -3

Query: 525  YSSPPPPKVYPP-----VSPPPKVYPPV-YSPPPKVYPPVSPPP-----------KVYPP 397
            +SSPPP + YPP      SPPP   PPV Y  PP  + P  PPP           K  PP
Sbjct: 541  HSSPPPVEYYPPPYQHQTSPPPP--PPVQYQSPPYHHKPPPPPPPIEYQSPPYQHKTSPP 598

Query: 396  VSPPYH-YSSPPPP-----VYSPPKKPYHY----SSPPPP----VYSPPPPY-HYSS--- 271
              P Y  YSSPPPP      +SPP    HY     SPPPP     +SPPP + HY     
Sbjct: 599  PPPGYDTYSSPPPPPKNEYAHSPPPTHGHYPPKRESPPPPKNEYTHSPPPTHGHYPPKRE 658

Query: 270  -----PPPPPKKPYKYSSPPPPEHHVSPKP--------YYHSP----PPPKKPYYYHSPP 142
                 PPPPP++P+     PPP   ++  P        Y+HSP    PPP++  ++H P 
Sbjct: 659  SPPPPPPPPPQEPFHPLPSPPPTGCITTPPSPPSSTPSYHHSPSPPPPPPEQ--HWHYPT 716

Query: 141  PPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPP----YHYTSPPPP 1
            PP YS    +H S PPPPP  P  + SPPPP  + P P      Y SPPPP
Sbjct: 717  PPSYS----HHQSPPPPPPLSP--FPSPPPPADNTPLPPIVGVSYASPPPP 761

 Score =  135 bits (341), Expect = 2e-30
 Identities = 87/190 (45%), Positives = 96/190 (50%), Gaps = 16/190 (8%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSP--PYHYSSPPPPVYS 349
           SSP P +   PV  PP    P  +PP + +   SPPP   PP S   P   S PPPP   
Sbjct: 393 SSPSPRRKPRPVGNPPS---PKLAPPRRPFVKPSPPP---PPTSKSSPSTRSHPPPPPPQ 446

Query: 348 PPKKPYHY--SSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPP 175
            P K YH   S PPPP     P  H   PPPPP  P    SPPPP H+ S    Y  PPP
Sbjct: 447 TPAKSYHPPPSPPPPPTKRVSPKTHLPPPPPPP--PVVEQSPPPPAHYHS----YAPPPP 500

Query: 174 PKK--PYYYHSPPPPV---------YSPPPPYHYSSPPPPPKKPYYYHSPPPPV-YSPPP 31
            KK  P  +H+PPPP          +SPPPP  Y+  P PPK     HS PPPV Y PPP
Sbjct: 501 TKKVSPSTHHAPPPPPPVDYTPTPKHSPPPPVEYT--PSPPK-----HSSPPPVEYYPPP 553

Query: 30  PYHYTSPPPP 1
             H TSPPPP
Sbjct: 554 YQHQTSPPPP 563

 Score =  115 bits (287), Expect = 4e-24
 Identities = 77/180 (42%), Positives = 92/180 (51%), Gaps = 29/180 (16%)
 Frame = -3

Query: 522  SSPPPPKVYPPVS--PPPKVYPPVYSPPPKV--YPPVS---PPPKVYPPVSPPY---HY- 376
            +SPPPP  Y   S  PPP      +SPPP    YPP     PPPK     SPP    HY 
Sbjct: 595  TSPPPPPGYDTYSSPPPPPKNEYAHSPPPTHGHYPPKRESPPPPKNEYTHSPPPTHGHYP 654

Query: 375  ---SSPPPPVYSPPKKPYHYSSPPPP---VYSPPPP------YHYSS--PPPPPKKPYKY 238
                SPPPP   PP++P+H    PPP   + +PP P      YH+S   PPPPP++ + Y
Sbjct: 655  PKRESPPPPPPPPPQEPFHPLPSPPPTGCITTPPSPPSSTPSYHHSPSPPPPPPEQHWHY 714

Query: 237  SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPP----YHYSSPPPPPKKPYY 70
             +PP   HH SP      PPPP  P  + SPPPP  + P P      Y+S PPPP  PYY
Sbjct: 715  PTPPSYSHHQSP-----PPPPPLSP--FPSPPPPADNTPLPPIVGVSYAS-PPPPTIPYY 766

[110][TOP]
>UniRef100_Q94ES7 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES7_PEA
          Length = 145

 Score =  154 bits (388), Expect = 7e-36
 Identities = 87/157 (55%), Positives = 94/157 (59%), Gaps = 5/157 (3%)
 Frame = -3

Query: 615 RSLMASTTFTLLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKV 436
           RSLMAS + TL +A++  + PS ISAN Y YSSPPPP      SPPP   P  YS PP  
Sbjct: 2   RSLMASASLTLALAILFFSFPSEISANQYSYSSPPPPVH----SPPPPKDPYHYSSPPP- 56

Query: 435 YPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPP---VYSPPPPYHYSSPP 265
                PP   YP   P YH  SPPPP  +P KKPY Y SPPPP    Y  P P  Y SPP
Sbjct: 57  -----PPAHTYPHPHPVYH--SPPPP--TPHKKPYKYPSPPPPPAHTYPHPHPV-YHSPP 106

Query: 264 PPPKKPYKYSSPPPPEHHVSPKPY--YHSPPPPKKPY 160
           PP KKPYKYSSPPPP  H  P P+  YHSPPPP   Y
Sbjct: 107 PPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPAHTY 143

 Score =  134 bits (337), Expect = 6e-30
 Identities = 72/121 (59%), Positives = 77/121 (63%), Gaps = 10/121 (8%)
 Frame = -3

Query: 333 YHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPY--YHSPPPP---K 169
           Y YSSPPPPV+SPPPP          K PY YSSPPPP  H  P P+  YHSPPPP   K
Sbjct: 30  YSYSSPPPPVHSPPPP----------KDPYHYSSPPPPPAHTYPHPHPVYHSPPPPTPHK 79

Query: 168 KPYYYHSPPPP---VYSPPPPYHYSSPPPPPKKPYYYHS-PPPPVYSPPPPYH-YTSPPP 4
           KPY Y SPPPP    Y  P P  Y SPPPP KKPY Y S PPPPV++ P P+  Y SPPP
Sbjct: 80  KPYKYPSPPPPPAHTYPHPHPV-YHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPP 138

Query: 3   P 1
           P
Sbjct: 139 P 139

 Score =  102 bits (255), Expect = 2e-20
 Identities = 55/112 (49%), Positives = 61/112 (54%), Gaps = 19/112 (16%)
 Frame = -3

Query: 279 YSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPP---VYSPPPPYH 109
           +S P       Y YSSPPPP          HSPPPPK PY+Y SPPPP    Y  P P +
Sbjct: 19  FSFPSEISANQYSYSSPPPP---------VHSPPPPKDPYHYSSPPPPPAHTYPHPHPVY 69

Query: 108 YSSPPPPP-KKPYYYHSPPPP-----------VYSPPP----PYHYTSPPPP 1
           +S PPP P KKPY Y SPPPP            +SPPP    PY Y+SPPPP
Sbjct: 70  HSPPPPTPHKKPYKYPSPPPPPAHTYPHPHPVYHSPPPPHKKPYKYSSPPPP 121

[111][TOP]
>UniRef100_UPI0000DD9D0C Os11g0657400 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD9D0C
          Length = 1399

 Score =  151 bits (381), Expect = 5e-35
 Identities = 96/217 (44%), Positives = 102/217 (47%), Gaps = 27/217 (12%)
 Frame = -3

Query: 570  VSLTLPSLISANSY--LYSSPPPPKVYPPVSPPPKVYPPVYSPPP-----------KVYP 430
            V   LP + S+  +  + S PPP K  PP  P     PP  S PP           K YP
Sbjct: 1037 VESVLPPVKSSPPHAPVISEPPPTKSSPPQVPVTSEPPPAKSSPPHEPISPPETPEKSYP 1096

Query: 429  PVSP----PPKVYPPVSPPYHYSSPPP-------PVYSPPKKPYHYSSPPPPVYSPPPPY 283
            P +P    PP V    SPP   S PPP       P   P   P   SSPPPP  SPPPP 
Sbjct: 1097 PSTPEESSPPSVPKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPA 1156

Query: 282  HYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYS 103
                PPPP K      SPPPP   +SP P   SPPPP        PPPPV SPPPP    
Sbjct: 1157 PVILPPPPIK------SPPPPAPVISPPPPVKSPPPPAPVIL---PPPPVKSPPPPAPVI 1207

Query: 102  SPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            SPPPP   P  P     PPPPV SPPPP    SPPPP
Sbjct: 1208 SPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPP 1244

 Score =  145 bits (365), Expect = 3e-33
 Identities = 93/196 (47%), Positives = 98/196 (50%), Gaps = 23/196 (11%)
 Frame = -3

Query: 519  SPP--PPKVYPPVSP----PPKVYPPVYSPPP-KVYPP---VSPPPKVYPPVSPPYHYSS 370
            SPP  P K YPP +P    PP V P   SPP  K  PP   VS PP    P+ PP   SS
Sbjct: 1086 SPPETPEKSYPPSTPEESSPPSV-PKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSS 1144

Query: 369  PPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYK----------YSSPPPP 220
            PPPP  SPP  P     PPPP+ SPPPP    SPPPP K P              SPPPP
Sbjct: 1145 PPPPEKSPPP-PAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPP 1203

Query: 219  EHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKP---YYYHSPPPP 49
               +SP P   SPPPP        PPPPV SPPPP    SPPPP K P         PP 
Sbjct: 1204 APVISPPPPVKSPPPPAPVIL---PPPPVKSPPPPAPVISPPPPEKSPPPAAPVILSPPA 1260

Query: 48   VYSPPPPYHYTSPPPP 1
            V S PPP   + PPPP
Sbjct: 1261 VKSLPPPAPVSLPPPP 1276

 Score =  139 bits (350), Expect = 2e-31
 Identities = 84/176 (47%), Positives = 89/176 (50%), Gaps = 3/176 (1%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            SSPPPP+  PP   P  + PP    PP   P +SPPP V  P  PP     PPPPV SPP
Sbjct: 1143 SSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSP-PPPAPVILPPPPVKSPP 1201

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P    SPPPPV SPPPP     PPPP K      SPPPP   +SP P   SPPP    
Sbjct: 1202 -PPAPVISPPPPVKSPPPPAPVILPPPPVK------SPPPPAPVISPPPPEKSPPPAAPV 1254

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKK---PYYYHSPPPPVYSPPPPYHYTSPPP 4
                  PP V S PPP   S PPPP K    P     PPP V S PPP   + PPP
Sbjct: 1255 IL---SPPAVKSLPPPAPVSLPPPPVKSLPPPAPVSLPPPVVKSLPPPAPVSLPPP 1307

 Score =  129 bits (324), Expect = 2e-28
 Identities = 89/211 (42%), Positives = 98/211 (46%), Gaps = 37/211 (17%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPP-----------VYSPPP--KVYPPVSPPPKVYPPV--SP 388
            S+PPP K  PP +P     PP             SPPP  K  PP SP   V PPV  SP
Sbjct: 989  STPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPPPSPVESVLPPVKSSP 1048

Query: 387  PYH--YSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP----- 229
            P+    S PPP   SPP+ P   +S PPP  S  PP+   SPP  P+K Y  S+P     
Sbjct: 1049 PHAPVISEPPPTKSSPPQVP--VTSEPPPAKS-SPPHEPISPPETPEKSYPPSTPEESSP 1105

Query: 228  --------PPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP- 88
                    PP E  + P      PPP  K    P    SPPPP  SPPPP     PPPP 
Sbjct: 1106 PSVPKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPPI 1165

Query: 87   --PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              P  P    SPPPPV SPPPP     PPPP
Sbjct: 1166 KSPPPPAPVISPPPPVKSPPPPAPVILPPPP 1196

 Score =  126 bits (316), Expect = 2e-27
 Identities = 81/186 (43%), Positives = 89/186 (47%), Gaps = 12/186 (6%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            SSPPPP     +  PPK  PPV   PP      S PP   P    P    S PP   SPP
Sbjct: 692  SSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPP 751

Query: 342  KKPYHYSSPP-PPVYSPPPPYHYSSPP----PPPKKPYKYSSPPPPEHHVSPKPYYHSPP 178
              P  ++SPP P  Y+P PP   SSPP    PPP  P K  SPP   H  SP P   SPP
Sbjct: 752  IPPTSHTSPPTPEEYTPSPP--KSSPPEEKSPPPHSPEK--SPPSEAHPTSPPPSEKSPP 807

Query: 177  PPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKK-----PYYYHSPPPP--VYSPPPPYHY 19
             P +     SPP P  SP PP  +   PP P K     P  + S PPP    SPPP  H 
Sbjct: 808  TPAEE---SSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHV 864

Query: 18   TSPPPP 1
            +SPPPP
Sbjct: 865  SSPPPP 870

 Score =  126 bits (316), Expect = 2e-27
 Identities = 85/185 (45%), Positives = 90/185 (48%), Gaps = 12/185 (6%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVS----PPPKVYPPVSPPYHYSSPP--- 364
            SSPPPP        PPK  PP    PP   PP S    P P+ Y P SPP   SSPP   
Sbjct: 725  SSPPPPAPEGHTPSPPKSSPPEEKSPP--IPPTSHTSPPTPEEYTP-SPPK--SSPPEEK 779

Query: 363  -PPVYSPPKKP---YHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
             PP +SP K P    H +SPPP   SPP P   SSPP P K P    SPP       P P
Sbjct: 780  SPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSP----SPPSGHEGTPPSP 835

Query: 195  YYHSPPPPKKPYYYHSPPPPVY-SPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHY 19
               S PPP+   +  SPPP    SPPP  H SSPPPP K P     PPP   SPP     
Sbjct: 836  VKSSSPPPEA--HVSSPPPEKSSSPPPEAHVSSPPPPEKSP-----PPPETKSPPTLTPE 888

Query: 18   TSPPP 4
             SPPP
Sbjct: 889  ISPPP 893

 Score =  120 bits (302), Expect = 7e-26
 Identities = 86/222 (38%), Positives = 98/222 (44%), Gaps = 48/222 (21%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPV--YSPPPKVYPPVSPPPKVYPP-------VSPPYHYSS 370
            SS PPP+ +    PPP+  PP      PP + P +SPPP+   P        SPP   S 
Sbjct: 855  SSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESE 914

Query: 369  PPP---PVYSPPKKPYHY------SSPPPPVYSPPPPYHYSSPPP-----PPKKPYKYSS 232
            PPP   P  SPP    +       S+PPP   SPP     SS PP     PP  P   SS
Sbjct: 915  PPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSS 974

Query: 231  PPPPEHHVSPKPYYHSPPPPKKPYYYHS--------------PPPPVYSPPPPYHYSSPP 94
            PP  E +V P P   S PPP+KP   H+              PP PV S PPP   S PP
Sbjct: 975  PPSHEEYVPPSP-AKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPP 1033

Query: 93   P-------PPKKPYYYHSP----PPPVYSPPPPYHYTSPPPP 1
            P       PP K    H+P    PPP  S PP    TS PPP
Sbjct: 1034 PSPVESVLPPVKSSPPHAPVISEPPPTKSSPPQVPVTSEPPP 1075

 Score =  119 bits (299), Expect = 2e-25
 Identities = 79/179 (44%), Positives = 84/179 (46%), Gaps = 6/179 (3%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPP K  PP +P     PPV SPPP   P +SPPP V  P  PP     PPPPV SPP
Sbjct: 1176 SPPPPVKSPPPPAPVILPPPPVKSPPPPA-PVISPPPPVKSP-PPPAPVILPPPPVKSPP 1233

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKK---PYKYSSPPPPEHHVSPKPYYHSPPPP 172
              P    SPPPP  SPPP       PP  K    P   S PPPP   + P      PPP 
Sbjct: 1234 -PPAPVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPPVKSLPPPAPVSLPPPV 1292

Query: 171  KKPYYYHSP---PPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
             K     +P   PPP   P PP    S PPP  KP     PP P  S PPP   + PPP
Sbjct: 1293 VKSLPPPAPVSLPPPAVKPLPPPAPVSLPPPAVKPL---PPPVPQVSLPPPKQESLPPP 1348

 Score =  117 bits (293), Expect = 8e-25
 Identities = 80/202 (39%), Positives = 90/202 (44%), Gaps = 29/202 (14%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP---PPVY 352
            SSPPPP        PPK  PP    PP      S PP    P +P  H  SPP   PPV 
Sbjct: 659  SSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPP----PPAPEGHMPSPPKSTPPVE 714

Query: 351  SPPKKPYHYSSPPPPVYSPPPPYHYSSPP--------PPPKKPYKYSSPPPPEHHVSPKP 196
              P  P   +S PPP   P P  H  SPP         PP  P  ++SPP PE + +P P
Sbjct: 715  KSPPTPESEASSPPP---PAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEY-TPSP 770

Query: 195  YYHSPPPPKKP------------YYYHSPPPPVYSPPPPYHYSSPPPPPKKPY----YYH 64
               SPP  K P             +  SPPP   SPP P   SSPP P K P     +  
Sbjct: 771  PKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSPPSGHEG 830

Query: 63   SPPPPV--YSPPPPYHYTSPPP 4
            +PP PV   SPPP  H +SPPP
Sbjct: 831  TPPSPVKSSSPPPEAHVSSPPP 852

 Score =  113 bits (283), Expect = 1e-23
 Identities = 88/268 (32%), Positives = 99/268 (36%), Gaps = 96/268 (35%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPV------------------ 394
            +P PPK  PP    P  + P  SPP + +P   PP +  PP                   
Sbjct: 767  TPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSPPS 826

Query: 393  -------------SPP--YHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYS----- 274
                         SPP   H SSPPP   S P    H SSPPPP  SPPPP   S     
Sbjct: 827  GHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLT 886

Query: 273  ---SPPP---------------------PPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
               SPPP                     PP  P   SSPP  E +V P P   +PPP +K
Sbjct: 887  PEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEK 946

Query: 165  PYYYH-----SPPPPVYSPPP-PYHYSSPP--------------PPPKKPYYYHS----- 61
                H     SPP     PPP P   SSPP              PPP+KP   H+     
Sbjct: 947  SPPSHTPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLPPHTPTINS 1006

Query: 60   ---------PPPPVYSPPPPYHYTSPPP 4
                     PP PV S PPP   + PPP
Sbjct: 1007 SPPSEEEYMPPSPVKSSPPPAEKSQPPP 1034

 Score =  112 bits (279), Expect = 3e-23
 Identities = 85/211 (40%), Positives = 94/211 (44%), Gaps = 36/211 (17%)
 Frame = -3

Query: 525  YSSPPPPKVYPPVSPPPKVYPPVYSPPP----KVYPPVSP------PPKVYPPV-----S 391
            +S PP P+ + P   PPK  PP    PP    K  PP +P      PPK  PP      +
Sbjct: 563  HSPPPVPEGHTP--SPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPT 620

Query: 390  PPYHYSSPPPP-----VYSPPKK-PYHYSSPPPP---VYSPPPPYHYSSPPPPPKK-PYK 241
            P    SSPPPP       SPP+  P    SPP P     SPPPP      P PPK  P  
Sbjct: 621  PESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPKSTPPT 680

Query: 240  YSSPPPPEHHVS----PKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPY 73
              SPP PE   S    P P  H P PPK      S PP   SPP P   +S PPPP    
Sbjct: 681  EKSPPTPESESSSPPPPAPEGHMPSPPK------STPPVEKSPPTPESEASSPPPPAPE- 733

Query: 72   YYHSPPPPVYSPP-------PPYHYTSPPPP 1
              H+P PP  SPP       PP  +TSPP P
Sbjct: 734  -GHTPSPPKSSPPEEKSPPIPPTSHTSPPTP 763

 Score =  111 bits (278), Expect = 4e-23
 Identities = 83/210 (39%), Positives = 86/210 (40%), Gaps = 37/210 (17%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PP P+ Y P   PPK  PP    PP      S PP   P    P    S PP   SPP
Sbjct: 595  SPPPTPEEYTP--SPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPP 652

Query: 342  KKPYHYSSPPPPV----------------YSPPPPYHYSSPPPPP-----------KKPY 244
                  SSPPPP                  SPP P   SS PPPP             P 
Sbjct: 653  TPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPP 712

Query: 243  KYSSPPPPEHHVS----PKPYYHSPPPPK-KPYYYHSPP-PPV--YSPPPPYHYSSPPPP 88
               SPP PE   S    P P  H+P PPK  P    SPP PP    SPP P  Y +P PP
Sbjct: 713  VEKSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEY-TPSPP 771

Query: 87   PKKPYYYHSPPP--PVYSPPPPYHYTSPPP 4
               P    SPPP  P  SPP   H TSPPP
Sbjct: 772  KSSPPEEKSPPPHSPEKSPPSEAHPTSPPP 801

 Score =  111 bits (277), Expect = 5e-23
 Identities = 83/214 (38%), Positives = 91/214 (42%), Gaps = 42/214 (19%)
 Frame = -3

Query: 516  PPPPKVYPPVSPP--PKVYPPVYSP--PPKVYPPVSPPPKVYPPVSPPYHYSSPPPPV-- 355
            PPPP+   P  PP  P   P   SP  P K+ PP  P P +    SPP  Y +PPPP   
Sbjct: 460  PPPPEEESPEEPPEEPTPSPTPSSPESPAKMAPP--PAPAIKGVTSPPAEYGAPPPPSSG 517

Query: 354  ---------------------YSPPKKPYHYSSPPPPVYSPPPPYHYSSPPP-------- 262
                                 YSPP  P   SSPPP   SPP P    SPPP        
Sbjct: 518  WLPKSPERKKAPPPQAEPPTEYSPPATPE--SSPPPEGKSPPTPTASHSPPPVPEGHTPS 575

Query: 261  PPKK-PYKYSSPPPPEHHVS--PKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPP 91
            PPK  P    SPP PE   S  P P  ++P PPK      S PP   SPP P   +S PP
Sbjct: 576  PPKSGPPAGESPPTPESKASPPPTPEEYTPSPPK------STPPAEKSPPTPESKASSPP 629

Query: 90   PPKKPYYYHSP----PPPVYSPPPPYHYTSPPPP 1
            PP    +  SP    PP   SPP P    S PPP
Sbjct: 630  PPAPEGHTPSPPESTPPSEKSPPTPESKASSPPP 663

 Score =  111 bits (277), Expect = 5e-23
 Identities = 85/228 (37%), Positives = 93/228 (40%), Gaps = 53/228 (23%)
 Frame = -3

Query: 525  YSSPPPP------------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPV 394
            Y +PPPP            K  PP + PP  Y     P  SPPP+   P +P     PP 
Sbjct: 508  YGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPP 567

Query: 393  SPPYHYSSPP---PPV----------YSPPKKPYHYS-----SPPPPVYSPPPPYHYSSP 268
             P  H  SPP   PP            SPP  P  Y+     S PP   SPP P   +S 
Sbjct: 568  VPEGHTPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASS 627

Query: 267  PPPP-----------KKPYKYSSPPPPEHHVS----PKPYYHSPPPPKKPYYYHSPPPPV 133
            PPPP             P    SPP PE   S    P P  H+P PPK      S PP  
Sbjct: 628  PPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPK------STPPTE 681

Query: 132  YSPPPPYHYSSPPPPPKKPYYYHSPP---PPV-YSPPPPYHYTSPPPP 1
             SPP P   SS PPPP    +  SPP   PPV  SPP P    S PPP
Sbjct: 682  KSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPP 729

 Score =  109 bits (273), Expect = 2e-22
 Identities = 81/200 (40%), Positives = 88/200 (44%), Gaps = 26/200 (13%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPP--KVYPP-----VSPPYHYSSPP 364
            S PPP K  PP +P     PPV SPPP   P +SPPP  K  PP     +SPP   S PP
Sbjct: 1208 SPPPPVKSPPPPAPVILPPPPVKSPPPPA-PVISPPPPEKSPPPAAPVILSPPAVKSLPP 1266

Query: 363  PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHS 184
            P   S P  P     PP PV S PPP   S PPP P      S PPP    + P      
Sbjct: 1267 PAPVSLPPPPVKSLPPPAPV-SLPPPVVKSLPPPAP-----VSLPPPAVKPLPPPAPVSL 1320

Query: 183  PPPPKKPYYYHSPPPPVYSPPPPYHYSSPPP------PPKKPYYYHSPPPPVYSPPPP-- 28
            PPP  KP     PP P  S PPP   S PPP      PP K      PPP + +  PP  
Sbjct: 1321 PPPAVKPL---PPPVPQVSLPPPKQESLPPPAKEAEAPPAKE---SKPPPAMEAEAPPAF 1374

Query: 27   -----------YHYTSPPPP 1
                       + Y SPPPP
Sbjct: 1375 DTTVLLPPVMAHQYASPPPP 1394

 Score =  108 bits (269), Expect = 5e-22
 Identities = 87/258 (33%), Positives = 92/258 (35%), Gaps = 84/258 (32%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVS--------PPPKVYPPVSPPYHYSS- 370
            SSPP  + Y P SP     PP    PP   P  S        PPP   P  SPP H    
Sbjct: 923  SSPPSHEEYVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSSPPSHEEYV 982

Query: 369  PPPPVYS--PPKKPY--------------HYSSPPPPVYSPPPPYHYSSPPPPPKK---- 250
            PP P  S  PP+KP                   PP PV S PPP   S PPP P +    
Sbjct: 983  PPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPPPSPVESVLP 1042

Query: 249  PYKYSSP-------PPPEHHVSPKPYYHSPPPPKKPYYYHSP------------------ 145
            P K S P       PPP     P+    S PPP K    H P                  
Sbjct: 1043 PVKSSPPHAPVISEPPPTKSSPPQVPVTSEPPPAKSSPPHEPISPPETPEKSYPPSTPEE 1102

Query: 144  --------------------------PPPVYSP-PPPYHYSSPPPP---PKKPYYYHSPP 55
                                      PPP   P PPP   SSPPPP   P  P     PP
Sbjct: 1103 SSPPSVPKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPP 1162

Query: 54   PPVYSPPPPYHYTSPPPP 1
            PP+ SPPPP    SPPPP
Sbjct: 1163 PPIKSPPPPAPVISPPPP 1180

 Score =  108 bits (269), Expect = 5e-22
 Identities = 74/185 (40%), Positives = 83/185 (44%), Gaps = 26/185 (14%)
 Frame = -3

Query: 519  SPPPPKVY----PPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPP----VSPPYHYSSPP 364
            SPPPP       PPV  PP   P +  PPP+  PP + P  + PP    + PP   S PP
Sbjct: 1215 SPPPPAPVILPPPPVKSPPPPAPVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPP 1274

Query: 363  PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPP-----PPKKPYKYSSP-----PPPEH 214
            PPV S P  P   S PPP V S PPP   S PPP     PP  P     P     PPP  
Sbjct: 1275 PPVKSLPP-PAPVSLPPPVVKSLPPPAPVSLPPPAVKPLPPPAPVSLPPPAVKPLPPPVP 1333

Query: 213  HVS-PKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPP-------PPKKPYYYHSP 58
             VS P P   S PPP K     +PP     PPP     +PP        PP   + Y SP
Sbjct: 1334 QVSLPPPKQESLPPPAKEA--EAPPAKESKPPPAMEAEAPPAFDTTVLLPPVMAHQYASP 1391

Query: 57   PPPVY 43
            PPP +
Sbjct: 1392 PPPQF 1396

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 77/218 (35%), Positives = 90/218 (41%), Gaps = 44/218 (20%)
 Frame = -3

Query: 522  SSPP--PPKVYPPVSPPPKVYPPVYSPPPKV-YPPVS---PPPKVYPPVSPPYHYSSPPP 361
            S PP  PP +  PV PP K   P Y  PP     P S   PPP+   P  PP   +  P 
Sbjct: 423  SEPPEKPPLIPVPVGPPEK--SPAYEEPPAAPSTPTSHGPPPPEEESPEEPPEEPTPSPT 480

Query: 360  PVYSPPKKPYHYSSPPPPVY-----------SPPP---------PYHYSSPPPPPKKPYK 241
            P  S P+ P   + PP P             +PPP         P    +PPP  + P +
Sbjct: 481  P--SSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTE 538

Query: 240  YSSP------PPPE----------HHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYH 109
            YS P      PPPE          H   P P  H+P PPK      S PP   SPP P  
Sbjct: 539  YSPPATPESSPPPEGKSPPTPTASHSPPPVPEGHTPSPPK------SGPPAGESPPTPES 592

Query: 108  YSSPPPPPKK--PYYYHSPPPPVYSPPPPYHYTSPPPP 1
             +SPPP P++  P    S PP   SPP P    S PPP
Sbjct: 593  KASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPP 630

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 70/188 (37%), Positives = 81/188 (43%), Gaps = 17/188 (9%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           P P K   P   PP +  PV   PP+  P    PP    P +P  H   PPPP    P++
Sbjct: 417 PTPGKPSEPPEKPPLIPVPV--GPPEKSPAYEEPPAA--PSTPTSH--GPPPPEEESPEE 470

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKK-----PYKYSSPPPPEHHVSPK-PYYHSPPP 175
           P    +P P   SP  P   + PP P  K     P +Y +PPPP     PK P     PP
Sbjct: 471 PPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPP 530

Query: 174 P--KKPYYY-------HSPPPPVYSPPPPYHYSSPPPPPK--KPYYYHSPPPPVYSPPPP 28
           P  + P  Y        SPPP   SPP P    SPPP P+   P    S PP   SPP P
Sbjct: 531 PQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPVPEGHTPSPPKSGPPAGESPPTP 590

Query: 27  YHYTSPPP 4
               SPPP
Sbjct: 591 ESKASPPP 598

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 59/169 (34%), Positives = 67/169 (39%), Gaps = 8/169 (4%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPV--YSPPPKVYPPVSPPPKVYPPVSPPY 382
            P ++S  +     PP P   PP  PP K  PP    S PP V   + PP  V        
Sbjct: 1253 PVILSPPAVKSLPPPAPVSLPP--PPVKSLPPPAPVSLPPPVVKSLPPPAPV-------- 1302

Query: 381  HYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSP 202
               S PPP   P   P   S PPP V   PPP    S PPP     K  S PPP      
Sbjct: 1303 ---SLPPPAVKPLPPPAPVSLPPPAVKPLPPPVPQVSLPPP-----KQESLPPPAKEAEA 1354

Query: 201  KPYYHSPPPPKKPYYYHSPPPPVYS-----PPPPYH-YSSPPPPPKKPY 73
             P   S PPP       +  PP +      PP   H Y+SPPPP  + Y
Sbjct: 1355 PPAKESKPPPA----MEAEAPPAFDTTVLLPPVMAHQYASPPPPQFQGY 1399

 Score = 71.6 bits (174), Expect = 5e-11
 Identities = 52/160 (32%), Positives = 60/160 (37%), Gaps = 26/160 (16%)
 Frame = -3

Query: 402 PPVSPPYHYSSPPPPVYSPPKKPYHYSSPPP----PVYSPPPPYHYSSPPPPPKKPYKYS 235
           P ++ P   S    P +  P KP      PP    PV  P     Y  PP  P  P  + 
Sbjct: 400 PVLARPVDCSKHVCPGHPTPGKPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHG 459

Query: 234 SPPPPEHHVSPKPYYHSPPP----PKKPYYYHSPPPPVYS--PPPPYHYSSPPPP----- 88
            PPP E      P   +P P    P+ P     PP P       PP  Y +PPPP     
Sbjct: 460 PPPPEEESPEEPPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWL 519

Query: 87  PKKPYYYHSPPPPV-----YSPP------PPYHYTSPPPP 1
           PK P    +PPP       YSPP      PP    SPP P
Sbjct: 520 PKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTP 559

[112][TOP]
>UniRef100_Q5ZB68 Os01g0594300 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5ZB68_ORYSJ
          Length = 551

 Score =  151 bits (381), Expect = 5e-35
 Identities = 84/172 (48%), Positives = 92/172 (53%), Gaps = 5/172 (2%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVY 352
           ++  SPPPP   PP  PPP   PP  SPPP   PP SP P   PP SPP     PP P  
Sbjct: 395 FVLPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSP---PPPSPP-----PPSP-- 444

Query: 351 SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP 172
            PP  P +YSSPPPP Y   P   Y SPPPPP     + +PPPP + VSP+  Y SPPPP
Sbjct: 445 -PPPSPVYYSSPPPPYYEVSPEDRYLSPPPPPAY---HEAPPPPYYEVSPEDRYLSPPPP 500

Query: 171 KKPYYYHSPPPPVYSPPPPYHYSSPPPPP----KKPYY-YHSPPPPVYSPPP 31
              Y    PPPP Y   P   Y SPPPP     K P Y Y SPPPP  +  P
Sbjct: 501 PA-YQETPPPPPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPPAATWKP 551

 Score =  146 bits (369), Expect = 1e-33
 Identities = 82/159 (51%), Positives = 87/159 (54%), Gaps = 18/159 (11%)
 Frame = -3

Query: 423 SPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPY 244
           SPPP   PP SPP    SPPPP   PP  P    SPPPP  SPPPP    SPPPP   P 
Sbjct: 399 SPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPP--SPPPP----SPPPP--SPV 450

Query: 243 KYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYH 64
            YSSPPPP + VSP+  Y SPPPP  P Y+ +PPPP Y   P   Y SPPPPP   Y   
Sbjct: 451 YYSSPPPPYYEVSPEDRYLSPPPP--PAYHEAPPPPYYEVSPEDRYLSPPPPP--AYQET 506

Query: 63  SPPPPVY---------SPPPP---------YHYTSPPPP 1
            PPPP Y         SPPPP         Y Y+SPPPP
Sbjct: 507 PPPPPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPP 545

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 54/117 (46%), Positives = 58/117 (49%), Gaps = 5/117 (4%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           PS    +   YSSPPPP  Y  VSP  +   P   PPP  Y    PPP  Y  VSP   Y
Sbjct: 442 PSPPPPSPVYYSSPPPP--YYEVSPEDRYLSP---PPPPAYHEAPPPP--YYEVSPEDRY 494

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPP----KKP-YKYSSPPPP 220
            SPPPP        Y  + PPPP Y   P   Y SPPPP     K P Y+YSSPPPP
Sbjct: 495 LSPPPP------PAYQETPPPPPQYEVSPEDRYLSPPPPSPVKWKLPVYEYSSPPPP 545

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 31/68 (45%), Positives = 34/68 (50%), Gaps = 12/68 (17%)
 Frame = -3

Query: 168 KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPP------------PY 25
           K +   SPPPP   PP P   S  PPPP  P    SPPPP  SPPP            P 
Sbjct: 393 KKFVLPSPPPPSPPPPSPPPPSPSPPPPSPP--PPSPPPPSPSPPPPSPPPPSPPPPSPV 450

Query: 24  HYTSPPPP 1
           +Y+SPPPP
Sbjct: 451 YYSSPPPP 458

[113][TOP]
>UniRef100_B9G8N7 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=B9G8N7_ORYSJ
          Length = 1360

 Score =  151 bits (381), Expect = 5e-35
 Identities = 96/217 (44%), Positives = 102/217 (47%), Gaps = 27/217 (12%)
 Frame = -3

Query: 570  VSLTLPSLISANSY--LYSSPPPPKVYPPVSPPPKVYPPVYSPPP-----------KVYP 430
            V   LP + S+  +  + S PPP K  PP  P     PP  S PP           K YP
Sbjct: 1037 VESVLPPVKSSPPHAPVISEPPPTKSSPPQVPVTSEPPPAKSSPPHEPISPPETPEKSYP 1096

Query: 429  PVSP----PPKVYPPVSPPYHYSSPPP-------PVYSPPKKPYHYSSPPPPVYSPPPPY 283
            P +P    PP V    SPP   S PPP       P   P   P   SSPPPP  SPPPP 
Sbjct: 1097 PSTPEESSPPSVPKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPA 1156

Query: 282  HYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYS 103
                PPPP K      SPPPP   +SP P   SPPPP        PPPPV SPPPP    
Sbjct: 1157 PVILPPPPIK------SPPPPAPVISPPPPVKSPPPPAPVIL---PPPPVKSPPPPAPVI 1207

Query: 102  SPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            SPPPP   P  P     PPPPV SPPPP    SPPPP
Sbjct: 1208 SPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPP 1244

 Score =  148 bits (374), Expect = 3e-34
 Identities = 93/182 (51%), Positives = 97/182 (53%), Gaps = 10/182 (5%)
 Frame = -3

Query: 519  SPP--PPKVYPPVSP----PPKVYPPVYSPPP-KVYPP---VSPPPKVYPPVSPPYHYSS 370
            SPP  P K YPP +P    PP V P   SPP  K  PP   VS PP    P+ PP   SS
Sbjct: 1086 SPPETPEKSYPPSTPEESSPPSV-PKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSS 1144

Query: 369  PPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYY 190
            PPPP  SPP  P     PPPP+ SPPPP    SPPPP K      SPPPP   + P P  
Sbjct: 1145 PPPPEKSPP-PPAPVILPPPPIKSPPPPAPVISPPPPVK------SPPPPAPVILPPPPV 1197

Query: 189  HSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSP 10
             SPPPP       SPPPPV SPPPP     PPPP K P     PP PV SPPPP    SP
Sbjct: 1198 KSPPPPAPVI---SPPPPVKSPPPPAPVILPPPPVKSP----PPPAPVISPPPP--EKSP 1248

Query: 9    PP 4
            PP
Sbjct: 1249 PP 1250

 Score =  137 bits (346), Expect = 5e-31
 Identities = 86/180 (47%), Positives = 91/180 (50%), Gaps = 6/180 (3%)
 Frame = -3

Query: 522  SSPPPPKVYPP---VSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVY 352
            SSPP  K  PP   VS PP    P+  P P   PP   PP+  PP  PP     PPPP+ 
Sbjct: 1112 SSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSPP---PPEKSPP--PPAPVILPPPPIK 1166

Query: 351  SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP 172
            SPP  P    SPPPPV SPPPP     PPPP K      SPPPP   +SP P   SPPPP
Sbjct: 1167 SPP-PPAPVISPPPPVKSPPPPAPVILPPPPVK------SPPPPAPVISPPPPVKSPPPP 1219

Query: 171  KKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKP---YYYHSPPPPVYSPPPPYHYTSPPPP 1
                    PPPPV SPPPP    SPPPP K P         PP V S PPP   + PP P
Sbjct: 1220 APVIL---PPPPVKSPPPPAPVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPSP 1276

 Score =  129 bits (324), Expect = 2e-28
 Identities = 89/211 (42%), Positives = 98/211 (46%), Gaps = 37/211 (17%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPP-----------VYSPPP--KVYPPVSPPPKVYPPV--SP 388
            S+PPP K  PP +P     PP             SPPP  K  PP SP   V PPV  SP
Sbjct: 989  STPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPPPSPVESVLPPVKSSP 1048

Query: 387  PYH--YSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP----- 229
            P+    S PPP   SPP+ P   +S PPP  S  PP+   SPP  P+K Y  S+P     
Sbjct: 1049 PHAPVISEPPPTKSSPPQVP--VTSEPPPAKS-SPPHEPISPPETPEKSYPPSTPEESSP 1105

Query: 228  --------PPPEHHVSPKPYYHSPPPPKK----PYYYHSPPPPVYSPPPPYHYSSPPPP- 88
                    PP E  + P      PPP  K    P    SPPPP  SPPPP     PPPP 
Sbjct: 1106 PSVPKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPPI 1165

Query: 87   --PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              P  P    SPPPPV SPPPP     PPPP
Sbjct: 1166 KSPPPPAPVISPPPPVKSPPPPAPVILPPPP 1196

 Score =  126 bits (317), Expect = 1e-27
 Identities = 81/176 (46%), Positives = 85/176 (48%), Gaps = 2/176 (1%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            SSPPPP+  PP   P  + PP    PP   P +SPPP V  P  PP     PPPPV SPP
Sbjct: 1143 SSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSP-PPPAPVILPPPPVKSPP 1201

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P    SPPPPV SPPPP     PPPP K      SPPPP   +SP P   SPPP    
Sbjct: 1202 -PPAPVISPPPPVKSPPPPAPVILPPPPVK------SPPPPAPVISPPPPEKSPPPAAPV 1254

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKK--PYYYHSPPPPVYSPPPPYHYTSPPPP 1
                  PP V S PPP   S PP P K   P    S PP V    PP    S P P
Sbjct: 1255 IL---SPPAVKSLPPPAPVSLPPSPVKSLPPRAPVSLPPRVVKSLPPRAPVSLPQP 1307

 Score =  126 bits (316), Expect = 2e-27
 Identities = 81/186 (43%), Positives = 89/186 (47%), Gaps = 12/186 (6%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            SSPPPP     +  PPK  PPV   PP      S PP   P    P    S PP   SPP
Sbjct: 692  SSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPP 751

Query: 342  KKPYHYSSPP-PPVYSPPPPYHYSSPP----PPPKKPYKYSSPPPPEHHVSPKPYYHSPP 178
              P  ++SPP P  Y+P PP   SSPP    PPP  P K  SPP   H  SP P   SPP
Sbjct: 752  IPPTSHTSPPTPEEYTPSPP--KSSPPEEKSPPPHSPEK--SPPSEAHPTSPPPSEKSPP 807

Query: 177  PPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKK-----PYYYHSPPPP--VYSPPPPYHY 19
             P +     SPP P  SP PP  +   PP P K     P  + S PPP    SPPP  H 
Sbjct: 808  TPAEE---SSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHV 864

Query: 18   TSPPPP 1
            +SPPPP
Sbjct: 865  SSPPPP 870

 Score =  126 bits (316), Expect = 2e-27
 Identities = 85/185 (45%), Positives = 90/185 (48%), Gaps = 12/185 (6%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVS----PPPKVYPPVSPPYHYSSPP--- 364
            SSPPPP        PPK  PP    PP   PP S    P P+ Y P SPP   SSPP   
Sbjct: 725  SSPPPPAPEGHTPSPPKSSPPEEKSPP--IPPTSHTSPPTPEEYTP-SPPK--SSPPEEK 779

Query: 363  -PPVYSPPKKP---YHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
             PP +SP K P    H +SPPP   SPP P   SSPP P K P    SPP       P P
Sbjct: 780  SPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSP----SPPSGHEGTPPSP 835

Query: 195  YYHSPPPPKKPYYYHSPPPPVY-SPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHY 19
               S PPP+   +  SPPP    SPPP  H SSPPPP K P     PPP   SPP     
Sbjct: 836  VKSSSPPPEA--HVSSPPPEKSSSPPPEAHVSSPPPPEKSP-----PPPETKSPPTLTPE 888

Query: 18   TSPPP 4
             SPPP
Sbjct: 889  ISPPP 893

 Score =  120 bits (302), Expect = 7e-26
 Identities = 86/222 (38%), Positives = 98/222 (44%), Gaps = 48/222 (21%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPV--YSPPPKVYPPVSPPPKVYPP-------VSPPYHYSS 370
            SS PPP+ +    PPP+  PP      PP + P +SPPP+   P        SPP   S 
Sbjct: 855  SSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESE 914

Query: 369  PPP---PVYSPPKKPYHY------SSPPPPVYSPPPPYHYSSPPP-----PPKKPYKYSS 232
            PPP   P  SPP    +       S+PPP   SPP     SS PP     PP  P   SS
Sbjct: 915  PPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSS 974

Query: 231  PPPPEHHVSPKPYYHSPPPPKKPYYYHS--------------PPPPVYSPPPPYHYSSPP 94
            PP  E +V P P   S PPP+KP   H+              PP PV S PPP   S PP
Sbjct: 975  PPSHEEYVPPSP-AKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPP 1033

Query: 93   P-------PPKKPYYYHSP----PPPVYSPPPPYHYTSPPPP 1
            P       PP K    H+P    PPP  S PP    TS PPP
Sbjct: 1034 PSPVESVLPPVKSSPPHAPVISEPPPTKSSPPQVPVTSEPPP 1075

 Score =  117 bits (293), Expect = 8e-25
 Identities = 80/202 (39%), Positives = 90/202 (44%), Gaps = 29/202 (14%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPP---PPVY 352
            SSPPPP        PPK  PP    PP      S PP    P +P  H  SPP   PPV 
Sbjct: 659  SSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPP----PPAPEGHMPSPPKSTPPVE 714

Query: 351  SPPKKPYHYSSPPPPVYSPPPPYHYSSPP--------PPPKKPYKYSSPPPPEHHVSPKP 196
              P  P   +S PPP   P P  H  SPP         PP  P  ++SPP PE + +P P
Sbjct: 715  KSPPTPESEASSPPP---PAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEY-TPSP 770

Query: 195  YYHSPPPPKKP------------YYYHSPPPPVYSPPPPYHYSSPPPPPKKPY----YYH 64
               SPP  K P             +  SPPP   SPP P   SSPP P K P     +  
Sbjct: 771  PKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSPPSGHEG 830

Query: 63   SPPPPV--YSPPPPYHYTSPPP 4
            +PP PV   SPPP  H +SPPP
Sbjct: 831  TPPSPVKSSSPPPEAHVSSPPP 852

 Score =  113 bits (283), Expect = 1e-23
 Identities = 88/268 (32%), Positives = 99/268 (36%), Gaps = 96/268 (35%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPV------------------ 394
            +P PPK  PP    P  + P  SPP + +P   PP +  PP                   
Sbjct: 767  TPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSPPS 826

Query: 393  -------------SPP--YHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYS----- 274
                         SPP   H SSPPP   S P    H SSPPPP  SPPPP   S     
Sbjct: 827  GHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLT 886

Query: 273  ---SPPP---------------------PPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
               SPPP                     PP  P   SSPP  E +V P P   +PPP +K
Sbjct: 887  PEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEK 946

Query: 165  PYYYH-----SPPPPVYSPPP-PYHYSSPP--------------PPPKKPYYYHS----- 61
                H     SPP     PPP P   SSPP              PPP+KP   H+     
Sbjct: 947  SPPSHTPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLPPHTPTINS 1006

Query: 60   ---------PPPPVYSPPPPYHYTSPPP 4
                     PP PV S PPP   + PPP
Sbjct: 1007 SPPSEEEYMPPSPVKSSPPPAEKSQPPP 1034

 Score =  112 bits (279), Expect = 3e-23
 Identities = 85/211 (40%), Positives = 94/211 (44%), Gaps = 36/211 (17%)
 Frame = -3

Query: 525  YSSPPPPKVYPPVSPPPKVYPPVYSPPP----KVYPPVSP------PPKVYPPV-----S 391
            +S PP P+ + P   PPK  PP    PP    K  PP +P      PPK  PP      +
Sbjct: 563  HSPPPVPEGHTP--SPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPT 620

Query: 390  PPYHYSSPPPP-----VYSPPKK-PYHYSSPPPP---VYSPPPPYHYSSPPPPPKK-PYK 241
            P    SSPPPP       SPP+  P    SPP P     SPPPP      P PPK  P  
Sbjct: 621  PESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPKSTPPT 680

Query: 240  YSSPPPPEHHVS----PKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPY 73
              SPP PE   S    P P  H P PPK      S PP   SPP P   +S PPPP    
Sbjct: 681  EKSPPTPESESSSPPPPAPEGHMPSPPK------STPPVEKSPPTPESEASSPPPPAPE- 733

Query: 72   YYHSPPPPVYSPP-------PPYHYTSPPPP 1
              H+P PP  SPP       PP  +TSPP P
Sbjct: 734  -GHTPSPPKSSPPEEKSPPIPPTSHTSPPTP 763

 Score =  111 bits (278), Expect = 4e-23
 Identities = 83/210 (39%), Positives = 86/210 (40%), Gaps = 37/210 (17%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PP P+ Y P   PPK  PP    PP      S PP   P    P    S PP   SPP
Sbjct: 595  SPPPTPEEYTP--SPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPP 652

Query: 342  KKPYHYSSPPPPV----------------YSPPPPYHYSSPPPPP-----------KKPY 244
                  SSPPPP                  SPP P   SS PPPP             P 
Sbjct: 653  TPESKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPP 712

Query: 243  KYSSPPPPEHHVS----PKPYYHSPPPPK-KPYYYHSPP-PPV--YSPPPPYHYSSPPPP 88
               SPP PE   S    P P  H+P PPK  P    SPP PP    SPP P  Y +P PP
Sbjct: 713  VEKSPPTPESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEY-TPSPP 771

Query: 87   PKKPYYYHSPPP--PVYSPPPPYHYTSPPP 4
               P    SPPP  P  SPP   H TSPPP
Sbjct: 772  KSSPPEEKSPPPHSPEKSPPSEAHPTSPPP 801

 Score =  111 bits (277), Expect = 5e-23
 Identities = 83/214 (38%), Positives = 91/214 (42%), Gaps = 42/214 (19%)
 Frame = -3

Query: 516  PPPPKVYPPVSPP--PKVYPPVYSP--PPKVYPPVSPPPKVYPPVSPPYHYSSPPPPV-- 355
            PPPP+   P  PP  P   P   SP  P K+ PP  P P +    SPP  Y +PPPP   
Sbjct: 460  PPPPEEESPEEPPEEPTPSPTPSSPESPAKMAPP--PAPAIKGVTSPPAEYGAPPPPSSG 517

Query: 354  ---------------------YSPPKKPYHYSSPPPPVYSPPPPYHYSSPPP-------- 262
                                 YSPP  P   SSPPP   SPP P    SPPP        
Sbjct: 518  WLPKSPERKKAPPPQAEPPTEYSPPATPE--SSPPPEGKSPPTPTASHSPPPVPEGHTPS 575

Query: 261  PPKK-PYKYSSPPPPEHHVS--PKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPP 91
            PPK  P    SPP PE   S  P P  ++P PPK      S PP   SPP P   +S PP
Sbjct: 576  PPKSGPPAGESPPTPESKASPPPTPEEYTPSPPK------STPPAEKSPPTPESKASSPP 629

Query: 90   PPKKPYYYHSP----PPPVYSPPPPYHYTSPPPP 1
            PP    +  SP    PP   SPP P    S PPP
Sbjct: 630  PPAPEGHTPSPPESTPPSEKSPPTPESKASSPPP 663

 Score =  111 bits (277), Expect = 5e-23
 Identities = 85/228 (37%), Positives = 93/228 (40%), Gaps = 53/228 (23%)
 Frame = -3

Query: 525  YSSPPPP------------KVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPV 394
            Y +PPPP            K  PP + PP  Y     P  SPPP+   P +P     PP 
Sbjct: 508  YGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPP 567

Query: 393  SPPYHYSSPP---PPV----------YSPPKKPYHYS-----SPPPPVYSPPPPYHYSSP 268
             P  H  SPP   PP            SPP  P  Y+     S PP   SPP P   +S 
Sbjct: 568  VPEGHTPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASS 627

Query: 267  PPPP-----------KKPYKYSSPPPPEHHVS----PKPYYHSPPPPKKPYYYHSPPPPV 133
            PPPP             P    SPP PE   S    P P  H+P PPK      S PP  
Sbjct: 628  PPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEGHTPSPPK------STPPTE 681

Query: 132  YSPPPPYHYSSPPPPPKKPYYYHSPP---PPV-YSPPPPYHYTSPPPP 1
             SPP P   SS PPPP    +  SPP   PPV  SPP P    S PPP
Sbjct: 682  KSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPP 729

 Score =  108 bits (269), Expect = 5e-22
 Identities = 87/258 (33%), Positives = 92/258 (35%), Gaps = 84/258 (32%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVS--------PPPKVYPPVSPPYHYSS- 370
            SSPP  + Y P SP     PP    PP   P  S        PPP   P  SPP H    
Sbjct: 923  SSPPSHEEYVPPSPAKSTPPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSSPPSHEEYV 982

Query: 369  PPPPVYS--PPKKPY--------------HYSSPPPPVYSPPPPYHYSSPPPPPKK---- 250
            PP P  S  PP+KP                   PP PV S PPP   S PPP P +    
Sbjct: 983  PPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPVKSSPPPAEKSQPPPSPVESVLP 1042

Query: 249  PYKYSSP-------PPPEHHVSPKPYYHSPPPPKKPYYYHSP------------------ 145
            P K S P       PPP     P+    S PPP K    H P                  
Sbjct: 1043 PVKSSPPHAPVISEPPPTKSSPPQVPVTSEPPPAKSSPPHEPISPPETPEKSYPPSTPEE 1102

Query: 144  --------------------------PPPVYSP-PPPYHYSSPPPP---PKKPYYYHSPP 55
                                      PPP   P PPP   SSPPPP   P  P     PP
Sbjct: 1103 SSPPSVPKASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPP 1162

Query: 54   PPVYSPPPPYHYTSPPPP 1
            PP+ SPPPP    SPPPP
Sbjct: 1163 PPIKSPPPPAPVISPPPP 1180

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 77/218 (35%), Positives = 90/218 (41%), Gaps = 44/218 (20%)
 Frame = -3

Query: 522  SSPP--PPKVYPPVSPPPKVYPPVYSPPPKV-YPPVS---PPPKVYPPVSPPYHYSSPPP 361
            S PP  PP +  PV PP K   P Y  PP     P S   PPP+   P  PP   +  P 
Sbjct: 423  SEPPEKPPLIPVPVGPPEK--SPAYEEPPAAPSTPTSHGPPPPEEESPEEPPEEPTPSPT 480

Query: 360  PVYSPPKKPYHYSSPPPPVY-----------SPPP---------PYHYSSPPPPPKKPYK 241
            P  S P+ P   + PP P             +PPP         P    +PPP  + P +
Sbjct: 481  P--SSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTE 538

Query: 240  YSSP------PPPE----------HHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYH 109
            YS P      PPPE          H   P P  H+P PPK      S PP   SPP P  
Sbjct: 539  YSPPATPESSPPPEGKSPPTPTASHSPPPVPEGHTPSPPK------SGPPAGESPPTPES 592

Query: 108  YSSPPPPPKK--PYYYHSPPPPVYSPPPPYHYTSPPPP 1
             +SPPP P++  P    S PP   SPP P    S PPP
Sbjct: 593  KASPPPTPEEYTPSPPKSTPPAEKSPPTPESKASSPPP 630

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 70/188 (37%), Positives = 81/188 (43%), Gaps = 17/188 (9%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           P P K   P   PP +  PV   PP+  P    PP    P +P  H   PPPP    P++
Sbjct: 417 PTPGKPSEPPEKPPLIPVPV--GPPEKSPAYEEPPAA--PSTPTSH--GPPPPEEESPEE 470

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKK-----PYKYSSPPPPEHHVSPK-PYYHSPPP 175
           P    +P P   SP  P   + PP P  K     P +Y +PPPP     PK P     PP
Sbjct: 471 PPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPP 530

Query: 174 P--KKPYYY-------HSPPPPVYSPPPPYHYSSPPPPPK--KPYYYHSPPPPVYSPPPP 28
           P  + P  Y        SPPP   SPP P    SPPP P+   P    S PP   SPP P
Sbjct: 531 PQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPVPEGHTPSPPKSGPPAGESPPTP 590

Query: 27  YHYTSPPP 4
               SPPP
Sbjct: 591 ESKASPPP 598

 Score = 91.7 bits (226), Expect = 4e-17
 Identities = 72/182 (39%), Positives = 77/182 (42%), Gaps = 9/182 (4%)
 Frame = -3

Query: 519  SPPPPKVY----PPV-SPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPV 355
            SPPPP       PPV SPPP    PV SPPP V  P  P P + PP  PP     PP PV
Sbjct: 1183 SPPPPAPVILPPPPVKSPPPPA--PVISPPPPVKSPPPPAPVILPP--PPVKSPPPPAPV 1238

Query: 354  YSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPP 175
                       SPPPP  SPPP       PP  K     S PPP    + P P      P
Sbjct: 1239 I----------SPPPPEKSPPPAAPVILSPPAVK-----SLPPPAPVSLPPSPV--KSLP 1281

Query: 174  PKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSP---PPPVYSP-PPPYHYTSPP 7
            P+ P    S PP V    PP    S P P  KP+   +P   PPP   P P      S P
Sbjct: 1282 PRAPV---SLPPRVVKSLPPRAPVSLPQPAVKPFPQRAPVSLPPPAVKPLPLQVRQVSLP 1338

Query: 6    PP 1
            PP
Sbjct: 1339 PP 1340

 Score = 71.6 bits (174), Expect = 5e-11
 Identities = 52/160 (32%), Positives = 60/160 (37%), Gaps = 26/160 (16%)
 Frame = -3

Query: 402 PPVSPPYHYSSPPPPVYSPPKKPYHYSSPPP----PVYSPPPPYHYSSPPPPPKKPYKYS 235
           P ++ P   S    P +  P KP      PP    PV  P     Y  PP  P  P  + 
Sbjct: 400 PVLARPVDCSKHVCPGHPTPGKPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHG 459

Query: 234 SPPPPEHHVSPKPYYHSPPP----PKKPYYYHSPPPPVYS--PPPPYHYSSPPPP----- 88
            PPP E      P   +P P    P+ P     PP P       PP  Y +PPPP     
Sbjct: 460 PPPPEEESPEEPPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWL 519

Query: 87  PKKPYYYHSPPPPV-----YSPP------PPYHYTSPPPP 1
           PK P    +PPP       YSPP      PP    SPP P
Sbjct: 520 PKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTP 559

 Score = 71.2 bits (173), Expect = 6e-11
 Identities = 62/159 (38%), Positives = 68/159 (42%), Gaps = 11/159 (6%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPP--KVYPP-----VSPPYHYSSPP 364
            S PPP K  PP +P     PPV SPPP   P +SPPP  K  PP     +SPP   S PP
Sbjct: 1208 SPPPPVKSPPPPAPVILPPPPVKSPPPPA-PVISPPPPEKSPPPAAPVILSPPAVKSLPP 1266

Query: 363  P-PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYH 187
            P PV          S PP PV S PP    S PP   K         PP   VS      
Sbjct: 1267 PAPV----------SLPPSPVKSLPPRAPVSLPPRVVKS-------LPPRAPVS------ 1303

Query: 186  SPPPPKKPYYYHSP---PPPVYSPPPPYHYSSPPPPPKK 79
             P P  KP+   +P   PPP   P P        PPPK+
Sbjct: 1304 LPQPAVKPFPQRAPVSLPPPAVKPLPLQVRQVSLPPPKR 1342

[114][TOP]
>UniRef100_Q43504 Extensin-like protein Dif10 (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q43504_SOLLC
          Length = 396

 Score =  150 bits (379), Expect = 8e-35
 Identities = 97/226 (42%), Positives = 105/226 (46%), Gaps = 47/226 (20%)
 Frame = -3

Query: 537 NSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY---PPVSPPYHYSSP 367
           + Y Y SP P K Y     P K Y    SP P  Y   SP P+ Y   P  S  Y+Y SP
Sbjct: 173 SKYYYKSPAPSKYYYKSPSPAKYYK---SPAPSKYYYKSPSPRKYYKSPAPSKHYYYKSP 229

Query: 366 PPPVYSPPKKPY-HYSSPPPPVYSPPPPYHYSSPPPPP----KKPYKYSSPPPPEHHVSP 202
            P  Y     PY +Y SP P  Y   P Y Y SPPPP     K P  Y SPPPP ++   
Sbjct: 230 SPSKYYKSPAPYKYYKSPAPQKYYKSPVY-YKSPPPPTTYYEKSPSYYKSPPPPPYYKES 288

Query: 201 KPYYHSPPPPKKPYY---YHSPPPPVY----------SPPPPYH------YSSPPPPPK- 82
            PYY SPPP   PYY   Y SPPPP Y           PPPPY+      Y SPPPPPK 
Sbjct: 289 TPYYKSPPP--SPYYKESYKSPPPPPYYEEFTPSYKSPPPPPYYKESTPSYKSPPPPPKH 346

Query: 81  ---KPYYYHSPPPP----------VYSPPPPYHY------TSPPPP 1
               P  Y+SPPPP            SPPPP  Y       SPPPP
Sbjct: 347 YDQSPTSYNSPPPPPPAYYKQTPTYASPPPPQKYEQSVTYASPPPP 392

 Score =  107 bits (266), Expect = 1e-21
 Identities = 88/236 (37%), Positives = 99/236 (41%), Gaps = 59/236 (25%)
 Frame = -3

Query: 531 YLYSSPPPPKVY---PPVSPPPKVYPP---VYSPP--PKVYPPVSPPPKVYPPVSPPYHY 376
           Y Y S  P K Y   P V+   K + P    Y  P   K Y   +P    Y       +Y
Sbjct: 79  YYYKSHAPSKHYYKAPIVAKYYKSHAPSKHYYKAPIVTKYYRSHAPSKHYYKAPVVAKYY 138

Query: 375 SSPPPP--VYSPPKKPYHYSSPPPP--VYSPPPP--YHYSSPPPPPKKPYKYSSPPPPEH 214
            SP P    Y  P    +Y SP P    Y  P P  Y+Y SP P     Y Y SP P ++
Sbjct: 139 KSPAPSKQYYKAPVVVKYYKSPAPSKNYYKAPTPSKYYYKSPAP---SKYYYKSPSPAKY 195

Query: 213 HVSPKP---YYHSPPP--------PKKPYYYHSPPPPVY--SPPP--------------- 118
           + SP P   YY SP P        P K YYY SP P  Y  SP P               
Sbjct: 196 YKSPAPSKYYYKSPSPRKYYKSPAPSKHYYYKSPSPSKYYKSPAPYKYYKSPAPQKYYKS 255

Query: 117 PYHYSSPPPP----PKKPYYYHSPPPPVY---------SPPP-PYH---YTSPPPP 1
           P +Y SPPPP     K P YY SPPPP Y         SPPP PY+   Y SPPPP
Sbjct: 256 PVYYKSPPPPTTYYEKSPSYYKSPPPPPYYKESTPYYKSPPPSPYYKESYKSPPPP 311

 Score = 91.3 bits (225), Expect = 6e-17
 Identities = 60/148 (40%), Positives = 65/148 (43%), Gaps = 8/148 (5%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           P+     S  Y   PPP             PP Y      Y   SPPP  Y   S    Y
Sbjct: 265 PTTYYEKSPSYYKSPPP-------------PPYYKESTPYYK--SPPPSPYYKES----Y 305

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPK----KPYKYSS-PPPPEHH 211
            SPPPP Y     P + S PPPP Y    P  Y SPPPPPK     P  Y+S PPPP  +
Sbjct: 306 KSPPPPPYYEEFTPSYKSPPPPPYYKESTP-SYKSPPPPPKHYDQSPTSYNSPPPPPPAY 364

Query: 210 VSPKPYYHSPPPPKK---PYYYHSPPPP 136
               P Y SPPPP+K      Y SPPPP
Sbjct: 365 YKQTPTYASPPPPQKYEQSVTYASPPPP 392

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 56/164 (34%), Positives = 63/164 (38%), Gaps = 37/164 (22%)
 Frame = -3

Query: 384 YHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPP---PYHYSSPPPPPKKPYKYSSPPPPEH 214
           Y Y+S  P   S   K  H S  P P Y  P    P HY      P K Y Y +P   ++
Sbjct: 46  YDYTSHSPSYNS---KKDHES--PSPYYKKPEKHVPSHYYYKSHAPSKHY-YKAPIVAKY 99

Query: 213 ---HVSPKPYYHSP--------PPPKKPY--------YYHSPPP-------PVY-----S 127
              H   K YY +P          P K Y        YY SP P       PV      S
Sbjct: 100 YKSHAPSKHYYKAPIVTKYYRSHAPSKHYYKAPVVAKYYKSPAPSKQYYKAPVVVKYYKS 159

Query: 126 PPPPYHYSSPPPPPKKPYYYHSPPPPVY---SPPPPYHYTSPPP 4
           P P  +Y   P P K  YYY SP P  Y   SP P  +Y SP P
Sbjct: 160 PAPSKNYYKAPTPSK--YYYKSPAPSKYYYKSPSPAKYYKSPAP 201

[115][TOP]
>UniRef100_A2Y786 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2Y786_ORYSI
          Length = 493

 Score =  150 bits (379), Expect = 8e-35
 Identities = 85/142 (59%), Positives = 89/142 (62%), Gaps = 1/142 (0%)
 Frame = -3

Query: 423 SPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP-PKKP 247
           SPPP  +   SPP   +SPPPPVYSPP  P   S PPPPVYSPPPP   SSPPPP P  P
Sbjct: 74  SPPPPYHD--SPPPPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPV--SSPPPPVPSPP 129

Query: 246 YKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYY 67
              SSPPPP    SP P   SPPPP       SPPPPV SPPPP   SSPPPP       
Sbjct: 130 PPVSSPPPPVP--SPPPPVSSPPPPVS-----SPPPPVSSPPPPV--SSPPPPVS----- 175

Query: 66  HSPPPPVYSPPPPYHYTSPPPP 1
            SPPPPV+SPPPP   +SPPPP
Sbjct: 176 -SPPPPVHSPPPP--VSSPPPP 194

 Score =  149 bits (375), Expect = 2e-34
 Identities = 88/154 (57%), Positives = 89/154 (57%), Gaps = 1/154 (0%)
 Frame = -3

Query: 486 SPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPP 307
           SPPP  +    SPPP   P  SPPP VY P  PP   S PPPPVYSPP      SSPPPP
Sbjct: 74  SPPPPYHD---SPPP---PRASPPPPVYSPPPPPPRSSPPPPPVYSPPPP---VSSPPPP 124

Query: 306 VYSPPPPYHYSSPPPP-PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY 130
           V SPPPP   SSPPPP P  P   SSPPPP           SPPPP       SPPPPV 
Sbjct: 125 VPSPPPPV--SSPPPPVPSPPPPVSSPPPP---------VSSPPPP-----VSSPPPPVS 168

Query: 129 SPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPP 28
           SPPPP   SSPPPP       HSPPPPV SPPPP
Sbjct: 169 SPPPP--VSSPPPP------VHSPPPPVSSPPPP 194

 Score =  140 bits (352), Expect = 1e-31
 Identities = 90/170 (52%), Positives = 94/170 (55%), Gaps = 7/170 (4%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPV-SPPYHYSSPPPPVYS 349
           + SPPPP+  PP        PPVYSPPP   PP S PP   PPV SPP   SSPPPPV S
Sbjct: 80  HDSPPPPRASPP--------PPVYSPPPP--PPRSSPPP--PPVYSPPPPVSSPPPPVPS 127

Query: 348 PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
           PP      SSPPPPV SPPPP   SSPPPP       SSPPPP    SP P   SPPPP 
Sbjct: 128 PPPP---VSSPPPPVPSPPPP--VSSPPPP------VSSPPPPVS--SPPPPVSSPPPP- 173

Query: 168 KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYY------YHSPPPPVYSP 37
                 SPPPPV+SPPPP   SSPPPP     Y      Y +   P Y P
Sbjct: 174 ----VSSPPPPVHSPPPP--VSSPPPPASDVVYCTNTTRYPTCTSPAYCP 217

 Score =  114 bits (286), Expect = 5e-24
 Identities = 65/121 (53%), Positives = 68/121 (56%), Gaps = 11/121 (9%)
 Frame = -3

Query: 330 HYSSPPPPVYSPPPPYHYSSPPP---PPKKPYKYSSPPPPEHHVSPKPYYHSPPP--PKK 166
           H  SPPPP +  PPP   S PPP   PP  P + S PPPP +  SP P   SPPP  P  
Sbjct: 71  HEKSPPPPYHDSPPPPRASPPPPVYSPPPPPPRSSPPPPPVY--SPPPPVSSPPPPVPSP 128

Query: 165 PYYYHSPPPPVYSPPPPYH-----YSSPPPP-PKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
           P    SPPPPV SPPPP        SSPPPP    P    SPPPPV SPPPP H  SPPP
Sbjct: 129 PPPVSSPPPPVPSPPPPVSSPPPPVSSPPPPVSSPPPPVSSPPPPVSSPPPPVH--SPPP 186

Query: 3   P 1
           P
Sbjct: 187 P 187

 Score =  100 bits (248), Expect = 1e-19
 Identities = 68/126 (53%), Positives = 69/126 (54%), Gaps = 1/126 (0%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPV-SPPYHYSSPPPPVY 352
           +YS PPP      VS PP   PPV SPP    PPVS PP   PPV SPP   SSPPPPV 
Sbjct: 111 VYSPPPP------VSSPP---PPVPSPP----PPVSSPP---PPVPSPPPPVSSPPPPV- 153

Query: 351 SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP 172
                    SSPPPPV SPPPP   SSPPPP       SSPPPP H  SP P   SPPPP
Sbjct: 154 ---------SSPPPPVSSPPPP--VSSPPPP------VSSPPPPVH--SPPPPVSSPPPP 194

Query: 171 KKPYYY 154
                Y
Sbjct: 195 ASDVVY 200

 Score = 89.7 bits (221), Expect = 2e-16
 Identities = 47/76 (61%), Positives = 50/76 (65%), Gaps = 3/76 (3%)
 Frame = -3

Query: 219 EHHVSPKPYYH-SPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPP--KKPYYYHSPPPP 49
           +H  SP P YH SPPPP+      SPPPPVYSPPPP   SSPPPPP    P    SPPPP
Sbjct: 70  KHEKSPPPPYHDSPPPPRA-----SPPPPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPP 124

Query: 48  VYSPPPPYHYTSPPPP 1
           V SPPPP   +SPPPP
Sbjct: 125 VPSPPPP--VSSPPPP 138

[116][TOP]
>UniRef100_Q9FUR6 ENOD2 (Fragment) n=1 Tax=Cladrastis kentukea RepID=Q9FUR6_CLALU
          Length = 244

 Score =  150 bits (378), Expect = 1e-34
 Identities = 97/211 (45%), Positives = 103/211 (48%), Gaps = 37/211 (17%)
 Frame = -3

Query: 528 LYSSP--PPPKVYPPVSPPPKVYPPVYSPPPKVY--PPVSPPPKVYPP---VSPPYHYSS 370
           +Y  P  PPP  +PP   PP VYPP +  PP VY  PP   PP VY P   V PP  Y  
Sbjct: 33  VYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYQPPPHVKPPPVYQP 92

Query: 369 PP----PPVYSPP---KKPYHYSSP---PPPVYSPPP----PYHYSSP---PPPPKKPYK 241
           PP    PPVY PP   K P  Y  P   PPPVY PPP    P  Y  P   PPP  +P  
Sbjct: 93  PPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPP 152

Query: 240 YSSPPP--PEHHVSPKPYYHSPPPPKKPYYY---HSPPPPVYSPPP---PYHYSSP---P 94
           +  PPP  P  H  P P Y  PP  K P  Y   H  PPPVY PPP   P  Y  P   P
Sbjct: 153 HEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPVYKPPGYEP 212

Query: 93  PPPKKPYYYHSP--PPPVYSPPPPYHYTSPP 7
           PP +KP  Y  P   PP Y PPP  HY  PP
Sbjct: 213 PPVEKPPVYKPPVEKPPSYKPPPYGHY--PP 241

 Score =  145 bits (367), Expect = 2e-33
 Identities = 93/204 (45%), Positives = 96/204 (47%), Gaps = 33/204 (16%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPP--VSPPYHYSSP----PPPVY 352
           PP    PP   PP VY P   PPP  +PP   PP VYPP    PP  Y  P    PPPVY
Sbjct: 19  PPTYEPPPTEKPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVY 78

Query: 351 SPP---KKPYHYSSP----PPPVYSPP----PPYHYSSP---PPPPKKPYKYSSPPP--P 220
            PP   K P  Y  P    PPPVY PP    PP  Y  P   PPP  +P  +  PPP  P
Sbjct: 79  QPPPHVKPPPVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPPPVYP 138

Query: 219 EHHVSPKPYYHSPPPPKKPYYY---HSPPPPVYSPPPPYHYSSPP--PPPKKPYYYHSPP 55
             H  P P Y  PP  K P  Y   H  PPPVY PPP  H   PP  PPP      H  P
Sbjct: 139 PPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPP--HEKPPPVYPPP------HEKP 190

Query: 54  PPVYSPPP---PYHYTSP---PPP 1
           PPVY PPP   P  Y  P   PPP
Sbjct: 191 PPVYQPPPHEKPPVYKPPGYEPPP 214

 Score =  134 bits (336), Expect = 8e-30
 Identities = 83/181 (45%), Positives = 87/181 (48%), Gaps = 18/181 (9%)
 Frame = -3

Query: 495 PPVSPPPKVYPPVYSPPP-KVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSS 319
           P   PP    PP Y PPP +  PPV  PP   PPV  P H    PPPVY PP +      
Sbjct: 9   PTYEPPATEKPPTYEPPPTEKPPPVYKPPIYPPPVHHPPH--EKPPPVYPPPHE------ 60

Query: 318 PPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPP---PEHHVSPKPYYHSPPPPKKPYYY-- 154
            PPPVY PPP       PPP  +P  +  PPP   P  HV P P Y  PP  K P  Y  
Sbjct: 61  KPPPVYQPPP----HEKPPPVYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHEKPPSVYPP 116

Query: 153 -HSPPPPVYSPPPPYHYSSPP--PPP--KKPYYY----HSPPPPVYSPP---PPYHYTSP 10
            H  PPPVY PPP  H   PP  PPP  K P  Y    H  PPPVY PP   PP  Y  P
Sbjct: 117 PHEKPPPVYQPPP--HEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPP 174

Query: 9   P 7
           P
Sbjct: 175 P 175

 Score =  106 bits (265), Expect = 1e-21
 Identities = 67/162 (41%), Positives = 71/162 (43%), Gaps = 8/162 (4%)
 Frame = -3

Query: 465 PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSP--PPPVYSPPKKPYHYSSPPPPVYSPP 292
           PP Y PP    PP   PP   P   PP  Y  P  PPPV+ PP +       PPPVY   
Sbjct: 8   PPTYEPPATEKPPTYEPP---PTEKPPPVYKPPIYPPPVHHPPHEK------PPPVY--- 55

Query: 291 PPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPP-- 118
                   PPP +KP     PPP   H  P P Y  PP        H  PPPVY PPP  
Sbjct: 56  --------PPPHEKPPPVYQPPP---HEKPPPVYQPPP--------HVKPPPVYQPPPHV 96

Query: 117 -PYHYSSPPPPPKKPYYY---HSPPPPVYSPPPPYHYTSPPP 4
            P     PPP  K P  Y   H  PPPVY PPP   +  PPP
Sbjct: 97  KPPPVYQPPPHEKPPSVYPPPHEKPPPVYQPPP---HEKPPP 135

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 33/74 (44%), Positives = 34/74 (45%), Gaps = 11/74 (14%)
 Frame = -3

Query: 528 LYSSPP---PPKVYPP--------VSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
           +Y  PP   PP VYPP          PPP   PPVY PP    PPV  PP   PPV  P 
Sbjct: 170 VYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPVYKPPGYEPPPVEKPPVYKPPVEKPP 229

Query: 381 HYSSPPPPVYSPPK 340
            Y  PP   Y P K
Sbjct: 230 SYKPPPYGHYPPSK 243

[117][TOP]
>UniRef100_C5YWZ0 Putative uncharacterized protein Sb09g030460 n=1 Tax=Sorghum
           bicolor RepID=C5YWZ0_SORBI
          Length = 642

 Score =  150 bits (378), Expect = 1e-34
 Identities = 87/223 (39%), Positives = 107/223 (47%), Gaps = 29/223 (13%)
 Frame = -3

Query: 582 LVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVY----------SPPPKVY 433
           L+ L++  L S  S +SY Y   P     P  +P    +PP +          +PPP   
Sbjct: 25  LLHLLARPLSSSQSGSSYAYRPFPSQAAAPAAAPNHVHHPPHHHQQEHWVPPRNPPPPGP 84

Query: 432 PPV-------SPPPKVYPPVSPPYHYSSPPPPV-YSPPKKPYHYSSPPPPVYSPPPPYHY 277
           PP         PPP+ Y P  P + +  PPPP  Y PP    H   PPP  Y PPPP  +
Sbjct: 85  PPQWSSQGHPPPPPRGYGPPPPQHQHVPPPPPRGYGPPPPGQHMPPPPPRGYGPPPPGQH 144

Query: 276 SSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK---PYYYHSPPPP--VYSPPPPY 112
             PPPPP  P+ +  PPP +H   P P+ H PP P +   P + H PPPP     PPPP 
Sbjct: 145 MPPPPPP-PPHGHGPPPPGQHVPPPPPHGHGPPLPGQHMPPPHGHGPPPPGQHMPPPPPR 203

Query: 111 HYSSPPP----PPKKPYYYHSPPPP--VYSPPPPYHYTSPPPP 1
           H+  PPP    PP  P + H PPPP     PPPP H   PPPP
Sbjct: 204 HHGPPPPGQHVPPPPPPHGHGPPPPGQHVPPPPPPHGHGPPPP 246

 Score =  145 bits (366), Expect = 3e-33
 Identities = 80/189 (42%), Positives = 94/189 (49%), Gaps = 17/189 (8%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP+ Y P  P  +  PP   PPP+ Y P  PPP  + P  PP  Y  PPP  + PP  
Sbjct: 95  PPPPRGYGPPPPQHQHVPP---PPPRGYGP--PPPGQHMPPPPPRGYGPPPPGQHMPPPP 149

Query: 336 P---YHYSSPPPPVYSPPPPYHYSSPPPP-----------PKKPYKYSSPPPPEHHVSPK 199
           P   + +  PPP  + PPPP H   PP P           P  P ++  PPPP HH  P 
Sbjct: 150 PPPPHGHGPPPPGQHVPPPPPHGHGPPLPGQHMPPPHGHGPPPPGQHMPPPPPRHHGPPP 209

Query: 198 PYYHSPPPPKKPYYYHSPPPPVYS--PPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPY 25
           P  H PPPP  P + H PPPP     PPPP H   PPPP +     H PPP  + PPPP+
Sbjct: 210 PGQHVPPPP--PPHGHGPPPPGQHVPPPPPPHGHGPPPPGQ-----HVPPPRGHGPPPPH 262

Query: 24  H-YTSPPPP 1
                PPPP
Sbjct: 263 QQAPPPPPP 271

 Score =  141 bits (356), Expect = 4e-32
 Identities = 82/203 (40%), Positives = 98/203 (48%), Gaps = 33/203 (16%)
 Frame = -3

Query: 510 PPKVYPPVSPPPKV----YPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
           PP+  PP  PPP+     +PP   PPP+ Y P  PP   + P  PP  Y  PPP  + PP
Sbjct: 75  PPRNPPPPGPPPQWSSQGHPP---PPPRGYGP-PPPQHQHVPPPPPRGYGPPPPGQHMPP 130

Query: 342 KKPYHYSSPPP----PVYSPPPPYHYSSPPP----PPKKPYKYSSP------PPPEHHVS 205
             P  Y  PPP    P   PPPP+ +  PPP    PP  P+ +  P      PPP  H  
Sbjct: 131 PPPRGYGPPPPGQHMPPPPPPPPHGHGPPPPGQHVPPPPPHGHGPPLPGQHMPPPHGHGP 190

Query: 204 PKPYYHSPPPPKKPYYYHSPPPP-VY-SPPPPYHYSSPPP-----PPKKPYYYHSPPPP- 49
           P P  H PPPP +   +H PPPP  +  PPPP H   PPP     PP  P + H PPPP 
Sbjct: 191 PPPGQHMPPPPPR---HHGPPPPGQHVPPPPPPHGHGPPPPGQHVPPPPPPHGHGPPPPG 247

Query: 48  -------VYSPPPPYHYTSPPPP 1
                   + PPPP+    PPPP
Sbjct: 248 QHVPPPRGHGPPPPHQQAPPPPP 270

 Score =  120 bits (301), Expect = 9e-26
 Identities = 61/156 (39%), Positives = 79/156 (50%), Gaps = 6/156 (3%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPP------VSPPYHYSSPP 364
           Y  PPP +  PP  PPP   P  + PPP       PPP  + P      + PP+ +  PP
Sbjct: 136 YGPPPPGQHMPPPPPPP---PHGHGPPPPGQHVPPPPPHGHGPPLPGQHMPPPHGHGPPP 192

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHS 184
           P  + PP  P H+  PPP  + PPPP  +   PPPP    ++  PPPP       P+ H 
Sbjct: 193 PGQHMPPPPPRHHGPPPPGQHVPPPPPPHGHGPPPPG---QHVPPPPP-------PHGHG 242

Query: 183 PPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKP 76
           PPPP +    H PPP  + PPPP+  + PPPPP +P
Sbjct: 243 PPPPGQ----HVPPPRGHGPPPPHQQAPPPPPPPEP 274

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 48/123 (39%), Positives = 58/123 (47%), Gaps = 18/123 (14%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPV---YSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           PPPP  + P  PP    PP+   + PPP  + P  PPP  + P  PP H+  PPP  + P
Sbjct: 158 PPPPGQHVPPPPPHGHGPPLPGQHMPPPHGHGP--PPPGQHMPPPPPRHHGPPPPGQHVP 215

Query: 345 PKKPYHYSSPPPPVYS--PPPPYHYSSPPPP-----------PKKPYKYSSPPPP--EHH 211
           P  P H   PPPP     PPPP H   PPPP           P  P++ + PPPP  E  
Sbjct: 216 PPPPPHGHGPPPPGQHVPPPPPPHGHGPPPPGQHVPPPRGHGPPPPHQQAPPPPPPPEPV 275

Query: 210 VSP 202
             P
Sbjct: 276 AGP 278

[118][TOP]
>UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2Z7_EHV86
          Length = 516

 Score =  149 bits (377), Expect = 1e-34
 Identities = 92/189 (48%), Positives = 95/189 (50%), Gaps = 16/189 (8%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP   PP SPPP + PP  SPP    PP SPPP   PP SPP    SPPPP   PP 
Sbjct: 48  SPPPPS--PPPSPPPPLPPPSPSPPSP--PPPSPPPPSPPPPSPPSPPPSPPPPSPPPPS 103

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYS-SPPPPEHHVSPKP----------Y 193
            P    SPPPP  SPPPP    SPPP P  P     SPPPP    SP P           
Sbjct: 104 PPP--PSPPPP--SPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSA 159

Query: 192 YHSPPPPKKPYYYH-----SPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPP 28
             SPPPP  P++       SPPPP  SP PP   S  PPPP       SP PP  SPPPP
Sbjct: 160 SPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSA-----SPSPPPPSPPPP 214

Query: 27  YHYTSPPPP 1
                PPPP
Sbjct: 215 SPPPPPPPP 223

 Score =  146 bits (368), Expect = 2e-33
 Identities = 91/192 (47%), Positives = 98/192 (51%), Gaps = 19/192 (9%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSP-PPPVYSPP 343
           SPPPP   PP  PPP    P  SPPP   PP SPPP   PP SPP     P PPP  SPP
Sbjct: 71  SPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPP 130

Query: 342 KKPYHYSSPPPPVYSP----PPPYHYSSP-----PPPPKKPY---KYSSPPPPEHHVSPK 199
             P    SPPPP  SP    PPP  + +P     PPPP  P+     +SP PP   +SP 
Sbjct: 131 SPPP--PSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPS 188

Query: 198 PYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSP----PPPVYSPPP 31
           P   + P P  P    SPPPP  SPPPP   S PPPPP  P    SP    PPP  SP P
Sbjct: 189 PPSSASPTPPPPSASPSPPPP--SPPPP---SPPPPPPPPPPPPPSPPSPNPPPSASPSP 243

Query: 30  PY--HYTSPPPP 1
           P+     SPPPP
Sbjct: 244 PFGRSLRSPPPP 255

 Score =  144 bits (362), Expect = 8e-33
 Identities = 85/194 (43%), Positives = 94/194 (48%), Gaps = 11/194 (5%)
 Frame = -3

Query: 549 LISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSP-PPKVYPPVSPPPKVYPPVSPPYHYS 373
           ++   +Y     PPP   PP SPPP   PP+  P PP   PP SPPP   PP+ PP    
Sbjct: 10  ILCGGAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSP 69

Query: 372 -SPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
            SPPPP   PP  P    SPP P  SPPPP      PPPP  P     PP P     P P
Sbjct: 70  PSPPPPSPPPPSPPP--PSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSP 127

Query: 195 YYHSPPPPKKPYYYHSPPPPVYSPPPPYHYS-----SPPPPP----KKPYYYHSPPPPVY 43
              SPPPP  P    SP PP   PPPP+  +     SPPPPP    + P    SPPPP  
Sbjct: 128 SPPSPPPPSPPPPSISPSPP--PPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSI 185

Query: 42  SPPPPYHYTSPPPP 1
           SP PP   +  PPP
Sbjct: 186 SPSPPSSASPTPPP 199

 Score = 79.0 bits (193), Expect = 3e-13
 Identities = 53/132 (40%), Positives = 55/132 (41%), Gaps = 12/132 (9%)
 Frame = -3

Query: 522 SSPPPPKVY---------PPVSPPPKVYPPVYSP---PPKVYPPVSPPPKVYPPVSPPYH 379
           S PPPP  +         PP  PPP    P  SP   PP + P  SPP    P   PP  
Sbjct: 145 SPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISP--SPPSSASPTPPPPSA 202

Query: 378 YSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPK 199
             SPPPP   PP  P     PPPP  SPP P    S  P P       SPPPP     P 
Sbjct: 203 SPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPP-----PP 257

Query: 198 PYYHSPPPPKKP 163
           P    PPPP  P
Sbjct: 258 P----PPPPGLP 265

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 45/103 (43%), Positives = 49/103 (47%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           PS+  +     S  PPP    P  PPP   PP  SPPP   PP  PPP   PP SPP   
Sbjct: 183 PSISPSPPSSASPTPPPPSASPSPPPPS--PPPPSPPP---PPPPPPP---PPPSPP--- 231

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKP 247
            SP PP  + P  P+  S   PP   PPPP     PPPPP  P
Sbjct: 232 -SPNPPPSASPSPPFGRSLRSPP---PPPP-----PPPPPGLP 265

[119][TOP]
>UniRef100_Q39866 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39866_SOYBN
          Length = 118

 Score =  149 bits (377), Expect = 1e-34
 Identities = 80/137 (58%), Positives = 81/137 (59%), Gaps = 10/137 (7%)
 Frame = -3

Query: 429 PVSPPPKVY---PPVS----PPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSS 271
           P  PPP VY   PP S    PPY Y SPPPP  SPP  PY Y SPPPP  SPPPPY Y S
Sbjct: 1   PSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPP-PPYVYKSPPPPSPSPPPPYVYKS 59

Query: 270 PPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSS 100
           PPPP   P  PY Y SPPPP           SP PP  PYYY SPPPP  SPPPPY+Y S
Sbjct: 60  PPPPSPSPPPPYVYKSPPPP-----------SPSPP-SPYYYKSPPPPSPSPPPPYYYKS 107

Query: 99  PPPPPKKPYYYHSPPPP 49
           PPPP        SPPPP
Sbjct: 108 PPPPSP------SPPPP 118

 Score =  146 bits (369), Expect = 1e-33
 Identities = 82/138 (59%), Positives = 82/138 (59%), Gaps = 3/138 (2%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP VY   SPPP    P  SPPP       PPP   PP  PPY Y SPPPP  SPP 
Sbjct: 2   SPPPPYVYK--SPPP----PSPSPPPPYIYKSPPPPSPSPP--PPYVYKSPPPPSPSPP- 52

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
            PY Y SPPPP  SPPPPY Y SPPPP   P  PY Y SPPPP    SP     SPPP  
Sbjct: 53  PPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPSPYYYKSPPPP----SP-----SPPP-- 101

Query: 168 KPYYYHSPPPPVYSPPPP 115
            PYYY SPPPP  SPPPP
Sbjct: 102 -PYYYKSPPPPSPSPPPP 118

 Score =  146 bits (369), Expect = 1e-33
 Identities = 71/115 (61%), Positives = 72/115 (62%), Gaps = 7/115 (6%)
 Frame = -3

Query: 324 SSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPK----KPYY 157
           S PPP VY  PPP    SP PPP  PY Y SPPPP     P   Y SPPPP      PY 
Sbjct: 2   SPPPPYVYKSPPP---PSPSPPP--PYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYV 56

Query: 156 YHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           Y SPPPP  SPPPPY Y SPPPP   P  PYYY SPPPP  SPPPPY+Y SPPPP
Sbjct: 57  YKSPPPPSPSPPPPYVYKSPPPPSPSPPSPYYYKSPPPPSPSPPPPYYYKSPPPP 111

 Score =  119 bits (297), Expect = 3e-25
 Identities = 63/116 (54%), Positives = 66/116 (56%), Gaps = 4/116 (3%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVY----PPVYSPPPKVYPPVSPPPKVYPPVSP 388
           PS      Y+Y SPPPP    P  PPP VY    PP  SPPP       PPP   PP  P
Sbjct: 15  PSPSPPPPYIYKSPPPPS---PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPP--P 69

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPP 220
           PY Y SPPPP  SPP  PY+Y SPPPP  SPPPPY+Y SPPPP        SPPPP
Sbjct: 70  PYVYKSPPPPSPSPPS-PYYYKSPPPPSPSPPPPYYYKSPPPPS------PSPPPP 118

 Score =  107 bits (267), Expect = 8e-22
 Identities = 59/94 (62%), Positives = 59/94 (62%), Gaps = 4/94 (4%)
 Frame = -3

Query: 270 PPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV-YSPPPPYHYSSPP 94
           P PPP  PY Y SPPPP    SP     SPPPP   Y Y SPPPP   SPPPPY Y SPP
Sbjct: 1   PSPPP--PYVYKSPPPP----SP-----SPPPP---YIYKSPPPPSP-SPPPPYVYKSPP 45

Query: 93  PP---PKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           PP   P  PY Y SPPPP  SPPPPY Y SPPPP
Sbjct: 46  PPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPP 79

[120][TOP]
>UniRef100_B9FLI1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9FLI1_ORYSJ
          Length = 518

 Score =  149 bits (377), Expect = 1e-34
 Identities = 85/142 (59%), Positives = 89/142 (62%), Gaps = 1/142 (0%)
 Frame = -3

Query: 423 SPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP-PKKP 247
           SPPP  +   SPP   +SPPPPVYSPP  P   S PPPPVYSPPPP   SSPPPP P  P
Sbjct: 99  SPPPPHHD--SPPPPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPV--SSPPPPVPSPP 154

Query: 246 YKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYY 67
              SSPPPP    SP P   SPPPP       SPPPPV SPPPP   SSPPPP       
Sbjct: 155 PPVSSPPPPVP--SPPPPVSSPPPPVS-----SPPPPVSSPPPPV--SSPPPPVS----- 200

Query: 66  HSPPPPVYSPPPPYHYTSPPPP 1
            SPPPPV+SPPPP   +SPPPP
Sbjct: 201 -SPPPPVHSPPPP--VSSPPPP 219

 Score =  149 bits (375), Expect = 2e-34
 Identities = 89/154 (57%), Positives = 89/154 (57%), Gaps = 1/154 (0%)
 Frame = -3

Query: 486 SPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPP 307
           SPPP   P   SPPP   P  SPPP VY P  PP   S PPPPVYSPP      SSPPPP
Sbjct: 99  SPPP---PHHDSPPP---PRASPPPPVYSPPPPPPRSSPPPPPVYSPPPP---VSSPPPP 149

Query: 306 VYSPPPPYHYSSPPPP-PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY 130
           V SPPPP   SSPPPP P  P   SSPPPP           SPPPP       SPPPPV 
Sbjct: 150 VPSPPPPV--SSPPPPVPSPPPPVSSPPPP---------VSSPPPP-----VSSPPPPVS 193

Query: 129 SPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPP 28
           SPPPP   SSPPPP       HSPPPPV SPPPP
Sbjct: 194 SPPPP--VSSPPPP------VHSPPPPVSSPPPP 219

 Score =  140 bits (352), Expect = 1e-31
 Identities = 90/170 (52%), Positives = 94/170 (55%), Gaps = 7/170 (4%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPV-SPPYHYSSPPPPVYS 349
           + SPPPP+  PP        PPVYSPPP   PP S PP   PPV SPP   SSPPPPV S
Sbjct: 105 HDSPPPPRASPP--------PPVYSPPPP--PPRSSPPP--PPVYSPPPPVSSPPPPVPS 152

Query: 348 PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
           PP      SSPPPPV SPPPP   SSPPPP       SSPPPP    SP P   SPPPP 
Sbjct: 153 PPPP---VSSPPPPVPSPPPP--VSSPPPP------VSSPPPPVS--SPPPPVSSPPPP- 198

Query: 168 KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYY------YHSPPPPVYSP 37
                 SPPPPV+SPPPP   SSPPPP     Y      Y +   P Y P
Sbjct: 199 ----VSSPPPPVHSPPPP--VSSPPPPASDVVYCTNTTRYPTCTSPAYCP 242

 Score =  114 bits (284), Expect = 8e-24
 Identities = 65/121 (53%), Positives = 68/121 (56%), Gaps = 11/121 (9%)
 Frame = -3

Query: 330 HYSSPPPPVYSPPPPYHYSSPPP---PPKKPYKYSSPPPPEHHVSPKPYYHSPPP--PKK 166
           H  SPPPP +  PPP   S PPP   PP  P + S PPPP +  SP P   SPPP  P  
Sbjct: 96  HEKSPPPPHHDSPPPPRASPPPPVYSPPPPPPRSSPPPPPVY--SPPPPVSSPPPPVPSP 153

Query: 165 PYYYHSPPPPVYSPPPPYH-----YSSPPPP-PKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
           P    SPPPPV SPPPP        SSPPPP    P    SPPPPV SPPPP H  SPPP
Sbjct: 154 PPPVSSPPPPVPSPPPPVSSPPPPVSSPPPPVSSPPPPVSSPPPPVSSPPPPVH--SPPP 211

Query: 3   P 1
           P
Sbjct: 212 P 212

 Score =  100 bits (248), Expect = 1e-19
 Identities = 68/126 (53%), Positives = 69/126 (54%), Gaps = 1/126 (0%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPV-SPPYHYSSPPPPVY 352
           +YS PPP      VS PP   PPV SPP    PPVS PP   PPV SPP   SSPPPPV 
Sbjct: 136 VYSPPPP------VSSPP---PPVPSPP----PPVSSPP---PPVPSPPPPVSSPPPPV- 178

Query: 351 SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPP 172
                    SSPPPPV SPPPP   SSPPPP       SSPPPP H  SP P   SPPPP
Sbjct: 179 ---------SSPPPPVSSPPPP--VSSPPPP------VSSPPPPVH--SPPPPVSSPPPP 219

Query: 171 KKPYYY 154
                Y
Sbjct: 220 ASDVVY 225

 Score = 87.8 bits (216), Expect = 6e-16
 Identities = 46/76 (60%), Positives = 50/76 (65%), Gaps = 3/76 (3%)
 Frame = -3

Query: 219 EHHVSPKPYYH-SPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPP--KKPYYYHSPPPP 49
           +H  SP P +H SPPPP+      SPPPPVYSPPPP   SSPPPPP    P    SPPPP
Sbjct: 95  KHEKSPPPPHHDSPPPPRA-----SPPPPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPP 149

Query: 48  VYSPPPPYHYTSPPPP 1
           V SPPPP   +SPPPP
Sbjct: 150 VPSPPPP--VSSPPPP 163

[121][TOP]
>UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1
            Tax=Ostreococcus tauri RepID=Q010M7_OSTTA
          Length = 1449

 Score =  148 bits (374), Expect = 3e-34
 Identities = 91/192 (47%), Positives = 93/192 (48%), Gaps = 19/192 (9%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPP--PKVYPPVSPPYHYSSPPPPVYSP 346
            SPPPP    P SPPP   PP   PPP   PP +PP  P   PP SPP   SSPPPP  SP
Sbjct: 790  SPPPPL---PPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSP 846

Query: 345  PKKPYHYSSPPPPVYSPP----------PPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
            P  P    SPPPP   PP          PP    SPPPPP  P   S PP P    S  P
Sbjct: 847  PPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNP 906

Query: 195  YYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSP------- 37
               SPPP   P    SPPPP  SPPPP    SPP PP  P   + PPPP  SP       
Sbjct: 907  PLSSPPPLSSPPPLSSPPPPS-SPPPP----SPPLPPSPPLPPNPPPPPSPSPXXXXXXX 961

Query: 36   PPPYHYTSPPPP 1
            PP     SPPPP
Sbjct: 962  PPRLPTPSPPPP 973

 Score =  140 bits (354), Expect = 6e-32
 Identities = 87/171 (50%), Positives = 92/171 (53%), Gaps = 6/171 (3%)
 Frame = -3

Query: 495  PPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSP 316
            PP SPPP + P    PPP   PP  PPP   PP +PP   S PPPP  SPP  P   SSP
Sbjct: 787  PPPSPPPPLPPS--PPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPP--SPPPPP---SSP 839

Query: 315  PPPVYSPPP-PYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPP 139
            PPP  SPPP P    SPPPPP  P   + PPPP    SP P   SPPPP  P     PPP
Sbjct: 840  PPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPP---SPPPPPSP-----PPP 891

Query: 138  PVYSPPPPYHYSSPPPPPKKPYYYHSP-----PPPVYSPPPPYHYTSPPPP 1
            P  SPPP     SP PPP       SP     PPP+ SPPPP   +SPPPP
Sbjct: 892  P--SPPP-----SPSPPPSSNPPLSSPPPLSSPPPLSSPPPP---SSPPPP 932

 Score =  137 bits (344), Expect = 9e-31
 Identities = 80/177 (45%), Positives = 84/177 (47%), Gaps = 3/177 (1%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP S PP   PP  SPPP   P  SPPP   PP +P     +PPPP   PP
Sbjct: 825  SPPPPPSPPPPPSSPP---PPSPSPPPSPPPAPSPPPPPNPPPAP-----TPPPPPSPPP 876

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P    SPPPP   PPPP    SP PPP      SSPPP    +S  P   SPPPP  P
Sbjct: 877  SPP---PSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPP----LSSPPPLSSPPPPSSP 929

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPP---PVYSPPPPYHYTSPPPP 1
                 PP P   P PP   + PPPP   P       P   P  SPPPP     PPPP
Sbjct: 930  ----PPPSPPLPPSPPLPPNPPPPPSPSPXXXXXXXPPRLPTPSPPPPSPPLPPPPP 982

 Score =  120 bits (300), Expect = 1e-25
 Identities = 76/164 (46%), Positives = 82/164 (50%), Gaps = 13/164 (7%)
 Frame = -3

Query: 453  SPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYS 274
            SPPP   PP+ P P   PP SPP     PPPP  SPP  P    +PP P   PPPP    
Sbjct: 786  SPPPSPPPPLPPSPP--PPPSPP-----PPPPPPSPPPPP----NPPTPPSPPPPP---- 830

Query: 273  SPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY-------SPPPP 115
            SPPPPP  P   S  PPP    +P     SPPPP  P    +PPPP         SPPPP
Sbjct: 831  SPPPPPSSPPPPSPSPPPSPPPAP-----SPPPPPNPPPAPTPPPPPSPPPSPPPSPPPP 885

Query: 114  YHYSSPPPPPKKPYYYHSPP---PPVYSPPP---PYHYTSPPPP 1
                SPPPPP  P     PP   PP+ SPPP   P   +SPPPP
Sbjct: 886  ---PSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPP 926

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 39/97 (40%), Positives = 42/97 (43%), Gaps = 24/97 (24%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPV--SPPPKVYPPV-------SPPYHYSS 370
            S PPPP   P  SPPP   PP+ SPPP   PP   SPPP   PP        SPP   + 
Sbjct: 887  SPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSPPLPPSPPLPPNP 946

Query: 369  PPPPVYSP---------------PKKPYHYSSPPPPV 304
            PPPP  SP               P  P     PPPP+
Sbjct: 947  PPPPSPSPXXXXXXXPPRLPTPSPPPPSPPLPPPPPL 983

[122][TOP]
>UniRef100_Q9ZQI0 Putative uncharacterized protein At2g27380 n=1 Tax=Arabidopsis
            thaliana RepID=Q9ZQI0_ARATH
          Length = 761

 Score =  147 bits (372), Expect = 5e-34
 Identities = 99/210 (47%), Positives = 99/210 (47%), Gaps = 38/210 (18%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPV--YSPPPKVYPPVSPPPKVY-PPVSPPYHYSSPPPPVYSP 346
            PP P   PPV PPP   PP   YSPP K  PPV PP   Y PPV PP     PP P YSP
Sbjct: 444  PPTPIYSPPVKPPPVHKPPTPTYSPPIKP-PPVKPPTPTYSPPVQPP-PVQKPPTPTYSP 501

Query: 345  PKKPYHYSSPPPPVYSPP-------PPYHYSSPP--PPP--KKPYKYSSPP--PPEHHVS 205
            P KP     PP P YSPP       PP    SPP  PPP  K P    SPP  PP  H  
Sbjct: 502  PVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKP 561

Query: 204  PKPYY---------HSPP-----PPKKPYYYHSPPPPVYSP---PPPYHYSSPP--PPPK 82
            P P Y         H PP     PP KP   H PP P YSP   PPP H    P   PP 
Sbjct: 562  PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPI 621

Query: 81   KPYYYHSPPPPVYSP---PPPYHYTSPPPP 1
            KP   H PP P YSP   PPP H   PP P
Sbjct: 622  KPPPVHKPPTPTYSPPIKPPPVH--KPPTP 649

 Score =  147 bits (371), Expect = 7e-34
 Identities = 96/228 (42%), Positives = 103/228 (45%), Gaps = 54/228 (23%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPP-----------PKVYPPVSPPP----------- 412
           Y++PPPP   PP+ PPP   PP YSPP           P   PP+ PPP           
Sbjct: 55  YTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSP 114

Query: 411 KVYPP---------VSPPYH---YSSPPPPVYSPPKKPYHYSSPPPPVYSPP---PPYH- 280
            +YPP          SPP +      PP P YSPP KP     PP P YSPP   PP H 
Sbjct: 115 PIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHK 174

Query: 279 -----YSSPPPPP--KKPYKYSSPP--PPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYS 127
                YS P  PP  K P    SPP  PP  H  P P Y    PP KP   H PP P YS
Sbjct: 175 PPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYS---PPIKPPPVHKPPTPTYS 231

Query: 126 P---PPPYHYSSPP--PPPKKPYYYHSPPPPVYSPP--PPYHYTSPPP 4
           P   PPP H    P   PP KP   H PP P+YSPP  PP   T P P
Sbjct: 232 PPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTP 279

 Score =  143 bits (361), Expect = 1e-32
 Identities = 92/200 (46%), Positives = 100/200 (50%), Gaps = 28/200 (14%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPV--YSPPPKVYPPVSPPPKVY-PPVSPPYHYSSPPPPVYSP 346
           PP P   PP+ PPP   PP   YSPP K  PPV PP  +Y PPV PP  +  PP P+YSP
Sbjct: 310 PPTPTYSPPIKPPPVQKPPTPTYSPPIKP-PPVKPPTPIYSPPVKPPPVHK-PPTPIYSP 367

Query: 345 PKKPYHYSSPPPPVYSPP--PPYHYSSPPP---PPKKPYKYSSPPPPEHHVSPKPYYHSP 181
           P KP     PP P+YSPP  PP     P P   PP KP     PP P +    K     P
Sbjct: 368 PVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKP 427

Query: 180 P-----PPKKPYYYHSPPPPVYSP---PPPYH------YSSP--PPPPKKPYYYHSP--- 58
           P     PP KP   H PP P+YSP   PPP H      YS P  PPP K P   +SP   
Sbjct: 428 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQ 487

Query: 57  PPPVYSPP-PPYHYTSPPPP 1
           PPPV  PP P Y     PPP
Sbjct: 488 PPPVQKPPTPTYSPPVKPPP 507

 Score =  143 bits (360), Expect = 1e-32
 Identities = 89/213 (41%), Positives = 98/213 (46%), Gaps = 28/213 (13%)
 Frame = -3

Query: 555 PSLISANSYLYSSP-------PPPKVYPPVSPPPKVYPPVYSPPPKVYPP---VSPPPKV 406
           PS  +    +YS P        PP   PP+ PPP   PP  +  P +YPP     P P  
Sbjct: 53  PSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTY 112

Query: 405 YPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPP--PPYHYSSPPP---PPKKPYK 241
            PP+ PP     PP P YSPP  P     PP P YSPP  PP     P P   PP KP  
Sbjct: 113 SPPIYPP-PIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPP 171

Query: 240 YSSPPPPEHHVSPKPYYHSPP-----PPKKPYYYHSPPPPVYSP---PPPYHYSSPP--P 91
              PP P +    KP  H PP     PP KP   H PP P+YSP   PPP H    P   
Sbjct: 172 VHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYS 231

Query: 90  PPKKPYYYHSPPPPVYSP---PPPYHYTSPPPP 1
           PP KP   H PP P+YSP   PPP H   PP P
Sbjct: 232 PPVKPPPVHKPPTPIYSPPIKPPPVH--KPPTP 262

 Score =  142 bits (359), Expect = 2e-32
 Identities = 94/209 (44%), Positives = 96/209 (45%), Gaps = 37/209 (17%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPP--VYSPPPKVYPPVSPPPKVY------PPVSPPYHYSSP-- 367
            PP P   PPV PPP   PP  +YSPP K  P   PP   Y      PPV PP    SP  
Sbjct: 427  PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPV 486

Query: 366  -PPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSP--PPPPKKPYKYSSPP--PPEHHVSP 202
             PPPV  PP   Y     PPP+  PP P  YS P  PPP K P    SPP  PP  H  P
Sbjct: 487  QPPPVQKPPTPTYSPPVKPPPIQKPPTP-TYSPPIKPPPVKPPTPTYSPPIKPPPVHKPP 545

Query: 201  KPYY---------HSPP-----PPKKPYYYHSPPPPVYSP---PPPYHYSSPP--PPPKK 79
             P Y         H PP     PP KP   H PP P YSP   PPP H    P   PP K
Sbjct: 546  TPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIK 605

Query: 78   PYYYHSPPPPVYSP---PPPYHYTSPPPP 1
            P   H PP P YSP   PPP H   PP P
Sbjct: 606  PPPVHKPPTPTYSPPIKPPPVH--KPPTP 632

 Score =  142 bits (358), Expect = 2e-32
 Identities = 88/193 (45%), Positives = 94/193 (48%), Gaps = 21/193 (10%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPP--VYSPPPKVYPPVSPPPKVY-PPVSPPYHYSSPPPPVYSP 346
           PP P   PP+ PPP   PP  +YSPP K  P  +PP  +Y PPV PP  +  PP P YSP
Sbjct: 242 PPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHK-PPTPTYSP 300

Query: 345 PKKPYHYSSPPPPVYSPP---PPYH------YSSP--PPPPKKPYKYSSPP--PPEHHVS 205
           P K      PP P YSPP   PP        YS P  PPP K P    SPP  PP  H  
Sbjct: 301 PVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKP 360

Query: 204 PKPYYHSPPPPKKPYYYHSPPPPVYSPP--PPYHYSSPPP---PPKKPYYYHSPPPPVYS 40
           P P Y    PP KP   H PP P+YSPP  PP     P P   PP KP     PP P YS
Sbjct: 361 PTPIYS---PPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYS 417

Query: 39  PPPPYHYTSPPPP 1
           PP       PP P
Sbjct: 418 PPIKLPPVKPPTP 430

 Score =  142 bits (357), Expect = 3e-32
 Identities = 92/213 (43%), Positives = 98/213 (46%), Gaps = 41/213 (19%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPP-------KVYPPVYSPP------PKVYPPVSPP-------PKVYPP 397
           PP P   PP+ PPP          PP+Y PP      P   PP+ PP       P   PP
Sbjct: 90  PPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPP 149

Query: 396 VSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPP--PPYH------YS---SPPPPPKK 250
           V PP     PP P YSPP KP     PP P YSPP  PP H      YS    PPP  K 
Sbjct: 150 VKPP-PVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKP 208

Query: 249 PYKYSSPP--PPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSP---PPPYHYSSPP--P 91
           P    SPP  PP  H  P P Y    PP KP   H PP P+YSP   PPP H    P   
Sbjct: 209 PTPIYSPPIKPPPVHKPPTPTY---SPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYS 265

Query: 90  PPKKPYYYHSPPPPVYSP---PPPYHYTSPPPP 1
           PP KP    +PP P+YSP   PPP H   PP P
Sbjct: 266 PPVKPPPVQTPPTPIYSPPVKPPPVH--KPPTP 296

 Score =  142 bits (357), Expect = 3e-32
 Identities = 86/191 (45%), Positives = 92/191 (48%), Gaps = 19/191 (9%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPP--VYSPPPKVYPPVSPPPKVY-PPVSPPYHYSSPPPPVYSP 346
           PP P   PPV PPP   PP  +YSPP K  P   PP  +Y PPV PP    +PP P+YSP
Sbjct: 225 PPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPP-PVQTPPTPIYSP 283

Query: 345 PKKPYHYSSPPPPVYSPP---PPYHYSSPPP--PPKKPYKYSSPPPPEHHVSPKPYYHSP 181
           P KP     PP P YSPP   PP      P   PP KP     PP P +    KP    P
Sbjct: 284 PVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKP 343

Query: 180 P-----PPKKPYYYHSPPPPVYSP---PPPYHYSSPP--PPPKKPYYYHSPPPPVYSPP- 34
           P     PP KP   H PP P+YSP   PPP H    P   PP KP     PP P YSPP 
Sbjct: 344 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPI 403

Query: 33  PPYHYTSPPPP 1
            P     PP P
Sbjct: 404 KPPPLQKPPTP 414

 Score =  142 bits (357), Expect = 3e-32
 Identities = 92/202 (45%), Positives = 99/202 (49%), Gaps = 30/202 (14%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYP-PVYSPPPKVYPPVSPPPKVY-PPVSPPYHYSSPPPPVYSPP 343
           PP P   PP+ PPP   P P+YSPP K  P   PP  +Y PPV PP  +  PP P+YSPP
Sbjct: 327 PPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHK-PPTPIYSPP 385

Query: 342 KKPYHYSSPPPPVYSPP--------PPYHYSSPP---PPPKKPYKYSSPP--PPEHHVSP 202
            KP     PP P YSPP        PP    SPP   PP K P    SPP  PP  H  P
Sbjct: 386 VKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPP 445

Query: 201 KPYYHSPPPPKKPYYYHSPPPPVYSPP-------PPYHYSSPP--PPP--KKPYYYHSP- 58
            P Y    PP KP   H PP P YSPP       PP    SPP  PPP  K P   +SP 
Sbjct: 446 TPIYS---PPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPP 502

Query: 57  --PPPVYSPP-PPYHYTSPPPP 1
             PPP+  PP P Y     PPP
Sbjct: 503 VKPPPIQKPPTPTYSPPIKPPP 524

 Score =  140 bits (354), Expect = 6e-32
 Identities = 90/209 (43%), Positives = 96/209 (45%), Gaps = 37/209 (17%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPV--YSPPPKVYPPVSPPPKVY-PPVSPPYHYSSPPPPVYSP 346
            PP P   PP+ PPP   PP   YSPP K+ PPV PP  +Y PPV PP  +  PP P+YSP
Sbjct: 394  PPTPTYSPPIKPPPLQKPPTPTYSPPIKL-PPVKPPTPIYSPPVKPPPVHK-PPTPIYSP 451

Query: 345  PKKPYHYSSPPPPVYS----------PPPPYHYSSPPP-----------PPKKPYKYSSP 229
            P KP     PP P YS          P P Y     PP           PP KP     P
Sbjct: 452  PVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKP 511

Query: 228  PPPEHHVSPKPYYHSPP-----PPKKPYYYHSPPPPVYSP---PPPYHYSSPP--PPPKK 79
            P P +    KP    PP     PP KP   H PP P YSP   PPP H    P   PP K
Sbjct: 512  PTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIK 571

Query: 78   PYYYHSPPPPVYSP---PPPYHYTSPPPP 1
            P   H PP P YSP   PPP H   PP P
Sbjct: 572  PPPVHKPPTPTYSPPIKPPPVH--KPPTP 598

 Score =  139 bits (351), Expect = 1e-31
 Identities = 91/227 (40%), Positives = 101/227 (44%), Gaps = 55/227 (24%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPP-----------KVYPPVYSPPPKVY-PPVSPPPKVYPPVS------ 391
           PP P   PP+ PPP            + PPV+ PP  +Y PP+ PPP   PP        
Sbjct: 158 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPI 217

Query: 390 --PPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSP---PPPYHYSSPP--PPPKKPYKYSS 232
             PP H   PP P YSPP KP     PP P+YSP   PPP H    P   PP KP    +
Sbjct: 218 KPPPVH--KPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQT 275

Query: 231 PP---------PPEHHVSPKPYY----HSPPPPKKPYYYHSP---PPPVYSPPPPYHYS- 103
           PP         PP  H  P P Y     SPP  K P   +SP   PPPV  PP P +   
Sbjct: 276 PPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPP 335

Query: 102 -SPPP---------PPKKPYYYHSPPPPVYSP---PPPYHYTSPPPP 1
             PPP         PP KP   H PP P+YSP   PPP H   PP P
Sbjct: 336 IKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVH--KPPTP 380

 Score =  139 bits (349), Expect = 2e-31
 Identities = 86/193 (44%), Positives = 90/193 (46%), Gaps = 21/193 (10%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPV--YSPPPKVYPPVSPPPKVY------PPVSPPYHYSSP-- 367
            PP P   PPV PPP   PP   YSPP K  P   PP   Y      PPV PP    SP  
Sbjct: 477  PPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPI 536

Query: 366  -PPPVYSPPKKPYHYSSPPPPVYSPPPPYHYS--SPPPPPKKPYKYSSPP--PPEHHVSP 202
             PPPV+ PP   Y     PPP++ PP P +     PPP  K P    SPP  PP  H  P
Sbjct: 537  KPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 596

Query: 201  KPYYHSPPPPKKPYYYHSPPPPVYSP---PPPYHYSSPP--PPPKKPYYYHSPPPPVYSP 37
             P Y    PP KP   H PP P YSP   PPP H    P   PP KP   H PP P YSP
Sbjct: 597  TPTY---SPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSP 653

Query: 36   P-PPYHYTSPPPP 1
            P  P     PP P
Sbjct: 654  PIKPPPVQKPPTP 666

 Score =  137 bits (344), Expect = 9e-31
 Identities = 91/196 (46%), Positives = 95/196 (48%), Gaps = 24/196 (12%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPV--YSPPPKVYPPVSPPPKVYPPVSPPYHYS--SPPPPVYS 349
           PP P   PPV PPP   PP   YSPP K  PP+  PP   P  SPP       PP P+YS
Sbjct: 377 PPTPIYSPPVKPPPIQKPPTPTYSPPIKP-PPLQKPPT--PTYSPPIKLPPVKPPTPIYS 433

Query: 348 PPKKPYHYSSPPPPVYSP---PPPYH------YSSP--PPPPKKPYKYSSPP--PPEHHV 208
           PP KP     PP P+YSP   PPP H      YS P  PPP K P    SPP  PP    
Sbjct: 434 PPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQK 493

Query: 207 SPKPYYHSPPPPKKPYYYHSPPPPVYSP---PPPYHYSSPP-PPPKKPYYYHSPPPPVYS 40
            P P Y    PP KP     PP P YSP   PPP    +P   PP KP   H PP P YS
Sbjct: 494 PPTPTY---SPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYS 550

Query: 39  P---PPPYHYTSPPPP 1
           P   PPP H   PP P
Sbjct: 551 PPIKPPPIH--KPPTP 564

 Score =  134 bits (337), Expect = 6e-30
 Identities = 88/202 (43%), Positives = 95/202 (47%), Gaps = 30/202 (14%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPV--YSPPPKVYPPVSPPPKVY------PPVSPPYHYSSPPP 361
           PP P   PP+ PPP   PP   YSPP K  P   PP  +Y      PPV        PP 
Sbjct: 208 PPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPV------HKPPT 261

Query: 360 PVYSPPKKPYHYSSPPPPVYSP---PPPYH------YSSP---PPPPKKPYKYSSPP--P 223
           P+YSPP KP    +PP P+YSP   PPP H      YS P   PP  K P    SPP  P
Sbjct: 262 PIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKP 321

Query: 222 PEHHVSPKPYYHSP--PPPKKPYYYHSPPPPVYSP---PPPYHYSSPP--PPPKKPYYYH 64
           P     P P Y  P  PPP K      PP P+YSP   PPP H    P   PP KP   H
Sbjct: 322 PPVQKPPTPTYSPPIKPPPVK------PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVH 375

Query: 63  SPPPPVYSPP-PPYHYTSPPPP 1
            PP P+YSPP  P     PP P
Sbjct: 376 KPPTPIYSPPVKPPPIQKPPTP 397

 Score =  130 bits (327), Expect = 9e-29
 Identities = 88/200 (44%), Positives = 94/200 (47%), Gaps = 30/200 (15%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPV--YSPPPKVYPPVSPPPKVY-PPVSPPYHYSSPPPPVYSP 346
            PP P   PP+ PPP   PP   YSPP K  P   PP   Y PP+ PP  +  PP P YSP
Sbjct: 561  PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHK-PPTPTYSP 619

Query: 345  PKKPYHYSSPPPPVYSPP---PPYH------YS---SPPPPPKKPYKYSSPP--PPEHHV 208
            P KP     PP P YSPP   PP H      YS    PPP  K P    SPP  PP   +
Sbjct: 620  PIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQL 679

Query: 207  SPKPYYHSPPPPKKPYYYHSPPPPVYSPP---PPYH------YSSP--PPPPKKPYYYHS 61
             P P Y    PP KP     PP P YSPP   PP        YS P  PPP + P    +
Sbjct: 680  PPTPTYS---PPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTT 736

Query: 60   PPPPV--YSPPPPYHYTSPP 7
            P PP   Y  PPPY Y S P
Sbjct: 737  PSPPQGGYGTPPPYAYLSHP 756

 Score =  129 bits (323), Expect = 3e-28
 Identities = 84/184 (45%), Positives = 86/184 (46%), Gaps = 13/184 (7%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPV--YSPPPKVYPPV--SPPPKVYPPVSPPYHYSSPPPPVYS 349
            PP P   PP+ PPP   PP   YSPP K  PPV   P P   PP+ PP     PP P YS
Sbjct: 544  PPTPTYSPPIKPPPIHKPPTPTYSPPIKP-PPVHKPPTPTYSPPIKPP-PVHKPPTPTYS 601

Query: 348  PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPP--PPEHHVSPKPYYHSPPP 175
            PP KP     PP P YSPP       PPP  K P    SPP  PP  H  P P Y    P
Sbjct: 602  PPIKPPPVHKPPTPTYSPP-----IKPPPVHKPPTPTYSPPIKPPPVHKPPTPTY---SP 653

Query: 174  PKKPYYYHSPPPPVYSPP--PPYHYSSPPP---PPKKPYYYHSPPPPVYSPP--PPYHYT 16
            P KP     PP P YSPP  PP     P P   PP KP     PP P YSPP  PP    
Sbjct: 654  PIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQV 713

Query: 15   SPPP 4
             P P
Sbjct: 714  PPTP 717

 Score =  127 bits (320), Expect = 6e-28
 Identities = 78/186 (41%), Positives = 88/186 (47%), Gaps = 14/186 (7%)
 Frame = -3

Query: 519  SPP--PPKVYPPVSP---PPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPV 355
            SPP  PP V+ P +P   PP   PPV+ PP   Y P   PP V+ P +P Y     PPPV
Sbjct: 567  SPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPV 626

Query: 354  YSPPKKPYHYSSPPPPVYSPPPPYHYS--SPPPPPKKPYKYSSPP--PPEHHVSPKPYYH 187
            + PP   Y     PPPV+ PP P +     PPP  K P    SPP  PP   + P P Y 
Sbjct: 627  HKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTY- 685

Query: 186  SPPPPKKPYYYHSPPPPVYSPP--PPYHYSSPPP---PPKKPYYYHSPPPPVYSPPPPYH 22
               PP KP     PP P YSPP  PP     P P   PP KP     PP P    PP   
Sbjct: 686  --SPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGG 743

Query: 21   YTSPPP 4
            Y +PPP
Sbjct: 744  YGTPPP 749

 Score =  127 bits (319), Expect = 7e-28
 Identities = 83/188 (44%), Positives = 87/188 (46%), Gaps = 17/188 (9%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPV--YSPP---PKVYPPVSP---PPKVYPPVSPPYHYSSPPP 361
            PP P   PP+ PPP   PP   YSPP   P ++ P +P   PP   PPV        PP 
Sbjct: 527  PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPV------HKPPT 580

Query: 360  PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPP--PPEHHVSPKPYYH 187
            P YSPP KP     PP P YSPP       PPP  K P    SPP  PP  H  P P Y 
Sbjct: 581  PTYSPPIKPPPVHKPPTPTYSPP-----IKPPPVHKPPTPTYSPPIKPPPVHKPPTPTY- 634

Query: 186  SPPPPKKPYYYHSPPPPVYSPP--PPYHYSSPPP---PPKKPYYYHSPPPPVYSPP--PP 28
               PP KP   H PP P YSPP  PP     P P   PP KP     PP P YSPP  PP
Sbjct: 635  --SPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPP 692

Query: 27   YHYTSPPP 4
                 P P
Sbjct: 693  PVQVPPTP 700

 Score =  127 bits (319), Expect = 7e-28
 Identities = 81/194 (41%), Positives = 91/194 (46%), Gaps = 21/194 (10%)
 Frame = -3

Query: 519  SPP--PPKVYPPVSP---PPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPV 355
            SPP  PP ++ P +P   PP   PPV+ PP   Y P   PP V+ P +P Y     PPPV
Sbjct: 550  SPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPV 609

Query: 354  YSPPKKPYHYSSPPPPVYSPPPPYHYS--SPPPPPKKPYKYSSPP--PPEHHVSPKPYYH 187
            + PP   Y     PPPV+ PP P +     PPP  K P    SPP  PP     P P Y 
Sbjct: 610  HKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTY- 668

Query: 186  SPPPPKKPYYYHSPPPPVYSPP--PPYHYSSPPP---PPKKPYYYHSPPPPVYSP---PP 31
               PP KP     PP P YSPP  PP     P P   PP KP     PP P YSP   PP
Sbjct: 669  --SPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPP 726

Query: 30   PYHY----TSPPPP 1
            P       T+P PP
Sbjct: 727  PVQVPPTPTTPSPP 740

 Score = 67.4 bits (163), Expect = 9e-10
 Identities = 43/102 (42%), Positives = 54/102 (52%), Gaps = 9/102 (8%)
 Frame = -3

Query: 279 YSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSP--PPPVYSPPPPYHY 106
           ++ PPP    P  Y++PPPP +  SP  Y   PPP +KP  Y  P  PPP+  PP P + 
Sbjct: 42  HAHPPPIYGAPPSYTTPPPPIY--SPPIY---PPPIQKPPTYSPPIYPPPIQKPPTPTYS 96

Query: 105 SS--PPPPPKKPYYYHSP---PPPVYSPPPPYHYTSP--PPP 1
               PPP  K P   +SP   PPP+  PP P  Y+ P  PPP
Sbjct: 97  PPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP-TYSPPIYPPP 137

[123][TOP]
>UniRef100_C6TK91 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TK91_SOYBN
          Length = 146

 Score =  147 bits (372), Expect = 5e-34
 Identities = 77/143 (53%), Positives = 84/143 (58%), Gaps = 3/143 (2%)
 Frame = -3

Query: 462 PVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPY 283
           P Y  P   YP  +PP   Y  ++PPY+Y SPP          Y+Y SPPPP  SPPPPY
Sbjct: 28  PYYGQPSNYYPHPTPP--TYRQINPPYYYKSPP----------YYYKSPPPPSPSPPPPY 75

Query: 282 HYSSPPPP---PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPY 112
            Y SPPPP   P  PY Y SPPPP    SP     SPPPP  PY Y SPPPP  SP PP 
Sbjct: 76  VYKSPPPPSPSPPPPYIYKSPPPP----SP-----SPPPPS-PYVYKSPPPPSPSPSPPP 125

Query: 111 HYSSPPPPPKKPYYYHSPPPPVY 43
            +S  PPPP  PY Y+SPPPPVY
Sbjct: 126 SHS--PPPPHHPYLYNSPPPPVY 146

 Score =  129 bits (323), Expect = 3e-28
 Identities = 73/156 (46%), Positives = 83/156 (53%), Gaps = 4/156 (2%)
 Frame = -3

Query: 585 LLVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPP--KVYPPVYSPPPKVYPPVSPPP 412
           L++AL    +   ++A+   Y   P    YP  +PP   ++ PP Y   P  Y    PPP
Sbjct: 9   LIIALAFCLMSMSVAADDKPYYGQPS-NYYPHPTPPTYRQINPPYYYKSPPYYYKSPPPP 67

Query: 411 KVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPP--YHYSSPPPPPKKPYKY 238
              PP  PPY Y SPPPP  SPP  PY Y SPPPP  SPPPP  Y Y SPPPP   P   
Sbjct: 68  SPSPP--PPYVYKSPPPPSPSPPP-PYIYKSPPPPSPSPPPPSPYVYKSPPPPSPSP--- 121

Query: 237 SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY 130
            SPPP           HSPPPP  PY Y+SPPPPVY
Sbjct: 122 -SPPPS----------HSPPPPHHPYLYNSPPPPVY 146

 Score = 80.9 bits (198), Expect = 8e-14
 Identities = 41/81 (50%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = -3

Query: 240 YSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHS 61
           Y  P PP +     PYY+  PP    YYY SPPPP  SPPPPY Y SPPPP         
Sbjct: 37  YPHPTPPTYRQINPPYYYKSPP----YYYKSPPPPSPSPPPPYVYKSPPPPS-------- 84

Query: 60  PPPPVY-SPPPPYHYTSPPPP 1
                  SPPPPY Y SPPPP
Sbjct: 85  ------PSPPPPYIYKSPPPP 99

[124][TOP]
>UniRef100_UPI0000E125D3 Os05g0552600 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000E125D3
          Length = 510

 Score =  147 bits (371), Expect = 7e-34
 Identities = 91/175 (52%), Positives = 95/175 (54%), Gaps = 2/175 (1%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP    P  PPP+      SPPP VY P  PPP+  PP  P Y   SPPPPV SPP 
Sbjct: 68  SPPPPHHDSP--PPPRA-----SPPPPVYSPPPPPPRSSPPPPPVY---SPPPPVSSPPP 117

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
                 SPPPPV SPPPP    SPPPP       +SPPP     SP P   SPPPP    
Sbjct: 118 P---VPSPPPPVSSPPPPV--PSPPPPVP-----TSPPP-----SPLP---SPPPPVP-- 157

Query: 159 YYHSPPPPVYSPPPPYHYSSPPP--PPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPPV SPPPP   S PPP  P   P    SPPPPV + PPP    SPPPP
Sbjct: 158 --SSPPPPVSSPPPPVPSSPPPPVVPSPPPPVLSSPPPPVVASPPPPVVPSPPPP 210

 Score =  135 bits (339), Expect = 4e-30
 Identities = 84/156 (53%), Positives = 88/156 (56%), Gaps = 4/156 (2%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPP---VYSPPPKVYPPVSPPPKVYPPV-SPPYHYSSPPPPV 355
           +SPPPP VY P  PPP+  PP   VYSPPP    PVS PP   PPV SPP   SSPPPPV
Sbjct: 82  ASPPPP-VYSPPPPPPRSSPPPPPVYSPPP----PVSSPP---PPVPSPPPPVSSPPPPV 133

Query: 354 YSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPP 175
            SPP  P   S PP P+ SPPPP   SSPPPP       SSPPPP     P P   SPPP
Sbjct: 134 PSPPP-PVPTSPPPSPLPSPPPPVP-SSPPPP------VSSPPPPVPSSPPPPVVPSPPP 185

Query: 174 PKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYY 67
           P       SPPPPV + PPP    SPPPP      Y
Sbjct: 186 P----VLSSPPPPVVASPPPPVVPSPPPPGASDVVY 217

 Score =  129 bits (323), Expect = 3e-28
 Identities = 74/132 (56%), Positives = 77/132 (58%), Gaps = 5/132 (3%)
 Frame = -3

Query: 381 HYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSP 202
           H  SPPPP +  P  P   +SPPPPVYSPPPP   SSPPPPP     YS PPP     SP
Sbjct: 65  HEKSPPPPHHDSPPPP--RASPPPPVYSPPPPPPRSSPPPPP----VYSPPPPVS---SP 115

Query: 201 KPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPP-----PPPKKPYYYHSPPPPVYSP 37
            P   SPPPP       SPPPPV SPPPP   S PP     PPP  P    SPPPPV SP
Sbjct: 116 PPPVPSPPPP-----VSSPPPPVPSPPPPVPTSPPPSPLPSPPPPVP---SSPPPPVSSP 167

Query: 36  PPPYHYTSPPPP 1
           PPP   +SPPPP
Sbjct: 168 PPPVP-SSPPPP 178

 Score = 87.8 bits (216), Expect = 6e-16
 Identities = 46/76 (60%), Positives = 50/76 (65%), Gaps = 3/76 (3%)
 Frame = -3

Query: 219 EHHVSPKPYYH-SPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPP--KKPYYYHSPPPP 49
           +H  SP P +H SPPPP+      SPPPPVYSPPPP   SSPPPPP    P    SPPPP
Sbjct: 64  KHEKSPPPPHHDSPPPPRA-----SPPPPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPP 118

Query: 48  VYSPPPPYHYTSPPPP 1
           V SPPPP   +SPPPP
Sbjct: 119 VPSPPPP--VSSPPPP 132

[125][TOP]
>UniRef100_Q9FUR7 ENOD2 (Fragment) n=1 Tax=Styphnolobium japonicum RepID=Q9FUR7_SOPJA
          Length = 269

 Score =  146 bits (368), Expect = 2e-33
 Identities = 90/203 (44%), Positives = 96/203 (47%), Gaps = 33/203 (16%)
 Frame = -3

Query: 513 PPPKVYPP--VSPPPKVYPPVYSPPPKVY--PPVSPPPKVY--------PPVSPPYHYSS 370
           PPP   PP  V PPP   PP +  PP  Y  PP   PP  Y        PPV PP H+  
Sbjct: 65  PPPAYQPPPHVKPPPVYQPPHHEKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPHHEK 124

Query: 369 PPPPVYSPP--KKPYHYSSPP----PPVYSPPPPYHYSSPPPPPKKPYKYSSPPP---PE 217
           PPP    PP  K P  Y  PP    PPVY PPP   +  PPP  + P  +  PPP   P 
Sbjct: 125 PPPVHQPPPHEKPPPEYQPPPHVKPPPVYQPPP---HVKPPPVYQPPPHHEIPPPEYQPP 181

Query: 216 HHVSPKPYYHSPPPPKKPYYYHSP----PPPVYSPP----PPYHYSSPPPPPKKPYYY-- 67
           HHV P P Y  PP  K P  Y  P    PPPVY PP    PP  Y  PPP  K P  Y  
Sbjct: 182 HHVKPPPVYQPPPHEKPPPVYQPPHHEIPPPVYPPPRENKPPPEYQ-PPPHVKPPPAYQP 240

Query: 66  --HSPPPPVYSPPPPYHYTSPPP 4
             H  PPPVY PP   H+  PPP
Sbjct: 241 PPHEKPPPVYPPP---HHEKPPP 260

 Score =  143 bits (361), Expect = 1e-32
 Identities = 88/203 (43%), Positives = 98/203 (48%), Gaps = 34/203 (16%)
 Frame = -3

Query: 510 PPKVYPPVSP--PPKVYP-PVYSPPPKVYPPV--SPPPKVYPP--VSPPYHYSSPP---- 364
           PP  YPP     PP VYP P   PPP+  PP    PPP+  PP  V PP  Y  PP    
Sbjct: 18  PPPAYPPPHHEIPPPVYPSPHEKPPPEYQPPPHEKPPPEYQPPPHVKPPPAYQPPPHVKP 77

Query: 363 PPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPP--PPEHHVSPKPYY 190
           PPVY PP    H+  PPP  Y PPP   +  PPP  + P+    PP  PP HH  P P +
Sbjct: 78  PPVYQPP----HHEKPPPE-YQPPP---HEKPPPEYQPPHHVKPPPVYPPPHHEKPPPVH 129

Query: 189 HSPPPPKKPYYYHSP----PPPVYSPP----PPYHYSSPP----PPPKKPYYYHSPPPPV 46
             PP  K P  Y  P    PPPVY PP    PP  Y  PP    PPP+    +H  PPPV
Sbjct: 130 QPPPHEKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHHEIPPPEYQPPHHVKPPPV 189

Query: 45  YSPPP---------PYHYTSPPP 4
           Y PPP         P H+  PPP
Sbjct: 190 YQPPPHEKPPPVYQPPHHEIPPP 212

 Score =  115 bits (289), Expect = 2e-24
 Identities = 77/195 (39%), Positives = 84/195 (43%), Gaps = 33/195 (16%)
 Frame = -3

Query: 489 VSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPP 310
           V PPP   PP +  PP  YPP  P  ++ PPV P  H    PPP Y PP         PP
Sbjct: 4   VKPPPVYQPPHHEKPPPAYPP--PHHEIPPPVYPSPH--EKPPPEYQPPPH-----EKPP 54

Query: 309 PVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYY----HSPPPPKKPYYYHSPP 142
           P Y PPP   +  PPP       Y  PP    HV P P Y    H  PPP+     H  P
Sbjct: 55  PEYQPPP---HVKPPPA------YQPPP----HVKPPPVYQPPHHEKPPPEYQPPPHEKP 101

Query: 141 PPVYSPP---------PPYHYSSPPP---PP---KKPYYYHSP----PPPVYSPP----- 34
           PP Y PP         PP H+  PPP   PP   K P  Y  P    PPPVY PP     
Sbjct: 102 PPEYQPPHHVKPPPVYPPPHHEKPPPVHQPPPHEKPPPEYQPPPHVKPPPVYQPPPHVKP 161

Query: 33  -----PPYHYTSPPP 4
                PP H+  PPP
Sbjct: 162 PPVYQPPPHHEIPPP 176

 Score =  110 bits (275), Expect = 9e-23
 Identities = 72/164 (43%), Positives = 81/164 (49%), Gaps = 14/164 (8%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPP--VSPPP--KVYPP-VSPPYHYSSPPP 361
           +  PPP    PP   P    PPVY PPP V PP    PPP  ++ PP   PP+H    PP
Sbjct: 134 HEKPPPEYQPPPHVKP----PPVYQPPPHVKPPPVYQPPPHHEIPPPEYQPPHHVK--PP 187

Query: 360 PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPP--PPKKPYKYSSPPPPEH----HVSPK 199
           PVY PP         PPPVY PP   H+  PPP  PP +  K    PPPE+    HV P 
Sbjct: 188 PVYQPPP-----HEKPPPVYQPP---HHEIPPPVYPPPRENK----PPPEYQPPPHVKPP 235

Query: 198 PYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSP---PPPPKKP 76
           P Y  PP        H  PPPVY  PPP+H   P   PPP +KP
Sbjct: 236 PAYQPPP--------HEKPPPVY--PPPHHEKPPPAYPPPHEKP 269

 Score = 95.1 bits (235), Expect = 4e-18
 Identities = 56/140 (40%), Positives = 64/140 (45%), Gaps = 12/140 (8%)
 Frame = -3

Query: 387 PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPP---PE 217
           P+H    PPPVY PP    H+  PPP     PPP+H     PPP  P  +  PPP   P 
Sbjct: 1   PHHVK--PPPVYQPP----HHEKPPPAY---PPPHHEI---PPPVYPSPHEKPPPEYQPP 48

Query: 216 HHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSP 37
            H  P P Y  PP        H  PPP Y PPP   +  PPP  + P+  H  PPP Y P
Sbjct: 49  PHEKPPPEYQPPP--------HVKPPPAYQPPP---HVKPPPVYQPPH--HEKPPPEYQP 95

Query: 36  PP---------PYHYTSPPP 4
           PP         P H+  PPP
Sbjct: 96  PPHEKPPPEYQPPHHVKPPP 115

[126][TOP]
>UniRef100_Q94ES4 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES4_PEA
          Length = 120

 Score =  146 bits (368), Expect = 2e-33
 Identities = 74/129 (57%), Positives = 81/129 (62%), Gaps = 12/129 (9%)
 Frame = -3

Query: 351 SPPKKPYHYSSPPPP-VYSPPPPYH-YSSPPPPPKKPYKYSSPPPPEHHVSPKPY--YHS 184
           +P KKPY Y SPPPP V++ P P+  Y SPPPP KKPYKYSSPPPP  H  P P+  YHS
Sbjct: 1   TPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHS 60

Query: 183 PPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPY-------YYHSPPPPVYSPPPP- 28
           PPPP  P+              PY Y SPPPPP   Y        YHSPPPPVYSPPPP 
Sbjct: 61  PPPPPTPH------------KKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVYSPPPPA 108

Query: 27  YHYTSPPPP 1
           Y+Y SPPPP
Sbjct: 109 YYYKSPPPP 117

 Score =  132 bits (332), Expect = 2e-29
 Identities = 76/134 (56%), Positives = 81/134 (60%), Gaps = 7/134 (5%)
 Frame = -3

Query: 444 PKVYPPVSPPP-KVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPP-VYSPPPPYH-YS 274
           P  YP   PPP   YP   P YH  SPPPP     KKPY YSSPPPP V++ P P+  Y 
Sbjct: 6   PYKYPSPPPPPVHTYPHPHPVYH--SPPPP----HKKPYKYSSPPPPPVHTYPHPHPVYH 59

Query: 273 SPPPPP---KKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPP-YHY 106
           SPPPPP   KKPYKY SPPPP  H  P    H P P      YHSPPPPVYSPPPP Y+Y
Sbjct: 60  SPPPPPTPHKKPYKYPSPPPPPAHTYPP---HVPTP-----VYHSPPPPVYSPPPPAYYY 111

Query: 105 SSPPPPPKKPYYYH 64
            SPPPP     Y+H
Sbjct: 112 KSPPPP-----YHH 120

 Score =  102 bits (255), Expect = 2e-20
 Identities = 57/117 (48%), Positives = 63/117 (53%), Gaps = 10/117 (8%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVY--PPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPP 358
           Y Y SPPPP V+    P P  +  PP +  P K   P  PP   YP   P YH S PPPP
Sbjct: 7   YKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYH-SPPPPP 65

Query: 357 VYSPPKKPYHYSSPPPP---VYSP--PPPYHYSSPPP---PPKKPYKYSSPPPPEHH 211
             +P KKPY Y SPPPP    Y P  P P ++S PPP   PP   Y Y SPPPP HH
Sbjct: 66  --TPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVYSPPPPAYYYKSPPPPYHH 120

[127][TOP]
>UniRef100_Q4PSF3 Proline-rich extensin-like family protein n=1 Tax=Arabidopsis
           thaliana RepID=Q4PSF3_ARATH
          Length = 249

 Score =  145 bits (367), Expect = 2e-33
 Identities = 99/240 (41%), Positives = 120/240 (50%), Gaps = 38/240 (15%)
 Frame = -3

Query: 606 MASTTFTLLVALVSLTLPSLISANSY--LYSSPPPPKVYPPVSPPPKVYPPVY--SPPPK 439
           M S  F+L++  +  TL ++ + N+   L +S P P     +SPPP   PPV   SPPP 
Sbjct: 1   MVSRRFSLILLFLLATLITVANGNNNRKLLTSAPEPAPLVDLSPPP---PPVNISSPPPP 57

Query: 438 VYPPVSPPPKVYPPVSPPYHYSSPPPPV-YSPPKKPYHYSSPPPPVY--SPPPPYHYSSP 268
           V   +SPPP       PP + S PPPPV  SPP  P + S PPPPV    PPPP + S P
Sbjct: 58  VN--LSPPP-------PPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPP 108

Query: 267 PPP-------------PKKPYKYSSPPPPEHHVS--PKPYYHSPPPPKKPYYYHSPPPPV 133
           PPP             P  P    SPPPP  ++S  P P   SPPPP  P  +  PPP V
Sbjct: 109 PPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPP--PVLFSPPPPTV 166

Query: 132 YSPPPPYHYSSPPPPPK---KPYYYHSPPPP------VYSPPPP-------YHYTSPPPP 1
             PPPP   +  PPPP+     YY  +PPPP      VY PPPP       Y  + PPPP
Sbjct: 167 TRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPP 226

 Score =  141 bits (356), Expect = 4e-32
 Identities = 88/197 (44%), Positives = 96/197 (48%), Gaps = 32/197 (16%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPV----YSPPPKVYPPVS----PPPKVYPPVSPPYHYSSP 367
           SSPPPP    P  PP  + PP      SPPP   PPV+    PPP +  P  PP + S P
Sbjct: 52  SSPPPPVNLSPPPPPVNLSPPPPPVNLSPPP---PPVNLSPPPPPVLLSPPPPPVNLSPP 108

Query: 366 PPPV-YSPPKKPYHYSSPPPPVY--SPPPPYHYSSPPPP-----PKKPYKYSSPPPPEHH 211
           PPPV  SPP  P   S PPPPV    PPPP + S PPPP     P  P  +S PPP    
Sbjct: 109 PPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTR 168

Query: 210 VSPKPYYHSPPPPKKP----YYYHSPPPPVYS-----PPPPYHYSSPPPPPKKPYYYHSP 58
             P P     PPP +P    YY  +PPPP Y      PPPP      PPP     Y  SP
Sbjct: 169 PPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPP------PPPQAARSYKRSP 222

Query: 57  PPP-------VYSPPPP 28
           PPP       VYSPPPP
Sbjct: 223 PPPPPSKYGRVYSPPPP 239

 Score = 84.3 bits (207), Expect = 7e-15
 Identities = 55/123 (44%), Positives = 60/123 (48%), Gaps = 21/123 (17%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPP----VYSPPPKVYPPV---SPPPKVYPPVSPPYHYSS 370
           L S PPPP +  P  PP  + PP    + SPPP   PPV    PPP V  P  PP    S
Sbjct: 122 LLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPP---PPVLFSPPPPTVTRPPPPPTITRS 178

Query: 369 PPPPVYSPPKKPYHYSSPPPP------VYSPPPP-------YHYSSPPPPP-KKPYKYSS 232
           PPPP   P    Y+  +PPPP      VY PPPP       Y  S PPPPP K    YS 
Sbjct: 179 PPPP--RPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVYSP 236

Query: 231 PPP 223
           PPP
Sbjct: 237 PPP 239

[128][TOP]
>UniRef100_Q41645 Extensin (Fragment) n=1 Tax=Volvox carteri RepID=Q41645_VOLCA
          Length = 464

 Score =  145 bits (366), Expect = 3e-33
 Identities = 86/184 (46%), Positives = 93/184 (50%), Gaps = 10/184 (5%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPP-----VSPPYHYSSPPPP 358
           S PPPP+V     PP +V     SPPP    P  PP ++  P      SPP   +SPPPP
Sbjct: 221 SPPPPPRVSTSPPPPARVSS---SPPPATRSP--PPRRITSPSPVLTASPPLPKTSPPPP 275

Query: 357 VYSPPKKPYHYSSPPPPVY-----SPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPY 193
              PP  P   +SPPPP       SPPPP   SSPPPPP  P    SPPPP    SP P 
Sbjct: 276 PRVPPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPP-PRPSPSPPPPRSSPSPPPP 334

Query: 192 YHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTS 13
              PP P  P    SPPPP  SP PP    SPPPPP +      PPPP  SPPPP     
Sbjct: 335 SPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRA---SPPPPPASSPPPP---PR 388

Query: 12  PPPP 1
           PPPP
Sbjct: 389 PPPP 392

 Score =  145 bits (366), Expect = 3e-33
 Identities = 87/182 (47%), Positives = 95/182 (52%)
 Frame = -3

Query: 549 LISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSS 370
           + S +  L +SPP PK  PP  PPP+V P    PPP   PP  PPP+V P   PP   SS
Sbjct: 254 ITSPSPVLTASPPLPKTSPP--PPPRVPPS--PPPPVASPPPPPPPRVSPSPPPPQPVSS 309

Query: 369 PPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYY 190
           PPPP   PP +P    SPPPP  SP PP   S PPP P  P    SPPPP    SP P  
Sbjct: 310 PPPP---PPPRPS--PSPPPPRSSPSPPPP-SPPPPSPPPPRPSPSPPPPRSSPSPPPPV 363

Query: 189 HSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSP 10
            SPPPP         PP    PPPP   SSPPPPP+ P     PP P  SPPPP    + 
Sbjct: 364 VSPPPP---------PPRASPPPPP--ASSPPPPPRPP-----PPSPPPSPPPPATAAAN 407

Query: 9   PP 4
           PP
Sbjct: 408 PP 409

 Score =  141 bits (356), Expect = 4e-32
 Identities = 91/185 (49%), Positives = 98/185 (52%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           P L ++     +SPPPP   PP SPP    PPV SPPP       PPP+V P   PP   
Sbjct: 259 PVLTASPPLPKTSPPPPPRVPP-SPP----PPVASPPP------PPPPRVSPSPPPPQPV 307

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
           SSPPPP   PP +P    SPPPP  SP PP    SPPPP        SPPPP     P P
Sbjct: 308 SSPPPP---PPPRP--SPSPPPPRSSPSPP--PPSPPPP--------SPPPPR----PSP 348

Query: 195 YYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYT 16
              SPPPP+      SPPPPV SPPPP   +SPPPPP       S PPP   PPPP    
Sbjct: 349 ---SPPPPRSS---PSPPPPVVSPPPPPPRASPPPPPA------SSPPPPPRPPPPSPPP 396

Query: 15  SPPPP 1
           SPPPP
Sbjct: 397 SPPPP 401

 Score =  132 bits (331), Expect = 3e-29
 Identities = 85/201 (42%), Positives = 99/201 (49%), Gaps = 7/201 (3%)
 Frame = -3

Query: 582 LVALVSLTLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY 403
           +VA    T+  + +A   + ++P PP       PPP+V     SPPP      SPPP   
Sbjct: 198 IVADSKNTVALVTAAAVVVQTTPSPP-------PPPRVST---SPPPPARVSSSPPPATR 247

Query: 402 PPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVY-SPPPPYHYSSPPPPPK------KPY 244
            P  PP   +SP P + + P  P     PPP V  SPPPP     PPPPP+       P 
Sbjct: 248 SP--PPRRITSPSPVLTASPPLPKTSPPPPPRVPPSPPPPVASPPPPPPPRVSPSPPPPQ 305

Query: 243 KYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYH 64
             SSPPPP     P+P   SPPPP+       P PP  SPPPP    SPPPP   P    
Sbjct: 306 PVSSPPPPP---PPRP-SPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSP---- 357

Query: 63  SPPPPVYSPPPPYHYTSPPPP 1
           SPPPPV SPPPP    SPPPP
Sbjct: 358 SPPPPVVSPPPPPPRASPPPP 378

 Score =  126 bits (316), Expect = 2e-27
 Identities = 74/165 (44%), Positives = 79/165 (47%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
           S PPPP   P  SPPP    P   PPP   PP  PPP+  P   PP    SPPPPV SPP
Sbjct: 309 SPPPPPPPRPSPSPPPPRSSPS-PPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPP 367

Query: 342 KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
             P   S PPPP  SPPPP      PPPP  P    SPPPP    +  P   SP P +  
Sbjct: 368 PPPPRASPPPPPASSPPPP----PRPPPPSPP---PSPPPPATAAANPP---SPAPSRS- 416

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPP 28
                PP     PPPP    +PPP       Y+ PPP   SPPPP
Sbjct: 417 -RAGGPPLGTRPPPPPPEDDAPPPD------YYFPPPQDMSPPPP 454

[129][TOP]
>UniRef100_Q43505 Extensin-like protein Dif54 n=1 Tax=Solanum lycopersicum
           RepID=Q43505_SOLLC
          Length = 436

 Score =  145 bits (365), Expect = 3e-33
 Identities = 84/195 (43%), Positives = 93/195 (47%), Gaps = 15/195 (7%)
 Frame = -3

Query: 540 ANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP 361
           + +Y Y SP P K Y   SP P  Y    +P    Y     P K Y   SP  +Y SP P
Sbjct: 232 SKNYYYKSPSPVKYYK--SPSPAKYYKSPAPSKNYYYKSPSPVKYYKSPSPVKYYKSPAP 289

Query: 360 PVYSPPKKPYHYSSPPPPVY--SPPPPYHYSSPPPPP---KKPYKYSSPPPPEHHVSPKP 196
                  K Y+Y SP P  Y  SP P  +Y SPPPPP   K P  Y SPPPP  +    P
Sbjct: 290 ------SKHYYYKSPSPSQYYKSPAPSKYYKSPPPPPTYYKSPVYYKSPPPPPTYYEKSP 343

Query: 195 -YYHSPPPP-----KKPYYYHSPPPPVYSPPPPYHYSSPPPPP----KKPYYYHSPPPPV 46
            YY SP PP       PYY   PPPP Y    PY Y SPPPPP      P Y   PPPP 
Sbjct: 344 SYYKSPLPPPYYKESMPYYKSPPPPPYYKESTPY-YKSPPPPPYYKESTPSYKSPPPPPY 402

Query: 45  YSPPPPYHYTSPPPP 1
           Y    PY+ + PPPP
Sbjct: 403 YKESTPYYKSPPPPP 417

 Score =  140 bits (354), Expect = 6e-32
 Identities = 83/190 (43%), Positives = 93/190 (48%), Gaps = 13/190 (6%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVY 352
           Y Y SP P K Y   SP P  Y    +P    Y     P K Y   SP  +Y SP     
Sbjct: 206 YYYKSPSPVKYYK--SPSPAKYYKSPAPSKNYYYKSPSPVKYYKSPSPAKYYKSP----- 258

Query: 351 SPPKKPYHYSSPPPPVY--SPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP--YYHS 184
             P K Y+Y SP P  Y  SP P  +Y S  P P K Y Y SP P +++ SP P  YY S
Sbjct: 259 -APSKNYYYKSPSPVKYYKSPSPVKYYKS--PAPSKHYYYKSPSPSQYYKSPAPSKYYKS 315

Query: 183 PPPP----KKPYYYHS-PPPPVYSPPPPYHYSSPPPPP----KKPYYYHSPPPPVYSPPP 31
           PPPP    K P YY S PPPP Y    P +Y SP PPP      PYY   PPPP Y    
Sbjct: 316 PPPPPTYYKSPVYYKSPPPPPTYYEKSPSYYKSPLPPPYYKESMPYYKSPPPPPYYKEST 375

Query: 30  PYHYTSPPPP 1
           PY+ + PPPP
Sbjct: 376 PYYKSPPPPP 385

 Score =  133 bits (334), Expect = 1e-29
 Identities = 82/189 (43%), Positives = 90/189 (47%), Gaps = 16/189 (8%)
 Frame = -3

Query: 540 ANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY--PPVSPPYHYSSP 367
           + +Y Y SP P K Y   SP      P    P K Y   SP P  Y   P    Y+ S P
Sbjct: 261 SKNYYYKSPSPVKYYKSPSPVKYYKSPA---PSKHYYYKSPSPSQYYKSPAPSKYYKSPP 317

Query: 366 PPPVYSPPKKPYHYSSPPPP-VYSPPPPYHYSSPPPPP----KKPYKYSSPPPPEHHVSP 202
           PPP Y   K P +Y SPPPP  Y    P +Y SP PPP      PY Y SPPPP ++   
Sbjct: 318 PPPTYY--KSPVYYKSPPPPPTYYEKSPSYYKSPLPPPYYKESMPY-YKSPPPPPYYKES 374

Query: 201 KPYYHSPPPPKKPYYYHS-------PPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY 43
            PYY SPPPP  PYY  S       PPPP Y    PY+ S PPPP     YY    P   
Sbjct: 375 TPYYKSPPPP--PYYKESTPSYKSPPPPPYYKESTPYYKSPPPPP-----YYKESTPSYK 427

Query: 42  SPP--PPYH 22
           SPP  P YH
Sbjct: 428 SPPSSPTYH 436

 Score =  129 bits (325), Expect = 1e-28
 Identities = 87/188 (46%), Positives = 95/188 (50%), Gaps = 13/188 (6%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPK--VYPPVSPPYHYSSPPPPVY 352
           Y SP P K Y   SP P  Y    SP P  Y     P K   Y   SP  +Y SP P  Y
Sbjct: 139 YKSPTPSKHYYYKSPSPSKY--YKSPSPAKYYKSPAPSKHYYYKSPSPAKYYKSPSPAKY 196

Query: 351 --SP-PKKPYHYSSPPPPVY--SPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP--Y 193
             SP P K Y+Y SP P  Y  SP P  +Y SP P   K Y Y SP P +++ SP P  Y
Sbjct: 197 YKSPAPSKHYYYKSPSPVKYYKSPSPAKYYKSPAP--SKNYYYKSPSPVKYYKSPSPAKY 254

Query: 192 YHSPPPPKKPYYYHSPPPPVY--SPPPPYHYSSPPPPPKKPYYYHSPPPPVY--SPPPPY 25
           Y SP P K  YYY SP P  Y  SP P  +Y S  P P K YYY SP P  Y  SP P  
Sbjct: 255 YKSPAPSKN-YYYKSPSPVKYYKSPSPVKYYKS--PAPSKHYYYKSPSPSQYYKSPAPSK 311

Query: 24  HYTSPPPP 1
           +Y SPPPP
Sbjct: 312 YYKSPPPP 319

 Score =  112 bits (281), Expect = 2e-23
 Identities = 84/203 (41%), Positives = 95/203 (46%), Gaps = 26/203 (12%)
 Frame = -3

Query: 534 SYLYSSPPPPKVY--PPV------SPPP-KVYPPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
           S+ Y SP P K Y   PV      SP P K Y    SP    Y   +P  K Y  +SP  
Sbjct: 69  SHYYKSPTPSKHYYKSPVVVKYYKSPAPSKKYYKSPSPSKYYYKSHTPSKKYYKSLSPAK 128

Query: 381 HYSSPPPPVY--SP-PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYK---------Y 238
           +Y SP P  Y  SP P K Y+Y SP P  Y       Y SP P   K YK         Y
Sbjct: 129 YYKSPSPAKYYKSPTPSKHYYYKSPSPSKY-------YKSPSPA--KYYKSPAPSKHYYY 179

Query: 237 SSPPPPEHHVSPKP-YYHSPPPPKKPYYYHSPPPPVY--SPPPPYHYSSPPPPPKKPYYY 67
            SP P +++ SP P  Y+  P P K YYY SP P  Y  SP P  +Y S  P P K YYY
Sbjct: 180 KSPSPAKYYKSPSPAKYYKSPAPSKHYYYKSPSPVKYYKSPSPAKYYKS--PAPSKNYYY 237

Query: 66  HSPPPPVY--SPPPPYHYTSPPP 4
            SP P  Y  SP P  +Y SP P
Sbjct: 238 KSPSPVKYYKSPSPAKYYKSPAP 260

 Score =  108 bits (271), Expect = 3e-22
 Identities = 86/224 (38%), Positives = 102/224 (45%), Gaps = 28/224 (12%)
 Frame = -3

Query: 591 FTLLVALVSLTLPSLISANSYLYSSPPPP----KVYPPVSPPP---------KVYPPVY- 454
           F L +  V+ T+   ++  SY Y+SP P     K Y   SP P         +  P  Y 
Sbjct: 16  FALAICFVASTV---VADYSYGYTSPSPTYTTKKYYKSPSPSPYYKKSEKHAEHSPSHYY 72

Query: 453 -SPPPKVYPPVSPPPKVY--PPVSPPYHYSSPPPPVY-----SPPKKPYHYSSPPPPVYS 298
            SP P  +   SP    Y   P     +Y SP P  Y     +P KK Y   SP     S
Sbjct: 73  KSPTPSKHYYKSPVVVKYYKSPAPSKKYYKSPSPSKYYYKSHTPSKKYYKSLSPAKYYKS 132

Query: 297 PPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP--YYHSPPPPKKPYYYHSPPPPVY-- 130
           P P  +Y SP P   K Y Y SP P +++ SP P  YY S P P K YYY SP P  Y  
Sbjct: 133 PSPAKYYKSPTP--SKHYYYKSPSPSKYYKSPSPAKYYKS-PAPSKHYYYKSPSPAKYYK 189

Query: 129 SPPPPYHYSSPPPPPKKPYYYHSPPPPVY--SPPPPYHYTSPPP 4
           SP P  +Y S  P P K YYY SP P  Y  SP P  +Y SP P
Sbjct: 190 SPSPAKYYKS--PAPSKHYYYKSPSPVKYYKSPSPAKYYKSPAP 231

 Score = 89.0 bits (219), Expect = 3e-16
 Identities = 62/151 (41%), Positives = 66/151 (43%), Gaps = 2/151 (1%)
 Frame = -3

Query: 555 PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
           P+   +  Y  S PPP              P  Y   P  Y    PPP  Y   S PY Y
Sbjct: 320 PTYYKSPVYYKSPPPP--------------PTYYEKSPSYYKSPLPPP--YYKESMPY-Y 362

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
            SPPPP Y     PY+ S PPPP Y    P  Y SPPPPP   YK S+           P
Sbjct: 363 KSPPPPPYYKESTPYYKSPPPPPYYKESTP-SYKSPPPPPY--YKEST-----------P 408

Query: 195 YYHSPPPPKKPYYYHSPPPPVYSPP--PPYH 109
           YY SPPPP  PYY  S  P   SPP  P YH
Sbjct: 409 YYKSPPPP--PYYKES-TPSYKSPPSSPTYH 436

[130][TOP]
>UniRef100_B9IKD0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IKD0_POPTR
          Length = 190

 Score =  144 bits (363), Expect = 6e-33
 Identities = 83/187 (44%), Positives = 98/187 (52%), Gaps = 11/187 (5%)
 Frame = -3

Query: 612 SLMASTTFTLLVALVSLTLPSLISANSYL---YSSPPPPKVYPPVSPPPKVYPPVYSPPP 442
           S+M   +  LL++  S    +  S NS L   Y SPPPP      SPPP  +     PPP
Sbjct: 6   SVMLYFSLALLLSSSSEATDTTFSRNSALWLTYKSPPPPFHNKHKSPPPPPHKYKSPPPP 65

Query: 441 KVYPPVSPPPKVY----PPVSPPYHYSSPPPPVY---SPPKKPYHYSSPPPPVYSPP-PP 286
                 SPPP VY    PP   P H+ SPPP  +   SPP  PY Y SPPPP   PP   
Sbjct: 66  HHKCKYSPPPPVYTYRSPPPPTPMHHKSPPPSPHMFKSPPPPPYRYISPPPPPPHPPCHA 125

Query: 285 YHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHY 106
           Y Y SPPPPP   YKY+SPPPP+HH     ++H       P+  +  PPP +   P YHY
Sbjct: 126 YKYLSPPPPPS--YKYASPPPPKHH-----HHHKHKWSPYPFITYMSPPPPHHNYPDYHY 178

Query: 105 SSPPPPP 85
           SSPPPPP
Sbjct: 179 SSPPPPP 185

 Score =  129 bits (324), Expect = 2e-28
 Identities = 79/162 (48%), Positives = 83/162 (51%), Gaps = 36/162 (22%)
 Frame = -3

Query: 378 YSSPPPPVY----SPPKKPYHYSSPPPP----VYSPPPP-YHYSSPPPPPKKPYKYSSPP 226
           Y SPPPP +    SPP  P+ Y SPPPP     YSPPPP Y Y SPPPP           
Sbjct: 38  YKSPPPPFHNKHKSPPPPPHKYKSPPPPHHKCKYSPPPPVYTYRSPPPPT---------- 87

Query: 225 PPEHHVSPKPYYH---SPPPPKKPYYYHSPPPPVYSPP-PPYHYSSPPPPPKKPYYYHSP 58
            P HH SP P  H   SPPPP  PY Y SPPPP   PP   Y Y SPPPPP   Y Y SP
Sbjct: 88  -PMHHKSPPPSPHMFKSPPPP--PYRYISPPPPPPHPPCHAYKYLSPPPPPS--YKYASP 142

Query: 57  PPPVY-----------------SPPPP------YHYTSPPPP 1
           PPP +                 SPPPP      YHY+SPPPP
Sbjct: 143 PPPKHHHHHKHKWSPYPFITYMSPPPPHHNYPDYHYSSPPPP 184

[131][TOP]
>UniRef100_Q76KW2 Hydroxyproline-rich glycoprotein-3 (Fragment) n=1 Tax=Pisum sativum
           RepID=Q76KW2_PEA
          Length = 137

 Score =  144 bits (362), Expect = 8e-33
 Identities = 76/119 (63%), Positives = 78/119 (65%), Gaps = 8/119 (6%)
 Frame = -3

Query: 333 YHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYY 154
           Y Y SPPPPVY       Y SPPPP KKPYKYSSPPPP +       Y+SPPPP   Y Y
Sbjct: 1   YKYKSPPPPVYK------YKSPPPPVKKPYKYSSPPPPVYK------YNSPPPP--VYKY 46

Query: 153 HSPPPPVY---SPPPP-YHYSSPPPPPKKPYYYHSPPPPVY---SPPPP-YHYTSPPPP 1
            SPPPPVY   SPPPP Y Y SPPPP KKPY Y SPPPPVY   SPPPP Y Y SP  P
Sbjct: 47  KSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYTSPPPPVYKYNSPPPPVYKYKSPXTP 105

 Score =  136 bits (342), Expect = 2e-30
 Identities = 85/155 (54%), Positives = 90/155 (58%), Gaps = 9/155 (5%)
 Frame = -3

Query: 453 SPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVY---SPPPP- 286
           SPPP VY   SPPP    PV  PY YSSPPPPVY        Y+SPPPPVY   SPPPP 
Sbjct: 5   SPPPPVYKYKSPPP----PVKKPYKYSSPPPPVYK-------YNSPPPPVYKYKSPPPPV 53

Query: 285 YHYSSPPPPPKKPYKYSSPPPPEHHVSPKPY-YHSPPPPKKPYYYHSPPPPVY---SPPP 118
           Y Y SPPPP    YKY SPPPP      KPY Y SPPPP   Y Y+SPPPPVY   SP  
Sbjct: 54  YKYKSPPPPV---YKYKSPPPP----VKKPYKYTSPPPP--VYKYNSPPPPVYKYKSPXT 104

Query: 117 P-YHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYT 16
           P Y Y SPPP     Y Y+S    V    PP+ +T
Sbjct: 105 PIYKYKSPPP---XVYKYNSLLNSVQVYSPPHQFT 136

 Score =  121 bits (303), Expect = 5e-26
 Identities = 77/148 (52%), Positives = 80/148 (54%), Gaps = 11/148 (7%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPPVSPPPKVYPPVY--SPPPKVYPPVSPPPKVYPPVSPP---YHYSSP 367
           Y Y SPPPP VY   SPPP V  P    SPPP VY   SPPP VY   SPP   Y Y SP
Sbjct: 1   YKYKSPPPP-VYKYKSPPPPVKKPYKYSSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSP 59

Query: 366 PPPVY---SPP---KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVS 205
           PPPVY   SPP   KKPY Y+SPPPPVY       Y+SPPPP    YKY SP  P +   
Sbjct: 60  PPPVYKYKSPPPPVKKPYKYTSPPPPVYK------YNSPPPP---VYKYKSPXTPIYK-- 108

Query: 204 PKPYYHSPPPPKKPYYYHSPPPPVYSPP 121
               Y SPPP    Y        VYSPP
Sbjct: 109 ----YKSPPPXVYKYNSLLNSVQVYSPP 132

[132][TOP]
>UniRef100_B9N4U0 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9N4U0_POPTR
          Length = 499

 Score =  143 bits (361), Expect = 1e-32
 Identities = 85/159 (53%), Positives = 90/159 (56%)
 Frame = -3

Query: 477 PKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYS 298
           P V  PV     K + P  PPP   PP  PP H  SPPPPV           SPPPPV+S
Sbjct: 381 PVVSRPVDCSKDKFHSP--PPPVQSPPPPPPVH--SPPPPV----------QSPPPPVHS 426

Query: 297 PPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPP 118
           PPPP H  SPPPP +      SPPPP H  SP P  HSPPPP      HSPPPPV+SPPP
Sbjct: 427 PPPPVH--SPPPPVQ------SPPPPVH--SPPPPVHSPPPP-----VHSPPPPVHSPPP 471

Query: 117 PYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           P    SPPPP       HSPPPPV+SPPP     SPPPP
Sbjct: 472 PVQ--SPPPP------VHSPPPPVHSPPP---VQSPPPP 499

 Score =  134 bits (338), Expect = 5e-30
 Identities = 83/157 (52%), Positives = 85/157 (54%)
 Frame = -3

Query: 498 YPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSS 319
           YP VS P       +  PP   PPV  PP   P  SPP    SPPPPV+SPP  P H  S
Sbjct: 380 YPVVSRPVDCSKDKFHSPP---PPVQSPPPPPPVHSPPPPVQSPPPPVHSPPP-PVH--S 433

Query: 318 PPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPP 139
           PPPPV SPPPP H S PPP         SPPPP          HSPPPP      HSPPP
Sbjct: 434 PPPPVQSPPPPVH-SPPPP-------VHSPPPP---------VHSPPPP-----VHSPPP 471

Query: 138 PVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPP 28
           PV SPPPP H  SPPPP       HS PPPV SPPPP
Sbjct: 472 PVQSPPPPVH--SPPPP------VHS-PPPVQSPPPP 499

 Score =  131 bits (329), Expect = 5e-29
 Identities = 79/146 (54%), Positives = 84/146 (57%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           + SPPPP   PP   PP   PPV+SPPP    PV  PP       PP H  SPPPPV+SP
Sbjct: 394 FHSPPPPVQSPP---PP---PPVHSPPP----PVQSPP-------PPVH--SPPPPVHSP 434

Query: 345 PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
           P       SPPPPV+SPPPP H  SPPPP        SPPPP H  SP P   SPPPP  
Sbjct: 435 PPP---VQSPPPPVHSPPPPVH--SPPPP------VHSPPPPVH--SPPPPVQSPPPP-- 479

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPP 88
               HSPPPPV+SPPP     SPPPP
Sbjct: 480 ---VHSPPPPVHSPPP---VQSPPPP 499

[133][TOP]
>UniRef100_UPI00015B4CAB PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
            RepID=UPI00015B4CAB
          Length = 972

 Score =  142 bits (359), Expect = 2e-32
 Identities = 84/201 (41%), Positives = 93/201 (46%), Gaps = 29/201 (14%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYS------PPPKVYPPVSPPPK--VYPPVSPPYHYSSPPP 361
            PPPP   PP  PPP   PPV        PPP   PP  PPP+   Y P +PP   + PPP
Sbjct: 699  PPPPPTRPP--PPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPP---TRPPP 753

Query: 360  PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKP------YKYSSPPPPEHHVSPK 199
            P   PP +P     P PPV  PPPP     PPPPP +P      Y    PPP    V+  
Sbjct: 754  PPTRPPTRP-----PQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPVTQT 808

Query: 198  PYYHSPPPPKKP----------YYYHSPP-----PPVYSPPPPYHYSSPPPPPKKPYYYH 64
            PY   PPPP +P          Y   +PP     PPV  PPPP     PPPPP +P    
Sbjct: 809  PYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRP---- 864

Query: 63   SPPPPVYSPPPPYHYTSPPPP 1
             PPPP   P     YT PPPP
Sbjct: 865  PPPPPTRPPVTQKPYTRPPPP 885

 Score =  141 bits (356), Expect = 4e-32
 Identities = 85/216 (39%), Positives = 94/216 (43%), Gaps = 41/216 (18%)
 Frame = -3

Query: 525  YSSPPPPKVYPPVSPPPKV-------------YPPVYSPPPKVYPPVSPPPKVYPPVSPP 385
            Y+ PPPP   PP  PPP+               PPV  PPP   PP  PPP   PP  PP
Sbjct: 607  YTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPP--PPTRPPPP--PPTRPP 662

Query: 384  YH---YSSPPPPVYSP------------PKKPYHYSSPPPPVYSPPPP--------YHYS 274
                 Y+ PPPP   P            PK P     PPPP   PPPP          Y+
Sbjct: 663  VTQTPYTRPPPPPTRPSTYLPPAPPTRPPKPPVTRPPPPPPTRPPPPPPTRPPVTQTPYT 722

Query: 273  SPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPP 94
             PPPPP +P     PP P  ++ P P    PPPP +P     P PPV  PPPP     PP
Sbjct: 723  RPPPPPTRP-PTRPPPQPSTYLPPAPPTRPPPPPTRPPT-RPPQPPVTRPPPPPPTRPPP 780

Query: 93   PPPKKP-----YYYHSPPPPVYSPPPPYHYTSPPPP 1
            PPP +P      Y   PPPP   P     YT PPPP
Sbjct: 781  PPPTRPPVTQTPYTRPPPPPTRPPVTQTPYTRPPPP 816

 Score =  139 bits (351), Expect = 1e-31
 Identities = 80/197 (40%), Positives = 87/197 (44%), Gaps = 22/197 (11%)
 Frame = -3

Query: 525  YSSPPPPKVYPPVSPPPKV----------------YPPVYSPPPKVYPPVSPPPKVYPPV 394
            Y+ PPPP   PP  PPP                   PPV  PPP   PP  PPP   PP 
Sbjct: 543  YTRPPPPPTRPPTRPPPPPTQPSTYLPPAPPTRPPQPPVTRPPPP--PPTRPPPP--PPT 598

Query: 393  SPPYH---YSSPPPPVYSPPKKPYHYSS---PPPPVYSPPPPYHYSSPPPPPKKPYKYSS 232
             PP     Y+ PPPP   PP +P    S   PP P   PP P     PPPPP +P     
Sbjct: 599  RPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRP---PP 655

Query: 231  PPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPP 52
            PPP    V+  PY   PPPP +P  Y  P PP   P PP     PPPP + P     PPP
Sbjct: 656  PPPTRPPVTQTPYTRPPPPPTRPSTYLPPAPPTRPPKPPVTRPPPPPPTRPP-----PPP 710

Query: 51   PVYSPPPPYHYTSPPPP 1
            P   P     YT PPPP
Sbjct: 711  PTRPPVTQTPYTRPPPP 727

 Score =  139 bits (351), Expect = 1e-31
 Identities = 79/202 (39%), Positives = 91/202 (45%), Gaps = 17/202 (8%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVS-------PPPKVYPP 397
            P     ++YL  +PP     PPV+ PP   P    PPP   PPV+       PPP   PP
Sbjct: 559  PPPTQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPP 618

Query: 396  VSPPYHYSS--PPPPVYSPPKKPYHYSSPPPPVYSPPPP--------YHYSSPPPPPKKP 247
              PP   S+  PP P   PP+ P     PPPP   PPPP          Y+ PPPPP +P
Sbjct: 619  TRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRP 678

Query: 246  YKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYY 67
              Y  P PP     P      PPPP +P     PPPP   P     Y+ PPPPP +P   
Sbjct: 679  STYLPPAPPTRPPKPPVTRPPPPPPTRP----PPPPPTRPPVTQTPYTRPPPPPTRPPTR 734

Query: 66   HSPPPPVYSPPPPYHYTSPPPP 1
              P P  Y PP P   T PPPP
Sbjct: 735  PPPQPSTYLPPAP--PTRPPPP 754

 Score =  139 bits (349), Expect = 2e-31
 Identities = 81/211 (38%), Positives = 95/211 (45%), Gaps = 26/211 (12%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
            P   + ++YL  +PP     PPV+ PP   P    PPP   PPV+  P   PP  P    
Sbjct: 495  PPPTAPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPP 554

Query: 375  SSPPPP-----VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKP----YKYSSPPP 223
            + PPPP      Y PP  P     P PPV  PPPP     PPPPP +P      Y+ PPP
Sbjct: 555  TRPPPPPTQPSTYLPPAPPTR--PPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPP 612

Query: 222  ----PEHHVSPKPYYHSPP-----PPKKPYYYHSPPPPVYSPPPP--------YHYSSPP 94
                P     P+P  + PP     PP+ P     PPPP   PPPP          Y+ PP
Sbjct: 613  PPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPP 672

Query: 93   PPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            PPP +P  Y  P PP   P PP     PPPP
Sbjct: 673  PPPTRPSTYLPPAPPTRPPKPPVTRPPPPPP 703

 Score =  138 bits (347), Expect = 4e-31
 Identities = 82/208 (39%), Positives = 93/208 (44%), Gaps = 33/208 (15%)
 Frame = -3

Query: 525  YSSPPPPKVYPPVSPPPKVY------PPVYSPPPKVYPPVSPP--PKVYPPVSPPYHYSS 370
            Y+ PPPP   PP  PPP+        PP   PPP   PP  PP  P   PP  PP     
Sbjct: 721  YTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPPPPTRPPTRPPQPPVTRPPPPPPTR--P 778

Query: 369  PPPPVYSPPKKPYHYSSPPPPVYSPPPPYH-YSSPPPPPKKPYKYSSPPPPEHHVSPKPY 193
            PPPP   PP     Y+ PPPP   PP     Y+ PPPPP +P     PP P  ++ P P 
Sbjct: 779  PPPPPTRPPVTQTPYTRPPPPPTRPPVTQTPYTRPPPPPTRP-PTRPPPQPSTYLPPAP- 836

Query: 192  YHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPP------KKPYYYHSPPPPVYSP-- 37
               P  P +P     PPPP   PPPP     PPPPP      +KPY    PPPP + P  
Sbjct: 837  ---PTRPPQPPVTRPPPPPPTRPPPPPPTRPPPPPPTRPPVTQKPYTRPPPPPPTFPPVA 893

Query: 36   -----PPPY-----------HYTSPPPP 1
                 PPPY             T+PPPP
Sbjct: 894  PSTPRPPPYLPPSSPRPTYVTVTAPPPP 921

 Score =  134 bits (336), Expect = 8e-30
 Identities = 80/196 (40%), Positives = 89/196 (45%), Gaps = 24/196 (12%)
 Frame = -3

Query: 516  PPPPKVYPPVS-------PPPKVYPPVYSPP-PKVYPPVSPPPKVYPPVSPPYHYSSPPP 361
            PPPP   PPV+       PPP   PP   PP P  Y P +PP +   P  PP     PPP
Sbjct: 593  PPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTR---PPQPPVTRPPPPP 649

Query: 360  PVYSPPKKPYH-------YSSPPPP-----VYSPP-PPYHYSSPP---PPPKKPYKYSSP 229
            P   PP  P         Y+ PPPP      Y PP PP     PP   PPP  P +   P
Sbjct: 650  PTRPPPPPPTRPPVTQTPYTRPPPPPTRPSTYLPPAPPTRPPKPPVTRPPPPPPTRPPPP 709

Query: 228  PPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPP 49
            PP    V+  PY   PPPP +P     P P  Y PP P   + PPPPP +P     P PP
Sbjct: 710  PPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAP--PTRPPPPPTRP-PTRPPQPP 766

Query: 48   VYSPPPPYHYTSPPPP 1
            V  PPPP     PPPP
Sbjct: 767  VTRPPPPPPTRPPPPP 782

 Score =  128 bits (322), Expect = 3e-28
 Identities = 81/205 (39%), Positives = 91/205 (44%), Gaps = 30/205 (14%)
 Frame = -3

Query: 525  YSSPPPPKVYP-------PVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYH---Y 376
            Y+ PPPP   P       P + PPK  PPV  PPP   PP  PPP   PP  PP     Y
Sbjct: 668  YTRPPPPPTRPSTYLPPAPPTRPPK--PPVTRPPPP--PPTRPPPP--PPTRPPVTQTPY 721

Query: 375  SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
            + PPPP   PP +P     P P  Y PP P   + PPPPP +P      PP      P P
Sbjct: 722  TRPPPPPTRPPTRP----PPQPSTYLPPAPP--TRPPPPPTRPPTRPPQPPVTRPPPPPP 775

Query: 195  YYHSPPPPKKP-----YYYHSPPPPVYSPPPPYHYSSPPPPPKKP----------YYYHS 61
                PPPP +P      Y   PPPP   P     Y+ PPPPP +P          Y   +
Sbjct: 776  TRPPPPPPTRPPVTQTPYTRPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPA 835

Query: 60   PP-----PPVYSPPPPYHYTSPPPP 1
            PP     PPV  PPPP     PPPP
Sbjct: 836  PPTRPPQPPVTRPPPPPPTRPPPPP 860

 Score =  127 bits (319), Expect = 7e-28
 Identities = 76/205 (37%), Positives = 87/205 (42%), Gaps = 28/205 (13%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVS---PPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP 361
            Y Y  P  P   PP +   PPP   PP   PP +  PP + P    PP  P      P P
Sbjct: 459  YTYPKPDTPFTLPPATRTPPPPPTRPPTRPPPTRPPPPPTAPSTYLPPAPPT---RPPQP 515

Query: 360  PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPP--PEHHVSPKPYYH 187
            PV  PP  P     PPPP   P     Y+ PPPPP +P     PPP  P  ++ P P   
Sbjct: 516  PVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPPPTQPSTYLPPAP--- 572

Query: 186  SPPPPKKPYYYHSPPPPVYSPPPP--------YHYSSPPPPPKKP----------YYYHS 61
               PP+ P     PPPP   PPPP          Y+ PPPPP +P          Y   +
Sbjct: 573  PTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPA 632

Query: 60   PP-----PPVYSPPPPYHYTSPPPP 1
            PP     PPV  PPPP     PPPP
Sbjct: 633  PPTRPPQPPVTRPPPPPPTRPPPPP 657

 Score =  119 bits (298), Expect = 2e-25
 Identities = 75/191 (39%), Positives = 83/191 (43%), Gaps = 20/191 (10%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYPPVYS------PPPKVYPPVS-------PPPKVYPPVSPPYHY 376
            PPPP   PP  PPP   PPV        PPP   PPV+       PPP   PP  PP   
Sbjct: 771  PPPPPTRPP--PPPPTRPPVTQTPYTRPPPPPTRPPVTQTPYTRPPPPPTRPPTRPP--- 825

Query: 375  SSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
              P P  Y PP  P     PP     PPPP     PPPPP +P     PPP    V+ KP
Sbjct: 826  --PQPSTYLPPAPPTRPPQPPVTRPPPPPPTR--PPPPPPTRP---PPPPPTRPPVTQKP 878

Query: 195  YYHSPPPPK--KPYYYHSPPPPVYSPPP---PYHYSSPPPPPKKPYYYHSPPPPVYSPP- 34
            Y   PPPP    P    +P PP Y PP    P + +   PPP  P Y  +P    Y PP 
Sbjct: 879  YTRPPPPPPTFPPVAPSTPRPPPYLPPSSPRPTYVTVTAPPPPSPVYSITPSTTTYRPPT 938

Query: 33   -PPYHYTSPPP 4
              P  Y + PP
Sbjct: 939  GKPAPYPTLPP 949

 Score =  118 bits (295), Expect = 4e-25
 Identities = 74/195 (37%), Positives = 81/195 (41%), Gaps = 24/195 (12%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSP----------PPKVYPPVS---PPPKVYPPVSPPYHYS 373
           PP    P   PPP V P   SP           P   PP +   PPP   PP  PP    
Sbjct: 434 PPVTQRPVTRPPPPVTPKPQSPFQGYTYPKPDTPFTLPPATRTPPPPPTRPPTRPP---P 490

Query: 372 SPPPPVYSPPKKPYHYSSPPPPVY-------SPPPPYHYSSPPPPPKKP----YKYSSPP 226
           + PPP   PP  P  Y  P PP          PPPP     PPPPP +P      Y+ PP
Sbjct: 491 TRPPP---PPTAPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPP 547

Query: 225 PPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPV 46
           PP      +P    PPPP +P  Y  P PP   P PP     PPPP + P     PPPP 
Sbjct: 548 PPPTRPPTRP----PPPPTQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPP-----PPPPT 598

Query: 45  YSPPPPYHYTSPPPP 1
             P     YT PPPP
Sbjct: 599 RPPVTQTPYTRPPPP 613

 Score =  112 bits (279), Expect = 3e-23
 Identities = 70/180 (38%), Positives = 84/180 (46%), Gaps = 18/180 (10%)
 Frame = -3

Query: 525  YSSPPPPKVYPPVS-------PPPKVYPPVYSPP-PKVYPPVSPPPKVYPPVSPPYHYSS 370
            Y+ PPPP   PPV+       PPP   PP   PP P  Y P +PP +   P  PP     
Sbjct: 793  YTRPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTR---PPQPPVTRPP 849

Query: 369  PPPPVYSPPKKPYHYSSPPPPVYSPPP----PYHYSSPPPPPKKPYKYSSPPPPEH--HV 208
            PPPP   PP  P   + PPPP  + PP    PY    PPPP   P   S+P PP +    
Sbjct: 850  PPPPTRPPPPPP---TRPPPPPPTRPPVTQKPYTRPPPPPPTFPPVAPSTPRPPPYLPPS 906

Query: 207  SPKPYY--HSPPPPKKPYYYHSPPPPVYSPP--PPYHYSSPPPPPKKPYYYHSPPPPVYS 40
            SP+P Y   + PPP  P Y  +P    Y PP   P  Y + PP   KPY  ++ P P  S
Sbjct: 907  SPRPTYVTVTAPPPPSPVYSITPSTTTYRPPTGKPAPYPTLPPSTAKPYQGYNYPIPEIS 966

 Score =  110 bits (274), Expect = 1e-22
 Identities = 70/200 (35%), Positives = 81/200 (40%), Gaps = 29/200 (14%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY---SSPPPPVYSPP 343
           PP +   P  PP +   P Y PP +   P  PP +   P  PP      + PPPPV   P
Sbjct: 394 PPQRPQTPYVPPQRPQTP-YVPPQRPQTPYVPPQRPQTPYVPPVTQRPVTRPPPPVTPKP 452

Query: 342 KKP---YHYSSP------PPPVYSPPPPYHY-------SSPPPPPKKPYKYSSPPPPEHH 211
           + P   Y Y  P      PP   +PPPP          + PPPPP  P  Y  P PP   
Sbjct: 453 QSPFQGYTYPKPDTPFTLPPATRTPPPPPTRPPTRPPPTRPPPPPTAPSTYLPPAPPTRP 512

Query: 210 VSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPP------- 52
             P      PPPP +P     PPPP   P     Y+ PPPPP +P     PPP       
Sbjct: 513 PQPPVTRPPPPPPTRP----PPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPPPTQPSTYL 568

Query: 51  ---PVYSPPPPYHYTSPPPP 1
              P   PP P     PPPP
Sbjct: 569 PPAPPTRPPQPPVTRPPPPP 588

 Score =  106 bits (265), Expect = 1e-21
 Identities = 65/190 (34%), Positives = 79/190 (41%), Gaps = 3/190 (1%)
 Frame = -3

Query: 561 TLPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPY 382
           T P       Y Y  P PP V PP +P P+  P     PP+      PPP   PP  P Y
Sbjct: 130 TAPPAPKTPGYSYPQPSPPFVQPPKTPAPQPRPTPPPSPPQTTRTFLPPPTRPPPQQPGY 189

Query: 381 HYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSP 202
            Y  P PP   PP+        PPP   PPPP   ++P PPP  P +   PPP      P
Sbjct: 190 SYPQPSPPFVQPPR------PTPPPQTRPPPPRPQTTPRPPP--PIQTRPPPPTTPRPRP 241

Query: 201 KPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPP---PPVYSPPP 31
               +S P P  P Y  +P    Y PP      +P  PP++P   + PP    P Y PP 
Sbjct: 242 PTSGYSYPQPSIP-YNPAPTQKPYVPPVTQRPQTPYVPPQRPQTPYVPPVTQRPQYVPPQ 300

Query: 30  PYHYTSPPPP 1
                +P  P
Sbjct: 301 TQRPQTPYVP 310

 Score =  100 bits (248), Expect = 1e-19
 Identities = 68/197 (34%), Positives = 86/197 (43%), Gaps = 22/197 (11%)
 Frame = -3

Query: 525 YSSPPPPKVY--PPVSP--PPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPP---YHYSSP 367
           Y  PPP K +  PP +P  P  V    Y P P   P  +P P+  PP       Y Y  P
Sbjct: 47  YDYPPPSKAFTLPPKTPVRPQPVPQQTYQPQPPA-PTRAPQPRPTPPPQNTVGSYDYPKP 105

Query: 366 P---PPVYSPPKKPYHYSSPPPPVYSPPPP----YHYSSPPPPPKKPYKYSSP-----PP 223
               P V   P++P    +P P   +PP P    Y Y  P PP  +P K  +P     PP
Sbjct: 106 QKVVPVVPVVPQRPVQPVAPQPRPTAPPAPKTPGYSYPQPSPPFVQPPKTPAPQPRPTPP 165

Query: 222 PEHHVSPKPYYHSP--PPPKKP-YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPP 52
           P    + + +   P  PPP++P Y Y  P PP   PP P       PPP +P     PPP
Sbjct: 166 PSPPQTTRTFLPPPTRPPPQQPGYSYPQPSPPFVQPPRPTPPPQTRPPPPRPQTTPRPPP 225

Query: 51  PVYSPPPPYHYTSPPPP 1
           P+ + PPP     P PP
Sbjct: 226 PIQTRPPPPTTPRPRPP 242

 Score = 93.2 bits (230), Expect = 2e-17
 Identities = 72/217 (33%), Positives = 88/217 (40%), Gaps = 41/217 (18%)
 Frame = -3

Query: 534 SYLYSSPPPPKVYP-PV--------------SPPPKVYPPV--------YSPPPKVYP-- 430
           S  ++ PP   V P PV              +P P+  PP         Y  P KV P  
Sbjct: 53  SKAFTLPPKTPVRPQPVPQQTYQPQPPAPTRAPQPRPTPPPQNTVGSYDYPKPQKVVPVV 112

Query: 429 ---------PVSPPPK-VYPPV--SPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPP 286
                    PV+P P+   PP   +P Y Y  P PP   PPK P     P PP   P   
Sbjct: 113 PVVPQRPVQPVAPQPRPTAPPAPKTPGYSYPQPSPPFVQPPKTPAPQPRPTPPPSPPQTT 172

Query: 285 YHYSSPP--PPPKKP-YKYSSPPPP-EHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPP 118
             +  PP  PPP++P Y Y  P PP      P P   + PPP +P     PPPP+ + PP
Sbjct: 173 RTFLPPPTRPPPQQPGYSYPQPSPPFVQPPRPTPPPQTRPPPPRPQTTPRPPPPIQTRPP 232

Query: 117 PYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPP 7
           P   +  P PP   Y Y  P  P Y+P P      PP
Sbjct: 233 P-PTTPRPRPPTSGYSYPQPSIP-YNPAPTQKPYVPP 267

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 57/146 (39%), Positives = 68/146 (46%), Gaps = 9/146 (6%)
 Frame = -3

Query: 537  NSYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSP-PYHYSSPPP 361
            ++YL  +PP     PPV+ PP   P    PPP   PP  PPP   PPV+  PY    PPP
Sbjct: 829  STYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPP--PPPPTRPPVTQKPYTRPPPPP 886

Query: 360  PVYSPPKKPYHYSSPPPPVYSPP----PPYHYSSPPPPPKKPYKYSSPP----PPEHHVS 205
            P + PP  P   S+P PP Y PP    P Y   + PPPP   Y  +       PP     
Sbjct: 887  PTF-PPVAP---STPRPPPYLPPSSPRPTYVTVTAPPPPSPVYSITPSTTTYRPPTG--K 940

Query: 204  PKPYYHSPPPPKKPYYYHSPPPPVYS 127
            P PY   PP   KPY  ++ P P  S
Sbjct: 941  PAPYPTLPPSTAKPYQGYNYPIPEIS 966

 Score = 84.3 bits (207), Expect = 7e-15
 Identities = 56/161 (34%), Positives = 62/161 (38%), Gaps = 23/161 (14%)
 Frame = -3

Query: 414 PKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKP---- 247
           PK+ P V   Y Y  P      PPK P      P   Y P PP    +P P P  P    
Sbjct: 37  PKIVPGVFDGYDYPPPSKAFTLPPKTPVRPQPVPQQTYQPQPPAPTRAPQPRPTPPPQNT 96

Query: 246 ---YKYSSPPP-----------PEHHVSPKPYYHSPPPPKKP-YYYHSPPPPVYSPP-PP 115
              Y Y  P             P   V+P+P   +PP PK P Y Y  P PP   PP  P
Sbjct: 97  VGSYDYPKPQKVVPVVPVVPQRPVQPVAPQPRPTAPPAPKTPGYSYPQPSPPFVQPPKTP 156

Query: 114 YHYSSPPPPPKKPYYYHS-PPPPVYSPP--PPYHYTSPPPP 1
                P PPP  P    +  PPP   PP  P Y Y  P PP
Sbjct: 157 APQPRPTPPPSPPQTTRTFLPPPTRPPPQQPGYSYPQPSPP 197

 Score = 81.6 bits (200), Expect = 5e-14
 Identities = 60/185 (32%), Positives = 76/185 (41%), Gaps = 10/185 (5%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSP--PPKVYPPVSP--PYHYSSPPPP 358
           Y  P   +   P  PP    P     PP+   P +P  PP    P +P  P     P  P
Sbjct: 332 YVPPQTQRPQTPYVPPVTQRPQTPYVPPQTQRPQTPYVPPVTQRPQTPYVPPQTQRPQTP 391

Query: 357 VYSPPKKPYHYSSPPPPVYSP-PPPYHYSSPPPPPKKPYKYSSPPPPEHHVS--PKPYYH 187
            Y PP++P     PP    +P  PP    +P  PP++P     PP  +  V+  P P   
Sbjct: 392 -YVPPQRPQTPYVPPQRPQTPYVPPQRPQTPYVPPQRPQTPYVPPVTQRPVTRPPPPVTP 450

Query: 186 SPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPP---PYHYT 16
            P  P + Y Y  P  P   PP      +PPPPP +P    + PPP   PPP   P  Y 
Sbjct: 451 KPQSPFQGYTYPKPDTPFTLPPAT---RTPPPPPTRP---PTRPPPTRPPPPPTAPSTYL 504

Query: 15  SPPPP 1
            P PP
Sbjct: 505 PPAPP 509

 Score = 78.6 bits (192), Expect = 4e-13
 Identities = 72/250 (28%), Positives = 89/250 (35%), Gaps = 73/250 (29%)
 Frame = -3

Query: 531  YLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVY-PPVSPPPKV--YPPVS---------- 391
            Y+    P     PPV+  P+  PP    P   Y PPV+  P+    PPV+          
Sbjct: 276  YVPPQRPQTPYVPPVTQRPQYVPPQTQRPQTPYVPPVTQRPQTPYVPPVTQRPQTPYVPP 335

Query: 390  ----PPYHYSSP----PPPVYSPPKKPYHYSSPPPPV-------YSPP----------PP 286
                P   Y  P    P   Y PP+     +   PPV       Y PP          PP
Sbjct: 336  QTQRPQTPYVPPVTQRPQTPYVPPQTQRPQTPYVPPVTQRPQTPYVPPQTQRPQTPYVPP 395

Query: 285  YHYSSPPPPPKKPYKYSSPP--------PPEHHVSP-------KPYYHSPPP----PKKP 163
                +P  PP++P     PP        PP+   +P       +P    PPP    P+ P
Sbjct: 396  QRPQTPYVPPQRPQTPYVPPQRPQTPYVPPQRPQTPYVPPVTQRPVTRPPPPVTPKPQSP 455

Query: 162  ---YYY-------------HSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPP 31
               Y Y              +PPPP   PP     + PPPPP  P  Y  P PP   P P
Sbjct: 456  FQGYTYPKPDTPFTLPPATRTPPPPPTRPPTRPPPTRPPPPPTAPSTYLPPAPPTRPPQP 515

Query: 30   PYHYTSPPPP 1
            P     PPPP
Sbjct: 516  PVTRPPPPPP 525

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 62/185 (33%), Positives = 72/185 (38%), Gaps = 22/185 (11%)
 Frame = -3

Query: 513 PPPKVYPPVSP--------PPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPP- 361
           PPP   PP  P        PP V PP  +PPP+  PP  P P+  P   PP     PPP 
Sbjct: 177 PPPTRPPPQQPGYSYPQPSPPFVQPPRPTPPPQTRPP-PPRPQTTPRPPPPIQTRPPPPT 235

Query: 360 -PVYSPPKKPYHYSSPPPPV--------YSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHV 208
            P   PP   Y Y  P  P         Y PP      +P  PP++P     PP     V
Sbjct: 236 TPRPRPPTSGYSYPQPSIPYNPAPTQKPYVPPVTQRPQTPYVPPQRPQTPYVPP-----V 290

Query: 207 SPKPYYHSPPP--PKKPYYYHSPPPPVYSPPPPYHYSSPP--PPPKKPYYYHSPPPPVYS 40
           + +P Y  P    P+ PY     PP    P  PY    PP    P+ PY     PP    
Sbjct: 291 TQRPQYVPPQTQRPQTPYV----PPVTQRPQTPY---VPPVTQRPQTPYV----PPQTQR 339

Query: 39  PPPPY 25
           P  PY
Sbjct: 340 PQTPY 344

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 75/261 (28%), Positives = 92/261 (35%), Gaps = 84/261 (32%)
 Frame = -3

Query: 531 YLYSSPPPPKVYPP-VSPPPKVYPPVYSPP--PKVYPPVS--PPPKVYPPVSPP---YHY 376
           Y Y  P PP V PP  +PPP+  PP   P   P+  PP+   PPP   P   PP   Y Y
Sbjct: 189 YSYPQPSPPFVQPPRPTPPPQTRPPPPRPQTTPRPPPPIQTRPPPPTTPRPRPPTSGYSY 248

Query: 375 SSPP-------------PPV-------YSPPKKPYHYSSPPP---PVYSPPPPYHYSSP- 268
             P              PPV       Y PP++P     PP    P Y PP      +P 
Sbjct: 249 PQPSIPYNPAPTQKPYVPPVTQRPQTPYVPPQRPQTPYVPPVTQRPQYVPPQTQRPQTPY 308

Query: 267 -PPPPKKPYKYSSPP----------PPEHHVSPKPYYHSPPPPKKPYYYHSPP------- 142
            PP  ++P     PP          PP+      PY   PP  ++P   + PP       
Sbjct: 309 VPPVTQRPQTPYVPPVTQRPQTPYVPPQTQRPQTPYV--PPVTQRPQTPYVPPQTQRPQT 366

Query: 141 ---PPV-------------------YSPP--------PPYHYSSPPPPPKKPYYYHSPP- 55
              PPV                   Y PP        PP    +P  PP++P   + PP 
Sbjct: 367 PYVPPVTQRPQTPYVPPQTQRPQTPYVPPQRPQTPYVPPQRPQTPYVPPQRPQTPYVPPQ 426

Query: 54  ---PPVYSPPPPYHYTSPPPP 1
               P   P      T PPPP
Sbjct: 427 RPQTPYVPPVTQRPVTRPPPP 447

[134][TOP]
>UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f.
           nagariensis RepID=Q9SBM1_VOLCA
          Length = 409

 Score =  142 bits (358), Expect = 2e-32
 Identities = 88/187 (47%), Positives = 93/187 (49%), Gaps = 15/187 (8%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP+ P P   PP   PPP V PP  PPP   PP SPP     PPPP  SPP  
Sbjct: 72  PPPPPPQPPLPPSPSPPPP---PPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPP 128

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP---PPPEHHVSPKPYYHSPPPPKK 166
           P     PPPP  +PPPP     PPPPP  P    SP   PPP    SP P   SPPP   
Sbjct: 129 P---PPPPPPPPNPPPP-----PPPPPPSPSPPPSPPPSPPPSPPPSPPP---SPPPSPP 177

Query: 165 PYYYHSPPP-PVYSPPPPYHYSSPPPPPKKPYYYHSPP---PPVYSPP--------PPYH 22
           P    SPPP P  SPPP    S PP PP +P    +PP   PP  SPP        PP+ 
Sbjct: 178 PSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFP 237

Query: 21  YTSPPPP 1
             SPPPP
Sbjct: 238 PPSPPPP 244

 Score =  139 bits (351), Expect = 1e-31
 Identities = 82/174 (47%), Positives = 86/174 (49%), Gaps = 2/174 (1%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP V PP  PPP   PP   PPP   PP  PP    PP  PP    +PPPP   PP  
Sbjct: 90  PPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPS 149

Query: 336 PYHYSSPPP-PVYSPPPPYHYSSPPPPPKKPYKYSSP-PPPEHHVSPKPYYHSPPPPKKP 163
           P    SPPP P  SPPP    S PP PP  P     P PPP    SP P   SPPP   P
Sbjct: 150 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPP---SPPPSPPP 206

Query: 162 YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
               SP PP   PP P   S  PPP + P+   SPPPP   PPPP    +PPPP
Sbjct: 207 RPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPP--RPPPP----APPPP 254

 Score =  139 bits (350), Expect = 2e-31
 Identities = 78/173 (45%), Positives = 82/173 (47%), Gaps = 1/173 (0%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP  PPP   PP   PPP   PP SP P   PP SPP      PPP   P   
Sbjct: 118 PPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPP 177

Query: 336 PYHYSSPPP-PVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
           P    SPPP P  SPPP    S PP PP +P    +PP P    SP P    PPP + P+
Sbjct: 178 PSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPP-SPSPPSPRPPPRRPPF 236

Query: 159 YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
              SPPPP   PP P     PPP P  P      PPP   PPP     SPPPP
Sbjct: 237 PPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPP 289

 Score =  136 bits (343), Expect = 1e-30
 Identities = 85/187 (45%), Positives = 88/187 (47%), Gaps = 16/187 (8%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYS-----------PPPKVYPPV----SPPPKVYPPVSPPYH 379
           PPP   PP +PPP V PP  S           PPP   PP+    SPPP   PPV PP  
Sbjct: 41  PPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPP 100

Query: 378 YSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPK 199
              PPPP  SPP  P     PPPP  SPPPP     PPPPP  P     PPPP    SP 
Sbjct: 101 PPPPPPPPPSPPPPP---PPPPPPPPSPPPP----PPPPPPPPPNPPPPPPPPPPSPSPP 153

Query: 198 PYYHSPPPPKKPYYYHSPPP-PVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYH 22
           P   SPPP   P    SPPP P  SPPP    S PP PP  P     P PP   PP P  
Sbjct: 154 P---SPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPP 210

Query: 21  YTSPPPP 1
             +PP P
Sbjct: 211 SPNPPSP 217

 Score =  135 bits (339), Expect = 4e-30
 Identities = 83/175 (47%), Positives = 88/175 (50%), Gaps = 3/175 (1%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPPP   PP SPPP   PP   PP    PP  PPP   PP SPP   S PP P  SPP  
Sbjct: 114 PPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPP--SPPPSPPPSPPPS 171

Query: 336 PYHYSSPPPPVYSPPPPYHYSSP---PPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
           P    SPPP     PPP    SP   PPP   P     PPP  +  SP+P   SPP P+ 
Sbjct: 172 PP--PSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRP 229

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           P     PP P  SPPPP      PPPP+ P    SPPPP+  PPPP    SPPPP
Sbjct: 230 P--PRRPPFPPPSPPPPRPPPPAPPPPRPP--PPSPPPPL--PPPP----SPPPP 274

 Score =  134 bits (337), Expect = 6e-30
 Identities = 78/173 (45%), Positives = 88/173 (50%), Gaps = 3/173 (1%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPK--VYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           PPP   PP   PP   PP   PPP+   +PP SPPP   PP +PP     PPPP   PP 
Sbjct: 208 PPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPP--PRPPPPSPPPPL 265

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
            P    SPPPP+  PP P   S PPP P  P      P P ++  P+P   +PPPP+ P 
Sbjct: 266 PPP--PSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPP 323

Query: 159 YYHSPP-PPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
              +PP PP  SPPPP     PPP P  P     PPPP  SPP P    SPPP
Sbjct: 324 PSPNPPRPPPPSPPPP---RPPPPSPNPP----RPPPPSPSPPKPPPPPSPPP 369

 Score =  133 bits (335), Expect = 1e-29
 Identities = 82/182 (45%), Positives = 88/182 (48%), Gaps = 7/182 (3%)
 Frame = -3

Query: 528 LYSSPPPPKVYPPVSPPPKVYPPVY------SPPPKVYPPVSPPPKVYPPV-SPPYHYSS 370
           L +S P     P   PPP+  P V       +PPP   PP +PPP V PP  S P H   
Sbjct: 9   LLASSPHALGAPARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPP 68

Query: 369 PPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYY 190
           PPPP   PP+ P   S  PPP   PPPP     PPPPP  P   S PPPP     P P  
Sbjct: 69  PPPPPPPPPQPPLPPSPSPPP---PPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPP-- 123

Query: 189 HSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSP 10
            SPPPP  P     PPPP  +PPPP     PPPPP  P    SPPP     PPP    SP
Sbjct: 124 -SPPPPPPP-----PPPPPPNPPPP-----PPPPPPSPSPPPSPPPSPPPSPPPSPPPSP 172

Query: 9   PP 4
           PP
Sbjct: 173 PP 174

 Score =  130 bits (327), Expect = 9e-29
 Identities = 87/175 (49%), Positives = 95/175 (54%), Gaps = 1/175 (0%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYP-PVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           S PP P   PP SPPP   P P  SPPP   PP SPPP+  PP SPP   S PP P  SP
Sbjct: 151 SPPPSPPPSPPPSPPPSPPPSPPPSPPPS--PPPSPPPR--PPPSPP--PSPPPSPPPSP 204

Query: 345 PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
           P +P    SP PP   PP P   S  PPP + P+   SPPP      P+P   +PPPP+ 
Sbjct: 205 PPRP--PPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPP------PRPPPPAPPPPRP 256

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
           P    SPPPP+  PPPP   S PPP P  P    SPPPP  SPPPP    SP PP
Sbjct: 257 P--PPSPPPPL--PPPP---SPPPPLPPPP----SPPPP--SPPPP----SPLPP 294

 Score =  127 bits (320), Expect = 6e-28
 Identities = 78/172 (45%), Positives = 87/172 (50%), Gaps = 1/172 (0%)
 Frame = -3

Query: 519 SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           SPPPP+  PP  PPP+  PP  SPPP + PP SPPP + PP SPP    SPPPP   PP 
Sbjct: 240 SPPPPRPPPPAPPPPRPPPP--SPPPPLPPPPSPPPPLPPPPSPP--PPSPPPPSPLPP- 294

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
                 SP PP   P PP +    PPPP  P     PP P     P+P   SPPPP+ P 
Sbjct: 295 ------SPRPP--KPSPPNNPFPRPPPPNPPPPRPPPPSPN---PPRPPPPSPPPPRPPP 343

Query: 159 YYHSPP-PPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPP 7
              +PP PP  SP PP     PPPPP  P     P PP   P PP    + P
Sbjct: 344 PSPNPPRPPPPSPSPP----KPPPPPSPP-----PRPPRRPPRPPRRPPTAP 386

 Score =  127 bits (319), Expect = 7e-28
 Identities = 84/191 (43%), Positives = 94/191 (49%), Gaps = 17/191 (8%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYP-PVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           S PP P   PP SPPP+  P P  SPPP   PP SPPP+  P  +PP    SP PP  SP
Sbjct: 171 SPPPSPPPSPPPSPPPRPPPSPPPSPPPS--PPPSPPPRPPPSPNPP----SPRPPSPSP 224

Query: 345 P-------KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYH 187
           P       + P+   SPPPP   PPPP      PPPP  P     PP P   + P P   
Sbjct: 225 PSPRPPPRRPPFPPPSPPPP--RPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPP--- 279

Query: 186 SPPPPKKPYYYHSPPPPVYSPPPPYHYSSP--------PPPPKKPYYYHSPP-PPVYSPP 34
           SPPPP  P    SP PP   PP P   ++P        PPPP+ P    +PP PP  SPP
Sbjct: 280 SPPPPSPP--PPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPP 337

Query: 33  PPYHYTSPPPP 1
           PP     PPPP
Sbjct: 338 PP----RPPPP 344

 Score =  124 bits (310), Expect = 8e-27
 Identities = 79/185 (42%), Positives = 85/185 (45%), Gaps = 11/185 (5%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPKVYP-PVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSP-----PP 361
           S PP P   PP SPPP   P P  SPPP+  P  +PP    P  SPP     P     PP
Sbjct: 179 SPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPP 238

Query: 360 PVYSPPKKPYHYSSPP-PPVYSPPPPYHYSSPPPPPKKPYKYSSP--PPPEHHVSPKPYY 190
           P   PP+ P     PP PP  SPPPP      PPPP  P     P  PPP   + P P  
Sbjct: 239 PSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRP 298

Query: 189 HSPPPPKKPYYYHSPP-PPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPP-PPYHYT 16
             P PP  P+    PP PP   PPPP      PPPP  P     PPPP  +PP PP    
Sbjct: 299 PKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPP--PPRPPPPSPNPPRPPPPSP 356

Query: 15  SPPPP 1
           SPP P
Sbjct: 357 SPPKP 361

 Score =  109 bits (272), Expect = 2e-22
 Identities = 69/164 (42%), Positives = 75/164 (45%), Gaps = 2/164 (1%)
 Frame = -3

Query: 486 SPPPKVYPPVYSPPPKVYPPVS--PPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPP 313
           S P  +  P   PPP+  P V+    P   PP SPP    +PPP V  PP  P     PP
Sbjct: 12  SSPHALGAPARKPPPRRSPVVALVETPAAPPPGSPPP--GTPPPGV--PPPTPSGPEHPP 67

Query: 312 PPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPV 133
           PP    PPP     PPPPP+ P   S  PPP            PPPP  P     PPPP 
Sbjct: 68  PP----PPP-----PPPPPQPPLPPSPSPPP------------PPPPPVP-----PPPPP 101

Query: 132 YSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
             PPPP     PPPPP  P     PPPP   PPPP +   PPPP
Sbjct: 102 PPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPP 145

 Score = 74.7 bits (182), Expect = 6e-12
 Identities = 46/100 (46%), Positives = 53/100 (53%), Gaps = 4/100 (4%)
 Frame = -3

Query: 534 SYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPV 355
           S L  SP PPK  PP +P P+  PP  +PPP   PP SP P   PP SPP     PPPP 
Sbjct: 290 SPLPPSPRPPKPSPPNNPFPRPPPP--NPPPPRPPPPSPNPPRPPPPSPPP--PRPPPPS 345

Query: 354 YSPPKKPYHYSSPP----PPVYSPPPPYHYSSPPPPPKKP 247
            +PP+ P    SPP    PP   P PP     PP PP++P
Sbjct: 346 PNPPRPPPPSPSPPKPPPPPSPPPRPP---RRPPRPPRRP 382

[135][TOP]
>UniRef100_Q41402 Nodulin n=1 Tax=Sesbania rostrata RepID=Q41402_SESRO
          Length = 330

 Score =  142 bits (357), Expect = 3e-32
 Identities = 111/265 (41%), Positives = 120/265 (45%), Gaps = 62/265 (23%)
 Frame = -3

Query: 612 SLMASTTFTLLVALVSLTLPSLISANSY---------LYSSPP----PPKVY-PPVSPPP 475
           SL  S    LL+ +V LT P L  AN Y          Y  PP    PP VY PP+ PPP
Sbjct: 3   SLHYSLVTLLLLGVVMLTTPVL--ANYYEPPPIEKPPTYEPPPTYEKPPPVYKPPIFPPP 60

Query: 474 -KVYPPVYSPPPKVYPPVSPPPKVYPP--VSPPYHYSSPPPPVYSPP--KKPYHYSSP-- 316
            +  PPVYSPP +  PPV PPP   PP    PPY     PPP Y PP  K P  Y  P  
Sbjct: 61  YEKPPPVYSPPYEKPPPVYPPPYEKPPPVYPPPY---EKPPPEYQPPHEKPPPEYQPPHE 117

Query: 315 -PPPVYSPP---PPYHYSSPPPPPKKPYKYSSP---PPPEH---HVSPKPYYHSP---PP 175
            PPP Y PP   PP  Y   PP  K P +Y  P   PPPE+   H  P P Y  P   PP
Sbjct: 118 NPPPEYQPPHEKPPPEYQ--PPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPQEKPP 175

Query: 174 PKKPYYYHSPP---PPVYSPPPPYH--------YSSPP---PPPKKPYY----YHSPP-- 55
           P  P  Y  PP   PP Y  PPPY         Y  PP   PP +KP Y    Y  PP  
Sbjct: 176 PVYPPPYEKPPHEKPPSYEKPPPYEKPPHEKPPYEKPPHEKPPHEKPPYDKPPYEKPPHE 235

Query: 54  ------PPVYSPPPPYH--YTSPPP 4
                 PP   PPP Y   +  PPP
Sbjct: 236 KPPHEKPPHEKPPPEYKPPHEKPPP 260

 Score =  139 bits (349), Expect = 2e-31
 Identities = 90/211 (42%), Positives = 101/211 (47%), Gaps = 37/211 (17%)
 Frame = -3

Query: 525 YSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPP-VSPPPKVYPP-VSPPYHYSSP---PP 361
           Y  PPP    P   PPP+  PP  +PPP+  PP   PPP+  PP   PP  Y  P   PP
Sbjct: 94  YEKPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPP 153

Query: 360 PVYSPP--KKPYHYSSP---PPPVYSPP---PPYH----YSSPPPPPKKPYK---YSSPP 226
           P Y PP  K P  Y  P   PPPVY PP   PP+     Y  PPP  K P++   Y  PP
Sbjct: 154 PEYQPPHEKPPPEYQPPQEKPPPVYPPPYEKPPHEKPPSYEKPPPYEKPPHEKPPYEKPP 213

Query: 225 --PPEHHVSP--KPYYHSPPPPKKPYYY--HSPPPPVYSPP---PPYHYSSP---PPPPK 82
              P H   P  KP Y  PP  K P+    H  PPP Y PP   PP  Y  P   PPP +
Sbjct: 214 HEKPPHEKPPYDKPPYEKPPHEKPPHEKPPHEKPPPEYKPPHEKPPPEYKPPHEKPPPYE 273

Query: 81  KPYYYHSPP---PPVYSPPPPYH--YTSPPP 4
           KP +   PP   PP   PPPP +  Y  PPP
Sbjct: 274 KPPHEKPPPEYKPPHEKPPPPEYPPYVKPPP 304

 Score =  131 bits (330), Expect = 4e-29
 Identities = 90/218 (41%), Positives = 98/218 (44%), Gaps = 49/218 (22%)
 Frame = -3

Query: 513 PPPKVYPP-VSPPPKVYPPVYSPPPKVYPP-VSPPPKVYPP-VSPPYHYSSP---PPPVY 352
           PPP+  PP   PPP+  PP   PPP+  PP   PPP+  PP   PP  Y  P   PPPVY
Sbjct: 119 PPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPPVY 178

Query: 351 SPPKKPYHYSSPP---PPVYSPPPPYH--------YSSPP---PPPKKPYKYSSPP--PP 220
            PP     Y  PP   PP Y  PPPY         Y  PP   PP +KP  Y  PP   P
Sbjct: 179 PPP-----YEKPPHEKPPSYEKPPPYEKPPHEKPPYEKPPHEKPPHEKP-PYDKPPYEKP 232

Query: 219 EHHVSP--KPYYHSPPPPKKPYYYHSPPPPVYSPP--------------PPYHYSSP--- 97
            H   P  KP +  PPP  KP   H  PPP Y PP              PP  Y  P   
Sbjct: 233 PHEKPPHEKPPHEKPPPEYKP--PHEKPPPEYKPPHEKPPPYEKPPHEKPPPEYKPPHEK 290

Query: 96  PPPPKKPYYYHSPP--------PPVYSPPPPYHYTSPP 7
           PPPP+ P Y   PP        PP Y+PPP  HY  PP
Sbjct: 291 PPPPEYPPYVKPPPEYKPPHEKPPGYNPPPYGHY--PP 326

 Score =  113 bits (283), Expect = 1e-23
 Identities = 75/178 (42%), Positives = 83/178 (46%), Gaps = 33/178 (18%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVYPPV--SPPPKVYPP-VSPPYH--------YSSP 367
           PPP+  PP   PP VYPP Y  PP   PP    PPP   PP   PPY         +  P
Sbjct: 163 PPPEYQPPQEKPPPVYPPPYEKPPHEKPPSYEKPPPYEKPPHEKPPYEKPPHEKPPHEKP 222

Query: 366 P---PPVYSPP-KKPYHYSSP---PPPVYSPPPPYHYSSPP---PPPKKPYKYSSPP--- 226
           P   PP   PP +KP H   P   PPP Y PP   H   PP   PP +KP  Y  PP   
Sbjct: 223 PYDKPPYEKPPHEKPPHEKPPHEKPPPEYKPP---HEKPPPEYKPPHEKPPPYEKPPHEK 279

Query: 225 -PPEHHVSPKPYYHSPPPPKKPYYYHSPP--------PPVYSPPPPYHYSSPPPPPKK 79
            PPE+    KP +  PPPP+ P Y   PP        PP Y+PPP  HY    PP KK
Sbjct: 280 PPPEY----KPPHEKPPPPEYPPYVKPPPEYKPPHEKPPGYNPPPYGHY----PPSKK 329

 Score = 72.0 bits (175), Expect = 4e-11
 Identities = 47/105 (44%), Positives = 50/105 (47%), Gaps = 13/105 (12%)
 Frame = -3

Query: 525 YSSPP---PPKVYPP-VSPPPKVYPPVYSPPPKVYPP-VSPPPKVYPP-VSPPYHYS--- 373
           Y  PP   PP   PP   PPP+  PP   PPP+  PP   PPP   PP   PP  Y    
Sbjct: 229 YEKPPHEKPPHEKPPHEKPPPEYKPPHEKPPPEYKPPHEKPPPYEKPPHEKPPPEYKPPH 288

Query: 372 -SPPPPVYSPPKKPYHYSSPP---PPVYSPPPPYHYSSPPPPPKK 250
             PPPP Y P  KP     PP   PP Y+PPP  HY    PP KK
Sbjct: 289 EKPPPPEYPPYVKPPPEYKPPHEKPPGYNPPPYGHY----PPSKK 329

[136][TOP]
>UniRef100_C1PGW1 Tracheary element differentiation-related 7A n=1 Tax=Zinnia
           violacea RepID=C1PGW1_ZINEL
          Length = 300

 Score =  142 bits (357), Expect = 3e-32
 Identities = 83/195 (42%), Positives = 97/195 (49%), Gaps = 9/195 (4%)
 Frame = -3

Query: 558 LPSLISANSYLYSSPPPPKVYPPVSPPPKVYPPVY--SPPPKVYPPVSPPPKVYPPVSP- 388
           + S +S + + +  PP P   PP +P     PP +  SPPP   PP SPP  V PP+ P 
Sbjct: 1   MASPLSQSVFPHFPPPSPAATPPPAPTTPSTPPPHFISPPPHSVPPPSPPHSVPPPLHPV 60

Query: 387 ----PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPP 220
               P H  SPPP    PP  P H  SPPP    PP P H   PPP       ++ PPP 
Sbjct: 61  PPPSPPHPVSPPPHTVPPPSPP-HPVSPPPHTVPPPSPPHPVFPPP-------HTVPPPS 112

Query: 219 EHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY- 43
            H V P P  +  PPP  P+    PPPP +S PPP H   PPPPP      H  PPP + 
Sbjct: 113 PHFVPPPP--NMVPPPSPPHANPPPPPPPHSVPPPPHTVPPPPPPP-----HIIPPPAHA 165

Query: 42  -SPPPPYHYTSPPPP 1
            SPPPP H   PPPP
Sbjct: 166 LSPPPP-HIIPPPPP 179

 Score =  134 bits (338), Expect = 5e-30
 Identities = 69/147 (46%), Positives = 77/147 (52%), Gaps = 4/147 (2%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYS-PPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKK 337
           PPP   PP SPP  V PP++  PPP    PVSPPP   PP SPP+  S PP  V  PP  
Sbjct: 39  PPPHSVPPPSPPHSVPPPLHPVPPPSPPHPVSPPPHTVPPPSPPHPVSPPPHTV--PPPS 96

Query: 336 PYHYSSPPPPVYSPPPPYHYSSPP---PPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
           P H   PPP    PP P+    PP   PPP  P+    PPPP H V P P  H+ PPP  
Sbjct: 97  PPHPVFPPPHTVPPPSPHFVPPPPNMVPPPSPPHANPPPPPPPHSVPPPP--HTVPPPPP 154

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPPP 85
           P +   PP    SPPPP+    PPP P
Sbjct: 155 PPHIIPPPAHALSPPPPHIIPPPPPSP 181

 Score =  108 bits (270), Expect = 4e-22
 Identities = 64/146 (43%), Positives = 73/146 (50%), Gaps = 8/146 (5%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPV-----YSPPPKVYPPVSPPPKVYPP---VSPPYHYSSPPPP 358
           PPP    PVSPPP   PP       SPPP   PP SPP  V+PP   V PP  +  PPPP
Sbjct: 61  PPPSPPHPVSPPPHTVPPPSPPHPVSPPPHTVPPPSPPHPVFPPPHTVPPPSPHFVPPPP 120

Query: 357 VYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPP 178
              PP  P H + PPPP     PP+    PPPP   P     PPPP H + P  +  SPP
Sbjct: 121 NMVPPPSPPHANPPPPP-----PPHSV--PPPPHTVP----PPPPPPHIIPPPAHALSPP 169

Query: 177 PPKKPYYYHSPPPPVYSPPPPYHYSS 100
           PP      H  PPP   PP P ++S+
Sbjct: 170 PP------HIIPPP---PPSPSNHST 186

[137][TOP]
>UniRef100_Q9SPM0 Extensin-like protein n=1 Tax=Zea mays RepID=Q9SPM0_MAIZE
          Length = 1016

 Score =  141 bits (355), Expect = 5e-32
 Identities = 89/200 (44%), Positives = 105/200 (52%), Gaps = 12/200 (6%)
 Frame = -3

Query: 564  LTLPSLIS--ANSYLYSSPPPPKVYPPVSPPP-KVYPPVYSPPPKVYPPVSPPPKVYPP- 397
            + +P+L S  A+ Y+ + P P K  P  SPP  +  PP+ + PP    P + P K  PP 
Sbjct: 465  MRMPTLRSPPADEYIPTPPVPAKSPPGTSPPASRGAPPLQAQPPAASSPPATPVKSSPPP 524

Query: 396  ----VSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSP 229
                + PP    SPP PV SPP +    SSP P V SPPPP   +SPPPP K      SP
Sbjct: 525  AAVVLPPPAKTPSPPAPVASPPPEA-PVSSPQPQVKSPPPPAPVASPPPPMK------SP 577

Query: 228  PPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPP----PPPKKPYYYHS 61
            PPP    SP P   SPPPP       SPP P+ SPPPP  + S P    PPP  P    S
Sbjct: 578  PPPARVASPPPLMKSPPPPAP---VASPPQPLKSPPPPVLWLSTPSVKSPPPPVPVA--S 632

Query: 60   PPPPVYSPPPPYHYTSPPPP 1
            PPPPV SPPP    +SP PP
Sbjct: 633  PPPPVKSPPPLAPVSSPSPP 652

 Score =  137 bits (346), Expect = 5e-31
 Identities = 98/220 (44%), Positives = 110/220 (50%), Gaps = 35/220 (15%)
 Frame = -3

Query: 555  PSLISANSYLYSSPPP---------PKVYPPVSP---PPKVYP------PVYSPPP--KV 436
            P+ +S+   L SSPPP         PK  PP++P   PP+V        PV SPPP  K 
Sbjct: 748  PAPVSSPPPLKSSPPPVPESSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKS 807

Query: 435  YPPVSP---PPKVYPPVSPPYHYSSPPP-PVYSPPKKPYHYSSPPPPVYSPPPPYHYSSP 268
             PP++P   PP+V     PP   SSPPP P  SPP  P   SSPP    + PPP   SSP
Sbjct: 808  SPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKSSPPLAPV--SSPPQVEKTSPPPAPVSSP 865

Query: 267  PPPPKK----------PYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPP 118
            PP PK           P +  S PPP    SP P   SPPPP       S PPPV SPPP
Sbjct: 866  PPTPKPLPPPAPVSLPPPEVKSSPPPAPISSPPPPAKSPPPPAP---MSSLPPPVKSPPP 922

Query: 117  PYHYSSPPPPPKKPYYYHSPPPPVYSPPP-PYHYTSPPPP 1
            P   SSPPPP K P     PP P+ SPPP P    S PPP
Sbjct: 923  PAPVSSPPPPMKSP----PPPAPISSPPPAPVKPPSLPPP 958

 Score =  126 bits (317), Expect = 1e-27
 Identities = 83/200 (41%), Positives = 94/200 (47%), Gaps = 26/200 (13%)
 Frame = -3

Query: 522  SSPPPPKVY-PPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
            SSPPP  V  PP +  P    PV SPPP+  P  SP P+V  P  PP   +SPPPP+ SP
Sbjct: 520  SSPPPAAVVLPPPAKTPSPPAPVASPPPEA-PVSSPQPQVKSP-PPPAPVASPPPPMKSP 577

Query: 345  PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPY---------KYSSPPPPEHHVSPKPY 193
            P  P   +SPPP + SPPPP   +SPP P K P             SPPPP    SP P 
Sbjct: 578  PP-PARVASPPPLMKSPPPPAPVASPPQPLKSPPPPVLWLSTPSVKSPPPPVPVASPPPP 636

Query: 192  YHSPPP------PKKPYYY--------HSPPPPVYSPPPPYHYSSPPPPPKK--PYYYHS 61
              SPPP      P  P            +PPP    P PP    S PPP K   P    +
Sbjct: 637  VKSPPPLAPVSSPSPPVKLPPLPAPGKSTPPPEEEKPTPPTPVKSSPPPEKSLPPPTLTT 696

Query: 60   PPPPVYSPPPPYHYTSPPPP 1
             PPP   P PP   + PPPP
Sbjct: 697  SPPPQEKPTPPSTPSKPPPP 716

 Score =  126 bits (317), Expect = 1e-27
 Identities = 87/194 (44%), Positives = 94/194 (48%), Gaps = 20/194 (10%)
 Frame = -3

Query: 522  SSPPP-PKVYPPVSP---PPKVYP------PVYSPPPKVYP-----PVSPPPKVYPPVSP 388
            SSPPP PK  PP++P   PP+V        PV SPPP   P     PVS PP       P
Sbjct: 831  SSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKPLPPPAPVSLPPPEVKSSPP 890

Query: 387  PYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHV 208
            P   SSPPPP  SPP  P   SS PPPV SPPPP   SSPPPP K      SPPPP    
Sbjct: 891  PAPISSPPPPAKSPPP-PAPMSSLPPPVKSPPPPAPVSSPPPPMK------SPPPPAPIS 943

Query: 207  SPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYS---- 40
            SP P    PP    P    SPPP V S PP     S  PP +      + PPP ++    
Sbjct: 944  SPPPAPVKPPSLPPPAPVSSPPPAVTSAPPKKEEDSTAPPAE------ALPPPSFNDIIL 997

Query: 39   -PPPPYHYTSPPPP 1
             P     Y SPPPP
Sbjct: 998  PPIMANKYASPPPP 1011

 Score =  125 bits (314), Expect = 3e-27
 Identities = 96/241 (39%), Positives = 102/241 (42%), Gaps = 65/241 (26%)
 Frame = -3

Query: 528  LYSSPPP---------PKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHY 376
            L +SPPP         P   PP SP   + PP  S PP+   PVS PP+     SPP   
Sbjct: 694  LTTSPPPQEKPTPPSTPSKPPPPSPVETLPPPSKSSPPE--EPVSSPPQAPKSSSPPAPV 751

Query: 375  SSPPP------------------------PVYSPPK------KPYHYSSPPP-------- 310
            SSPPP                        PV SPP+       P   SSPPP        
Sbjct: 752  SSPPPLKSSPPPVPESSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKSSPPL 811

Query: 309  -PVYSP-------PPPYHYSSPPPPPKK--PYKYSSPPPPEHHVSPKPYYHSPPPP---- 172
             PV SP       PPP   SSPPP PK   P    S PP     SP P   S PPP    
Sbjct: 812  APVSSPPQVEKTSPPPAPVSSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKP 871

Query: 171  -KKPYYYHSPPPPVYSPPPPYHYSSPPPP---PKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
               P     PPP V S PPP   SSPPPP   P  P    S PPPV SPPPP   +SPPP
Sbjct: 872  LPPPAPVSLPPPEVKSSPPPAPISSPPPPAKSPPPPAPMSSLPPPVKSPPPPAPVSSPPP 931

Query: 3    P 1
            P
Sbjct: 932  P 932

 Score =  123 bits (309), Expect = 1e-26
 Identities = 85/207 (41%), Positives = 92/207 (44%), Gaps = 36/207 (17%)
 Frame = -3

Query: 513  PPPKVYPPVS------------PPPKVYPPVYSPPPKVYPPVSPPPKVYPP-VSPPYHYS 373
            P P   P VS            P P   P + SPP   Y P  P P   PP  SPP    
Sbjct: 440  PTPHTPPDVSPEPLPEPSPVPAPAPMRMPTLRSPPADEYIPTPPVPAKSPPGTSPPASRG 499

Query: 372  SP-----PPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPP-----PPPKKPY-----KY 238
            +P     PP   SPP  P   SSPPP     PPP    SPP     PPP+ P      + 
Sbjct: 500  APPLQAQPPAASSPPATPVK-SSPPPAAVVLPPPAKTPSPPAPVASPPPEAPVSSPQPQV 558

Query: 237  SSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSP 58
             SPPPP    SP P   SPPPP +     SPPP + SPPPP   +SPP P K      SP
Sbjct: 559  KSPPPPAPVASPPPPMKSPPPPAR---VASPPPLMKSPPPPAPVASPPQPLK------SP 609

Query: 57   PPPVY--------SPPPPYHYTSPPPP 1
            PPPV         SPPPP    SPPPP
Sbjct: 610  PPPVLWLSTPSVKSPPPPVPVASPPPP 636

 Score =  121 bits (304), Expect = 4e-26
 Identities = 90/220 (40%), Positives = 100/220 (45%), Gaps = 48/220 (21%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVY----PPV--SPPPKVYPPVSPPYHYSSPPPP 358
            SPPPP    PV+ PP   PP+ SPPP       PP+  SPPP   P  SPP    SPPPP
Sbjct: 560  SPPPPA---PVASPP---PPMKSPPPPARVASPPPLMKSPPPPA-PVASPPQPLKSPPPP 612

Query: 357  VY--------SPPKKPYHYSSPPPPVYSPPPPYHYSSPPPP------------------- 259
            V         SPP  P   +SPPPPV SPPP    SSP PP                   
Sbjct: 613  VLWLSTPSVKSPPP-PVPVASPPPPVKSPPPLAPVSSPSPPVKLPPLPAPGKSTPPPEEE 671

Query: 258  -PKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSP-----PPPVYSPPPPYH---- 109
             P  P    S PPPE  + P     SPPP +KP    +P     P PV + PPP      
Sbjct: 672  KPTPPTPVKSSPPPEKSLPPPTLTTSPPPQEKPTPPSTPSKPPPPSPVETLPPPSKSSPP 731

Query: 108  ---YSSPPPPPK--KPYYYHSPPPPVYSPPPPYHYTSPPP 4
                SSPP  PK   P    S PPP+ S PPP   +SPPP
Sbjct: 732  EEPVSSPPQAPKSSSPPAPVSSPPPLKSSPPPVPESSPPP 771

 Score =  105 bits (261), Expect = 4e-21
 Identities = 90/222 (40%), Positives = 94/222 (42%), Gaps = 49/222 (22%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVY------------SPPP-KVYPP----VSPPPKVYPPV 394
            SSP PP   PP+  P K  PP              SPPP K  PP     SPPP+  P  
Sbjct: 647  SSPSPPVKLPPLPAPGKSTPPPEEEKPTPPTPVKSSPPPEKSLPPPTLTTSPPPQEKP-- 704

Query: 393  SPPYHYSSPPPPVYSPPKKPYHYSSPPP-PVYSPP-------PPYHYSSPPP----PPKK 250
            +PP   S PPPP       P   SSPP  PV SPP       PP   SSPPP    PP  
Sbjct: 705  TPPSTPSKPPPPSPVETLPPPSKSSPPEEPVSSPPQAPKSSSPPAPVSSPPPLKSSPP-- 762

Query: 249  PYKYSSPPPPEHHVSPKPYYHSPPPPKK----PYYYHSPPP---------PVYSP----- 124
            P   SSPPP      P     SPP  +K    P    SPPP         PV SP     
Sbjct: 763  PVPESSPPPTPKSSPPLAPVSSPPQVEKTSPPPAPVSSPPPTPKSSPPLAPVSSPPQVEK 822

Query: 123  --PPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
              PPP   SSPPP PK      SPP    S PP    TSPPP
Sbjct: 823  TSPPPAPVSSPPPTPKS-----SPPLAPVSSPPQVEKTSPPP 859

 Score = 96.3 bits (238), Expect = 2e-18
 Identities = 70/167 (41%), Positives = 77/167 (46%), Gaps = 7/167 (4%)
 Frame = -3

Query: 522  SSPPP-PKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
            SSPPP PK  PP +P     P V S PP       PPP   PP  PP   SS PPPV SP
Sbjct: 863  SSPPPTPKPLPPPAPVSLPPPEVKSSPPPAPISSPPPPAKSPP--PPAPMSSLPPPVKSP 920

Query: 345  P------KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHS 184
            P        P    SPPPP          SSPPP P KP    S PPP    SP P   S
Sbjct: 921  PPPAPVSSPPPPMKSPPPPAP-------ISSPPPAPVKP---PSLPPPAPVSSPPPAVTS 970

Query: 183  PPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY 43
             PP K+     S  PP  + PPP  ++    PP     Y SPPPP++
Sbjct: 971  APPKKEE---DSTAPPAEALPPP-SFNDIILPPIMANKYASPPPPLF 1013

 Score = 89.0 bits (219), Expect = 3e-16
 Identities = 60/151 (39%), Positives = 72/151 (47%), Gaps = 2/151 (1%)
 Frame = -3

Query: 576  ALVSLTLPSLISAN--SYLYSSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVY 403
            A VSL  P + S+   + + S PPP K  PP +P   + PPV SPPP       PPP   
Sbjct: 876  APVSLPPPEVKSSPPPAPISSPPPPAKSPPPPAPMSSLPPPVKSPPPPAPVSSPPPPMKS 935

Query: 402  PPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPP 223
            PP  PP   SSPPP    PP  P     PP PV SPPP    +    PPKK  +  S  P
Sbjct: 936  PP--PPAPISSPPPAPVKPPSLP-----PPAPVSSPPP----AVTSAPPKK--EEDSTAP 982

Query: 222  PEHHVSPKPYYHSPPPPKKPYYYHSPPPPVY 130
            P   + P  +     PP     Y SPPPP++
Sbjct: 983  PAEALPPPSFNDIILPPIMANKYASPPPPLF 1013

 Score = 68.2 bits (165), Expect = 5e-10
 Identities = 50/148 (33%), Positives = 55/148 (37%), Gaps = 4/148 (2%)
 Frame = -3

Query: 435 YPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPP 256
           YP    PP    P  PP   S P  P    P    H    PP V   P P     P P P
Sbjct: 411 YPTPGGPPSSSVPGKPP---SVPGKPAAPAPMPTPH---TPPDVSPEPLPEPSPVPAPAP 464

Query: 255 KKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSPP----PPVYSPPPPYHYSSPPPP 88
            +     SPP  E+  +P     SPP    P    +PP    PP  S PP     S PPP
Sbjct: 465 MRMPTLRSPPADEYIPTPPVPAKSPPGTSPPASRGAPPLQAQPPAASSPPATPVKSSPPP 524

Query: 87  PKKPYYYHSPPPPVYSPPPPYHYTSPPP 4
                     PPP  +P PP    SPPP
Sbjct: 525 AAVVL-----PPPAKTPSPPAPVASPPP 547

[138][TOP]
>UniRef100_O49151 Early nodulin (Fragment) n=1 Tax=Maackia amurensis
           RepID=O49151_9FABA
          Length = 447

 Score =  140 bits (354), Expect = 6e-32
 Identities = 87/202 (43%), Positives = 95/202 (47%), Gaps = 32/202 (15%)
 Frame = -3

Query: 513 PPPKVYPPVS-PPPKVYPPVYSPPPKVYPPVSPPPKVYPP--VSPPYHYSSP---PPPVY 352
           PPP   PP+  PPP   PP   PPP+  PP   PP +YPP    PP  Y  P   PPPVY
Sbjct: 232 PPPHEKPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVY 291

Query: 351 SPP--KKPYHYSSP---PPPVYSPP--------PPYHYSSP---PPPPKK-----PYKYS 235
            PP  K P  Y  P   PPPVY PP        PP H   P   PPP +K        Y 
Sbjct: 292 QPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYE 351

Query: 234 SPPPPEHHVSPKPYYHSPPPPKKPYYYHSPP--PPVYSPPPPYHYSSPPPPPKKPYYYHS 61
            PPP       KP    PPP +KP Y   PP  PP Y  PPP +   PPP   KP ++  
Sbjct: 352 KPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLY---PPPHHHKPPHHEK 408

Query: 60  PP---PPVYSPPPPYHYTSPPP 4
           PP   PPVY PPP      PPP
Sbjct: 409 PPFYKPPVYEPPP---LEKPPP 427

 Score =  140 bits (353), Expect = 8e-32
 Identities = 96/237 (40%), Positives = 102/237 (43%), Gaps = 67/237 (28%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYS-PPPKVYPPVSPPPKVYPPV--SPPYHYSSP---PPPVY 352
           PPP+  PP   PP  +PP Y  PPP+  PP   PP +YPP    PP  Y  P   PPPVY
Sbjct: 106 PPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVY 165

Query: 351 SPP--KKPYHYSSP---PPPVYSPP-------------------PPYHYSSPP------- 265
            PP  K P  Y  P   PPPVY PP                   PP H   PP       
Sbjct: 166 QPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYE 225

Query: 264 -PPPKKPYKYSSPP---PPEHHVSP--------KPYYHSPPP------PKKPYYY---HS 148
            PPP  P  +  PP   PP H   P        +P Y  PPP       K P  Y   H 
Sbjct: 226 KPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHE 285

Query: 147 PPPPVYSPP---PPYHYSSPPPPPKKPYYYHSP---PPPVYSPP---PPYHYTSPPP 4
            PPPVY PP   PP  Y  PPP  K P  Y  P   PPPVY PP   PP  Y  PPP
Sbjct: 286 KPPPVYQPPYEKPPIEY--PPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEY--PPP 338

 Score =  139 bits (349), Expect = 2e-31
 Identities = 87/196 (44%), Positives = 92/196 (46%), Gaps = 25/196 (12%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVYPPV-SPPPKVYPP--VSPPYHYSSP---PPPVY 352
           PPP+  PP   PP +YPP +  PP  YPP    PP VY P    PP  Y  P   PPPVY
Sbjct: 128 PPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVY 187

Query: 351 SPPKKPYHYSSPPPPVYSPP---PPYHYSSPPP----PPKKPYKYSSPPPPEHHVSPKPY 193
            PP +       PPPVY PP   PP  Y  PPP    PP     Y  PPP       KP 
Sbjct: 188 QPPYE------KPPPVYPPPHEKPPIEY--PPPHEKLPPVYQPPYEKPPPTYPPPHEKPP 239

Query: 192 YHSPPPPKKPYYYHSPP---PPVYSPPPPYHYSSPPPPPKKPYYY---HSPPPPVYSPP- 34
              PPP +KP Y   PP   PP   PPP Y    PPP  K P  Y   H  PPPVY PP 
Sbjct: 240 IEYPPPHEKPPYEKPPPEYQPPYEKPPPLY----PPPHEKPPIEYPPPHEKPPPVYQPPY 295

Query: 33  --PPYHYTSP---PPP 1
             PP  Y  P   PPP
Sbjct: 296 EKPPIEYPPPHEKPPP 311

 Score =  138 bits (348), Expect = 3e-31
 Identities = 94/223 (42%), Positives = 106/223 (47%), Gaps = 26/223 (11%)
 Frame = -3

Query: 594 TFTLLVALVSLTLPSLISANSYLYSSPP---PPKVYPP-VSPPPKVY--PPVYSPPPKVY 433
           +  LL+  V +T P L +    +Y  PP   PP   PP +  PP VY  PPV+ PPP V 
Sbjct: 1   SLVLLLLGVVVTTPVLANYKPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVK 60

Query: 432 PP--VSPPPKVYPP--VSPPYHYSSPPPPVYSPPKKPYHYSSPP---PPVYSPPPPYHYS 274
           PP    PPP+  PP    PP+     PPP Y PP    H   PP   PP   PPP Y   
Sbjct: 61  PPPEYEPPPEYQPPPEYQPPH---EKPPPEYQPP----HEKPPPEYQPPHEKPPPEYPPP 113

Query: 273 SPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHSP----PPPVYSPP---PP 115
              PPP+ P  Y  PPP       KP    PPP +KP   + P    PPPVY PP   PP
Sbjct: 114 HEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPP 173

Query: 114 YHYSSPPPPPKKPYYYHSP---PPPVYSPP---PPYHYTSPPP 4
             Y  PPP  K P  Y  P   PPPVY PP   PP  Y  PPP
Sbjct: 174 IEY--PPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEY--PPP 212

 Score =  135 bits (341), Expect = 2e-30
 Identities = 91/218 (41%), Positives = 97/218 (44%), Gaps = 47/218 (21%)
 Frame = -3

Query: 513 PPPKVYPP-VSPPPKVYPPVYSPPPKVYPPVSPPPKVYPP--------VSPPYHYSSP-- 367
           PPP+  PP   PPP+  PP   PPP+  PP   PP  YPP          PPY    P  
Sbjct: 73  PPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEY 132

Query: 366 ------PPPVYSPP--KKPYHYSSP---PPPVYSPP---PPYHYSSP--PPPPKKPYKYS 235
                 PPP+Y PP  K P  Y  P   PPPVY PP   PP  Y  P   PPP     Y 
Sbjct: 133 QPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYE 192

Query: 234 SPPP--PEHHVSPKPYYHSPPPPKKPYYYHSP---PPPVYSPP---PPYHYSSP---PPP 88
            PPP  P  H  P P  + PP  K P  Y  P   PPP Y PP   PP  Y  P   PP 
Sbjct: 193 KPPPVYPPPHEKP-PIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPY 251

Query: 87  PKKPYYYHSP---PPPVYSPP---PPYHYTSP---PPP 1
            K P  Y  P   PPP+Y PP   PP  Y  P   PPP
Sbjct: 252 EKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPP 289

 Score =  135 bits (340), Expect = 3e-30
 Identities = 88/207 (42%), Positives = 96/207 (46%), Gaps = 37/207 (17%)
 Frame = -3

Query: 513 PPPKVYPPVS--PPPKVYPPVYSPPPKVYPPVSPPPKVYPPV-------SPPYHYSSP-- 367
           PPP   PP+   PP +  PPVY PP +  PP  PPP   PP+        PPY    P  
Sbjct: 199 PPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPEY 258

Query: 366 ------PPPVYSPP--KKPYHYSSP---PPPVYSPP---PPYHYSSP--PPPPKKPYKYS 235
                 PPP+Y PP  K P  Y  P   PPPVY PP   PP  Y  P   PPP     Y 
Sbjct: 259 QPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYE 318

Query: 234 SPPP--PEHHVSPKPYYHSPPPPKKPYYYHSP---PPPVYSPP---PPYHYSSPPPPPKK 79
            PPP  P  H  P P  + PP  K P  Y  P   PPP Y PP   PP  Y   PPP +K
Sbjct: 319 KPPPVYPPPHEKP-PIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEY---PPPHEK 374

Query: 78  PYYYHSPP--PPVYSPPPPYHYTSPPP 4
           P Y   PP  PP Y  PPP +   PPP
Sbjct: 375 PPYEKPPPLYPPPYEKPPPLY---PPP 398

 Score =  132 bits (332), Expect = 2e-29
 Identities = 89/195 (45%), Positives = 94/195 (48%), Gaps = 26/195 (13%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVY-PPVSPPPKVYPP--VSPPYHYSSP---PPPVY 352
           PPP   PP   PP  YPP +  PP VY PP   PP  YPP    PP  Y  P   PPPVY
Sbjct: 265 PPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVY 324

Query: 351 SPP--KKPYHYSSPP---PPVYSPP---PPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
            PP  K P  Y  P    PPVY PP   PP  Y  PPP  K P +Y  PPP E     KP
Sbjct: 325 PPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTY--PPPHEKPPIEY--PPPHE-----KP 375

Query: 195 YYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSP---PPPPKKPYYYHSPP---------P 52
            Y  PPP   P Y    PPP+Y  PPP+H+  P    PP  KP  Y  PP         P
Sbjct: 376 PYEKPPPLYPPPY--EKPPPLY--PPPHHHKPPHHEKPPFYKPPVYEPPPLEKPPPVEKP 431

Query: 51  PVYSPPPPYHYTSPP 7
           P Y PPP  HY  PP
Sbjct: 432 PSYKPPPYRHY--PP 444

 Score =  131 bits (329), Expect = 5e-29
 Identities = 87/196 (44%), Positives = 96/196 (48%), Gaps = 25/196 (12%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVS-PPPKVYPPVS-PPYHYSSP---PPPVY 352
           PPP +  PPV  PP   PP   PPP   PP+  PPP   PP   PP  Y  P   PPP+Y
Sbjct: 210 PPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLY 269

Query: 351 SPP--KKPYHYSSP---PPPVYSPP---PPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKP 196
            PP  K P  Y  P   PPPVY PP   PP  Y   PPP +KP     PP    +  P P
Sbjct: 270 PPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEY---PPPHEKPPPVYQPP----YEKPPP 322

Query: 195 YYHSPPPPKKPYYYHSPP----PPVYSPP---PPYHYSSPPPPPKKPYYYHSPP---PPV 46
            Y  PPP +KP   + PP    PPVY PP   PP  Y   PPP +KP   + PP   PP 
Sbjct: 323 VY--PPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTY---PPPHEKPPIEYPPPHEKPPY 377

Query: 45  YSPPP--PYHYTSPPP 4
             PPP  P  Y  PPP
Sbjct: 378 EKPPPLYPPPYEKPPP 393

 Score =  127 bits (319), Expect = 7e-28
 Identities = 87/203 (42%), Positives = 94/203 (46%), Gaps = 32/203 (15%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPP-KVYPPVYSPPPKVYPPVSPPP---KVYPPVSPPYHYSSPPPPVYS 349
           PPP +  PPV  PP +  PPVY PPP   PP+  PP   K+ P   PPY     PPP Y 
Sbjct: 177 PPPHEKPPPVYQPPYEKPPPVY-PPPHEKPPIEYPPPHEKLPPVYQPPY---EKPPPTYP 232

Query: 348 PP--KKPYHYSSP--PPPVYSPPPPYHYSSPPPPPKKPYKYSSPP---PPEHHVSP---- 202
           PP  K P  Y  P   PP   PPP Y      PPP  P  +  PP   PP H   P    
Sbjct: 233 PPHEKPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQ 292

Query: 201 ----KPYYHSPPPPKKPYYYHSP----PPPVYSPP---PPYHYSSPPPPPKKPYYYHSP- 58
               KP    PPP +KP   + P    PPPVY PP   PP  Y  PPP  K P  Y  P 
Sbjct: 293 PPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEY--PPPHEKLPPVYQPPY 350

Query: 57  --PPPVYSPP---PPYHYTSPPP 4
             PPP Y PP   PP  Y  PPP
Sbjct: 351 EKPPPTYPPPHEKPPIEY--PPP 371

 Score = 94.4 bits (233), Expect = 7e-18
 Identities = 66/170 (38%), Positives = 73/170 (42%), Gaps = 49/170 (28%)
 Frame = -3

Query: 363 PPVYSPP--KKPYHYSSPPPPVYSP-----PPPYHYSSP--------------------- 268
           PP+Y PP  +KP  Y   PP +  P     PPP HY  P                     
Sbjct: 21  PPIYEPPPTEKPPTYE--PPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYQPPPEYQ 78

Query: 267 PPPPKKPYKYSSP---PPPEH---HVSPKPYY---HSPPPPKKPYYYHSPPP---PVYSP 124
           PP  K P +Y  P   PPPE+   H  P P Y   H  PPP+ P  Y  PPP   P Y  
Sbjct: 79  PPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEK 138

Query: 123 PPPYHYSSPPPPPKKPYYY---HSPPPPVYSPP---PPYHYTSP---PPP 1
           PPP +   PPP  K P  Y   H  PPPVY PP   PP  Y  P   PPP
Sbjct: 139 PPPLY---PPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPP 185

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 54/116 (46%), Positives = 60/116 (51%), Gaps = 11/116 (9%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPP-KVYPPVYSPPPKVYPPVS-PPPKVYPPV-SPPYHYSSP---PPPV 355
           PPP +  PPV  PP +  PP Y PPP   PP+  PPP   PP   PP  Y  P   PPP+
Sbjct: 336 PPPHEKLPPVYQPPYEKPPPTY-PPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPL 394

Query: 354 YSPP--KKPYHYSSPP---PPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSP 202
           Y PP   KP H+  PP   PPVY PPP       PPP +KP  Y   PPP  H  P
Sbjct: 395 YPPPHHHKPPHHEKPPFYKPPVYEPPP----LEKPPPVEKPPSYK--PPPYRHYPP 444

[139][TOP]
>UniRef100_Q9FUR5 ENOD2f (Fragment) n=1 Tax=Maackia amurensis RepID=Q9FUR5_9FABA
          Length = 308

 Score =  140 bits (353), Expect = 8e-32
 Identities = 88/207 (42%), Positives = 100/207 (48%), Gaps = 38/207 (18%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYS-PPPKVYPPVSPPPKVYPPV--SPPYHYSSP---PPPVY 352
           PPP+  PP   PP  +PP Y  PPP+  PP   PP +YPP    PP  Y  P   PPPVY
Sbjct: 93  PPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPVEYPPPHEKPPPVY 152

Query: 351 SPP--KKPYHYSSP---PPPVYSPP--------PPYHYSSP---PPPPKKP---YK--YS 235
            PP  K P  Y  P   PPPVY PP        PP H   P   PPP +KP   Y+  Y 
Sbjct: 153 QPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQPPYE 212

Query: 234 SPPPPEHHVSPKPYYHSPPPPKKPYYYHSPP--PPVYSPPPPYH---YSSPPPPPKKPYY 70
            PPP       KP    PPP +KP Y   PP  PP Y  PPP +   +   PP  +KP +
Sbjct: 213 KPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPPHHEKPPF 272

Query: 69  YHSP---PPPVYSPPP---PYHYTSPP 7
           Y  P   PPP+  PPP   P  Y  PP
Sbjct: 273 YKPPVYEPPPLEKPPPVEKPPSYKPPP 299

 Score =  139 bits (351), Expect = 1e-31
 Identities = 82/186 (44%), Positives = 90/186 (48%), Gaps = 16/186 (8%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVYPPV-SPPPKVYPP--VSPPYHYSSP---PPPVY 352
           PPP+  PP   PP +YPP +  PP  YPP    PP VY P    PP  Y  P   PPPVY
Sbjct: 115 PPPEYQPPYEKPPPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVY 174

Query: 351 SPPKKPYHYSSPPPPVYSPP---PPYHYSSP--PPPPKKPYKYSSPPPPEHHVSPKPYYH 187
            PP +       PPPVY PP   PP  Y  P   PPP     Y  PPP       KP   
Sbjct: 175 QPPYE------KPPPVYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPPTYPPPHEKPPIE 228

Query: 186 SPPPPKKPYYYHSPP--PPVYSPPPPYHYSSPPPPPKKPYYYHSPP---PPVYSPPPPYH 22
            PPP +KP Y   PP  PP Y  PPP +   PPP   KP ++  PP   PPVY PPP   
Sbjct: 229 YPPPHEKPPYEKPPPLYPPPYEKPPPLY---PPPHHHKPPHHEKPPFYKPPVYEPPP--- 282

Query: 21  YTSPPP 4
              PPP
Sbjct: 283 LEKPPP 288

 Score =  137 bits (346), Expect = 5e-31
 Identities = 86/196 (43%), Positives = 96/196 (48%), Gaps = 26/196 (13%)
 Frame = -3

Query: 513 PPPKVYPP-VSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPV--SPPYHYSSP---PPPVY 352
           PPP+  PP   PPP+  PP   PPP+  PP   PP  +PP    PP  Y  P   PPP+Y
Sbjct: 71  PPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLY 130

Query: 351 SPP--KKPYHYSSP---PPPVYSPP---PPYHYSSP---PPPPKKPYKYSSPPPPEHHVS 205
            PP  K P  Y  P   PPPVY PP   PP  Y  P   PPP  +P  Y  PPP      
Sbjct: 131 PPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQP-PYEKPPPVYPPPH 189

Query: 204 PKPYYHSPPPPKKPYYYHSP----PPPVYSPP---PPYHYSSPPPPPKKPYYYHSPP--P 52
            KP    PPP +KP   + P    PPP Y PP   PP  Y   PPP +KP Y   PP  P
Sbjct: 190 EKPPIEYPPPHEKPPPVYQPPYEKPPPTYPPPHEKPPIEY---PPPHEKPPYEKPPPLYP 246

Query: 51  PVYSPPPPYHYTSPPP 4
           P Y  PPP +   PPP
Sbjct: 247 PPYEKPPPLY---PPP 259

 Score =  135 bits (339), Expect = 4e-30
 Identities = 93/224 (41%), Positives = 99/224 (44%), Gaps = 40/224 (17%)
 Frame = -3

Query: 555 PSLISANSYLYSSPP---PPKVYPP-VSPPPKVY--PPVYSPPPKVYPP--------VSP 418
           P L +    +Y  PP   PP   PP +  PP VY  PPV+ PPP V PP          P
Sbjct: 1   PVLANYKPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYEP 60

Query: 417 PPKVYPP-VSPPYHYSSP---PPPVYSPP--KKPYHYSSP--------PPPVYSPPPPYH 280
           PP+  PP   PP  Y  P   PPP Y PP  K P  Y  P        PPP   PPP Y 
Sbjct: 61  PPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQ 120

Query: 279 YSSPPPPPKKPYKYSSPP---PPEHHVSPKPYYHSPPPPKKPYYY---HSPPPPVYSPP- 121
                PPP  P  +  PP   PP H   P  Y   PP  K P  Y   H  PPPVY PP 
Sbjct: 121 PPYEKPPPLYPPPHEKPPVEYPPPHEKPPPVY--QPPYEKPPIEYPPPHEKPPPVYQPPY 178

Query: 120 --PPYHYSSPPPPPKKPYYY---HSPPPPVYSPPPPYHYTSPPP 4
             PP  Y  PPP  K P  Y   H  PPPVY PP    Y  PPP
Sbjct: 179 EKPPPVY--PPPHEKPPIEYPPPHEKPPPVYQPP----YEKPPP 216

 Score =  132 bits (333), Expect = 2e-29
 Identities = 80/185 (43%), Positives = 87/185 (47%), Gaps = 16/185 (8%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVY-PPVSPPPKVYPP--VSPPYHYSSP---PPPVY 352
           PPP   PP   PP  YPP +  PP VY PP   PP VYPP    PP  Y  P   PPPVY
Sbjct: 148 PPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVY 207

Query: 351 SPPKKPYHYSSPPPPVYSPP---PPYHYSSP-------PPPPKKPYKYSSPPPPEHHVSP 202
            PP +       PPP Y PP   PP  Y  P        PPP  P  Y  PPP    + P
Sbjct: 208 QPPYE------KPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPP----LYP 257

Query: 201 KPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYH 22
            P++H PP  +KP +Y    PPVY PPP      PPP  K         PP Y PPP  H
Sbjct: 258 PPHHHKPPHHEKPPFY---KPPVYEPPP---LEKPPPVEK---------PPSYKPPPYRH 302

Query: 21  YTSPP 7
           Y  PP
Sbjct: 303 Y--PP 305

 Score =  132 bits (331), Expect = 3e-29
 Identities = 95/236 (40%), Positives = 102/236 (43%), Gaps = 65/236 (27%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVY--PPVYSPPPKVYPP--VSPPPKVYPP--VSPPYHYSSP---PP 361
           PPP   PP   PP++   PPVY PPP  YPP  V PPP+  PP    PP  Y  P   PP
Sbjct: 13  PPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYEPPPEYQPPHEKPP 72

Query: 360 PVYSPP--KKPYHYSSP---PPPVYSPP---PPYHYSSP--PPPPKKPYKYSSPPP---- 223
           P Y PP  K P  Y  P   PPP Y PP   PP  +  P   PPP+    Y  PPP    
Sbjct: 73  PEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPP 132

Query: 222 ---------PEHHVSPKPYYHSP--------PPP--KKPYYYHSP---PPPVYSPP---P 118
                    P  H  P P Y  P        PPP  K P  Y  P   PPPVY PP   P
Sbjct: 133 PHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKP 192

Query: 117 PYHYSSP---PPPPKKPYYYHSPP--------PPVYSPP----PPYHYTSP--PPP 1
           P  Y  P   PPP  +P Y   PP        PP+  PP    PPY    P  PPP
Sbjct: 193 PIEYPPPHEKPPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPP 248

 Score =  127 bits (319), Expect = 7e-28
 Identities = 80/180 (44%), Positives = 88/180 (48%), Gaps = 25/180 (13%)
 Frame = -3

Query: 465 PPVYSPPPKVYPPVSPPPKVY--PPV--SPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYS 298
           PP+Y PPP   PP   PP++   PPV   PP HY  PPP V  PP+        PPP Y 
Sbjct: 8   PPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHY--PPPHVKPPPEYE------PPPEYE 59

Query: 297 PPPPYHYSSPPPPPKKPYKYSSP---PPPEH---HVSPKPYY---HSPPPPKKPYYYHSP 145
           PPP Y     PP  K P +Y  P   PPPE+   H  P P Y   H  PPP+ P  Y  P
Sbjct: 60  PPPEYQ----PPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKP 115

Query: 144 PP---PVYSPPPPYHYSSPPPPPKKPYYY---HSPPPPVYSPP---PPYHYTSP---PPP 1
           PP   P Y  PPP +   PPP  K P  Y   H  PPPVY PP   PP  Y  P   PPP
Sbjct: 116 PPEYQPPYEKPPPLY---PPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPP 172

[140][TOP]
>UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO
          Length = 2618

 Score =  140 bits (352), Expect = 1e-31
 Identities = 88/200 (44%), Positives = 99/200 (49%), Gaps = 6/200 (3%)
 Frame = -3

Query: 582  LVALVSLTLPSLISANSYLYSSPP-PPKVYPPVSPPPKVYPP-VYSPPPKVYPPVSPPPK 409
            LV    LT   + +A    Y+  P PP  +PP SPPP   PP + SPPP   PP+SPPP 
Sbjct: 1995 LVGEGDLTYADVNAAAPKQYADAPRPPPNHPPPSPPPLPSPPPLPSPPPPSPPPLSPPP- 2053

Query: 408  VYPPVSPPYHYSSPPPPVYSPPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSS- 232
              PP  PP     PPPP+  PP  P     PPPP + PPP    S PPPPP  P   ++ 
Sbjct: 2054 --PPPPPPAPLPPPPPPL--PPPAPSPSPPPPPPPWPPPP----SPPPPPPPAPPPGAAQ 2105

Query: 231  ---PPPPEHHVSPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHS 61
               PPPP    SP P   SPPPP  P     PPPP   PP P     PPPPP  P     
Sbjct: 2106 APWPPPP----SPSPPPPSPPPPPSP-----PPPPPSPPPAPL----PPPPPSPPPSPPP 2152

Query: 60   PPPPVYSPPPPYHYTSPPPP 1
            PP P  SPP P  +  P PP
Sbjct: 2153 PPSPPPSPPAPPPHPPPEPP 2172

 Score =  132 bits (331), Expect = 3e-29
 Identities = 80/173 (46%), Positives = 86/173 (49%), Gaps = 1/173 (0%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            SPPP    PP+  PP   PP  SPPP   PP +P P   PP+ PP    SPPPP   PP 
Sbjct: 2028 SPPPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPPPPLPPPAPSPSPPPP---PPP 2084

Query: 339  KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPY 160
             P   S PPPP  +PPP    +  PPPP       SPPPP    SP P    PPPP    
Sbjct: 2085 WPPPPSPPPPPPPAPPPGAAQAPWPPPPS-----PSPPPP----SPPPPPSPPPPPP--- 2132

Query: 159  YYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPP-PPVYSPPPPYHYTSPPP 4
               SPPP    PPPP    SPPPPP  P    SPP PP + PP P    S PP
Sbjct: 2133 ---SPPPAPLPPPPPSPPPSPPPPPSPP---PSPPAPPPHPPPEPPAPPSFPP 2179

 Score =  123 bits (308), Expect = 1e-26
 Identities = 81/176 (46%), Positives = 86/176 (48%), Gaps = 5/176 (2%)
 Frame = -3

Query: 519  SPPPPKVYPPVSPPPKVYPPV--YSPPPKVYPPVSPPPKVYPPVSP-PYHYSSPPPPVYS 349
            SPPPP   PP+SPPP   PP     PPP   PP +P P   PP  P P   S PPPP  +
Sbjct: 2040 SPPPPSP-PPLSPPPPPPPPPAPLPPPPPPLPPPAPSPSPPPPPPPWPPPPSPPPPPPPA 2098

Query: 348  PPKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPK 169
            PP        PPPP  SPPPP    SPPPPP  P     PPPP    SP P    PPPP 
Sbjct: 2099 PPPGAAQAPWPPPPSPSPPPP----SPPPPPSPP-----PPPP----SPPPAPLPPPPPS 2145

Query: 168  KPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSP--PPPYHYTSPP 7
             P    SPPPP  SPPP    S P PPP      H PP P   P  PP + +   P
Sbjct: 2146 PP---PSPPPPP-SPPP----SPPAPPP------HPPPEPPAPPSFPPQFDFGDEP 2187

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 38/86 (44%), Positives = 43/86 (50%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PPP   PP   PPP   PP SPPP   PP SPP    +PPP    PP
Sbjct: 2120 SPPPPPS--PP--PPPPSPPPAPLPPPPPSPPPSPPPPPSPPPSPP----APPP---HPP 2168

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPP 265
             +P     P PP +  PP + +   P
Sbjct: 2169 PEP-----PAPPSF--PPQFDFGDEP 2187

[141][TOP]
>UniRef100_Q8RWX5 Putative uncharacterized protein At3g19020 (Fragment) n=1
            Tax=Arabidopsis thaliana RepID=Q8RWX5_ARATH
          Length = 712

 Score =  139 bits (351), Expect = 1e-31
 Identities = 87/194 (44%), Positives = 98/194 (50%), Gaps = 22/194 (11%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYP-PVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
            PP P+  P   PP +  P P  SP P+     +P P+  P   PP   +  P P  SP  
Sbjct: 527  PPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQET--PKPEESPKP 584

Query: 339  KPYHYSSPP---------PPVYSPPP--PYHYS-------SPPPPPKKPYKYSSPP-PPE 217
            +P     PP         PP+ SP P  PY  S        PP P  +  K +SP  PP 
Sbjct: 585  QPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKCRPQPPSPSTEETKTTSPQSPPV 644

Query: 216  HHVSPKPYYHSPPPP--KKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVY 43
            H   P P  HSPPPP    P   HSPPPPVYSPPPP H  SPPPPP      HSPPPPV+
Sbjct: 645  HSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVH--SPPPPP-----VHSPPPPVH 697

Query: 42   SPPPPYHYTSPPPP 1
            SPPPP H  SPPPP
Sbjct: 698  SPPPPVH--SPPPP 709

 Score =  119 bits (298), Expect = 2e-25
 Identities = 75/165 (45%), Positives = 85/165 (51%), Gaps = 7/165 (4%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVYPP-VSPPPKVYPPVSPPYHYSS-----PPPPVY 352
           PP +  P     PK  PP    PPK   P +  PP   P  + PY  S      P PP  
Sbjct: 570 PPKQETPKPEESPKPQPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKCRPQPP-- 627

Query: 351 SPPKKPYHYSSPP-PPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPP 175
           SP  +    +SP  PPV+SPPPP    SPPPP        SPPPP H  SP P  +SPPP
Sbjct: 628 SPSTEETKTTSPQSPPVHSPPPPPPVHSPPPP------VFSPPPPMH--SPPPPVYSPPP 679

Query: 174 PKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYS 40
           P     +  PPPPV+SPPPP H  SPPPP       HSPPPPV+S
Sbjct: 680 P----VHSPPPPPVHSPPPPVH--SPPPP------VHSPPPPVHS 712

 Score =  102 bits (253), Expect = 3e-20
 Identities = 80/228 (35%), Positives = 87/228 (38%), Gaps = 56/228 (24%)
 Frame = -3

Query: 516  PPPPKVYPPVSPPPKVYP--PVYSPPPKVYP-PVSPPPKVYPPVSPPYHYSS--PPPPVY 352
            P  PK   P +  PK  P  P    P +  P P  P PK   P SP    S   PP P  
Sbjct: 465  PESPKQESPKTEQPKPKPESPKQESPKQEAPKPEQPKPK---PESPKQESSKQEPPKPEE 521

Query: 351  SP---PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPK---KPYKYSSP-------PPPEHH 211
            SP   P KP     P PP    P P     P PP +   KP +   P       P PE  
Sbjct: 522  SPKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEES 581

Query: 210  VSPKPYYHSPPPPKKPYYYHSPP------------------------------------- 142
              P+P     PP  +     SPP                                     
Sbjct: 582  PKPQPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKCRPQPPSPSTEETKTTSPQS 641

Query: 141  PPVYSPPPPYHYSSPPPPP-KKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            PPV+SPPPP    SPPPP    P   HSPPPPVYSPPPP H  SPPPP
Sbjct: 642  PPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVH--SPPPP 687

 Score = 97.4 bits (241), Expect = 8e-19
 Identities = 57/102 (55%), Positives = 63/102 (61%), Gaps = 1/102 (0%)
 Frame = -3

Query: 516 PPPPKVYPPVSPPPKVYPPVYSPPPKVYPPV-SPPPKVYPPVSPPYHYSSPPPPVYSPPK 340
           PP P      +  P+  PPV+SPPP   PPV SPPP V+ P  PP H  SPPPPVYSPP 
Sbjct: 626 PPSPSTEETKTTSPQS-PPVHSPPPP--PPVHSPPPPVFSP-PPPMH--SPPPPVYSPP- 678

Query: 339 KPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEH 214
            P  +S PPPPV+SPPPP H  SPPPP        SPPPP H
Sbjct: 679 -PPVHSPPPPPVHSPPPPVH--SPPPP------VHSPPPPVH 711

 Score = 91.7 bits (226), Expect = 4e-17
 Identities = 51/89 (57%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = -3

Query: 522 SSPPPPKVY-PPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
           +SP  P V+ PP  PP    PPV+SPPP V+   SPPP ++ P  P Y   SPPPPV+SP
Sbjct: 637 TSPQSPPVHSPP--PP----PPVHSPPPPVF---SPPPPMHSPPPPVY---SPPPPVHSP 684

Query: 345 PKKPYHYSSPPPPVYSPPPPYHYSSPPPP 259
           P  P H  SPPPPV+SPPPP H  SPPPP
Sbjct: 685 PPPPVH--SPPPPVHSPPPPVH--SPPPP 709

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 80/248 (32%), Positives = 87/248 (35%), Gaps = 74/248 (29%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPP----PKVYPPVSPPPKVYPPV---------SPPY 382
            S P P +   P  P PK   P + P     PK   P    PK   P          SP  
Sbjct: 433  SKPKPEESPKPQQPSPKPETPSHEPSNPKEPKPESPKQESPKTEQPKPKPESPKQESPKQ 492

Query: 381  HYSSPPPPVYSP--PKKPYHYSSPPPPVYSP---PPPYHYSSPPPPPK----KPYKYSSP 229
                P  P   P  PK+      PP P  SP   PP    S  P PPK    KP +   P
Sbjct: 493  EAPKPEQPKPKPESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKP 552

Query: 228  PPPEHHVSPKPYYH-SPPPPK----KPYYYHSPPPPVYSPPP------------------ 118
             PP+   +PKP     P PPK    KP     P PP    PP                  
Sbjct: 553  QPPKQ-ETPKPEESPKPQPPKQETPKPEESPKPQPPKQEQPPKTEAPKMGSPPLESPVPN 611

Query: 117  -PYHYS----------------------------SPPPPPKKPYYYHSPPPPVYSPPPPY 25
             PY  S                            SPPPPP      HSPPPPV+SPPPP 
Sbjct: 612  DPYDASPIKKCRPQPPSPSTEETKTTSPQSPPVHSPPPPPP----VHSPPPPVFSPPPPM 667

Query: 24   HYTSPPPP 1
            H  SPPPP
Sbjct: 668  H--SPPPP 673

 Score = 71.2 bits (173), Expect = 6e-11
 Identities = 59/185 (31%), Positives = 67/185 (36%), Gaps = 11/185 (5%)
 Frame = -3

Query: 522 SSPPPPKVYPPVSPPPK--VYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYS 349
           S+P P     P +P PK  + PP    P K  P  SP P+   P         P  P + 
Sbjct: 405 SNPSPKPTPTPKAPEPKKEINPPNLEEPSKPKPEESPKPQQPSP--------KPETPSHE 456

Query: 348 P--PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPP 175
           P  PK+P     P  P    P        P  PK+       P PE    PKP    P  
Sbjct: 457 PSNPKEP----KPESPKQESPKTEQPKPKPESPKQESPKQEAPKPEQ---PKP---KPES 506

Query: 174 PKKPYYYHSPPPPVYSP---PPPYHYSSPPPPPK----KPYYYHSPPPPVYSPPPPYHYT 16
           PK+      PP P  SP   PP    S  P PPK    KP     P PP    P P    
Sbjct: 507 PKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESP 566

Query: 15  SPPPP 1
            P PP
Sbjct: 567 KPQPP 571

[142][TOP]
>UniRef100_B1Z6K9 Type VI secretion system Vgr family protein n=1 Tax=Burkholderia
            ambifaria MC40-6 RepID=B1Z6K9_BURA4
          Length = 1057

 Score =  139 bits (350), Expect = 2e-31
 Identities = 84/186 (45%), Positives = 89/186 (47%), Gaps = 12/186 (6%)
 Frame = -3

Query: 522  SSPPPPKVYPPVS---PPPKVYPPVYS---PPPKVYPPVSPPPKVYPPVS--PPYHYSSP 367
            S PPPP   PP S   PPP   PP  S   PPP   PP  PP    PP S  PP   S P
Sbjct: 722  SEPPPPSSEPPPSSEPPPPSSEPPPPSSEPPPPSSEPP--PPSSEPPPPSSEPPPPSSEP 779

Query: 366  PPPVYSPP----KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPK 199
            PPP   PP    + P   S PPPP   PPPP   S PPPP  +P   SS PPP     P 
Sbjct: 780  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPP 837

Query: 198  PYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHY 19
            P    PPP  +P    S PPP  S PPP     PPP  + P     PPPP   PPPP   
Sbjct: 838  PSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--S 895

Query: 18   TSPPPP 1
            + PPPP
Sbjct: 896  SEPPPP 901

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 756  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 807

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 808  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 863

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 864  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 915

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 763  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 814

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 815  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 870

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 871  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 922

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 770  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 821

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 822  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 877

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 878  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 929

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 777  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 828

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 829  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 884

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 885  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 936

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 784  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 835

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 836  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 891

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 892  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 943

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 791  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 842

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 843  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 898

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 899  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 950

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 798  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 849

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 850  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 905

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 906  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 957

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 805  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 856

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 857  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 912

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 913  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 964

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 812  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 863

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 864  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 919

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 920  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 971

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 819  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 870

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 871  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 926

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 927  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 978

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 826  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 877

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 878  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 933

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 934  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 985

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 833  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 884

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 885  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 940

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 941  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 992

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 840  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 891

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 892  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 947

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 948  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 999

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 847  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 898

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 899  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 954

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 955  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 1006

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 854  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 905

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 906  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 961

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 962  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 1013

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 861  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 912

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 913  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 968

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 969  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 1020

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 868  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 919

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 920  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 975

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 976  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 1027

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 875  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 926

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 927  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 982

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 983  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 1034

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 882  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 933

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 934  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 989

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 990  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 1041

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/174 (46%), Positives = 85/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 889  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 940

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 941  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 996

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 997  PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 1048

 Score =  136 bits (343), Expect = 1e-30
 Identities = 81/175 (46%), Positives = 86/175 (49%), Gaps = 3/175 (1%)
 Frame = -3

Query: 516  PPPPKVYPPVS---PPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSP 346
            PPPP + P  S   PPP   PP  S PP   PP S PP   PP S P   SS PPP  S 
Sbjct: 711  PPPPALPPAPSSEPPPPSSEPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSE 764

Query: 345  PKKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
            P  P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +
Sbjct: 765  PPPP--SSEPPPPSSEPPPP--SSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSE 820

Query: 165  PYYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            P    S PPP  S PPP     PPP  + P     PPPP   PPPP   + PPPP
Sbjct: 821  PPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP--SSEPPPP 873

 Score =  134 bits (337), Expect = 6e-30
 Identities = 80/174 (45%), Positives = 84/174 (48%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 896  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 947

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKP 163
              P   S PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P
Sbjct: 948  PPPS--SEPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 1003

Query: 162  YYYHSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
                S PPP  S PPP     PPP  + P     PPPP   PPPP   +  PPP
Sbjct: 1004 PPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPP---SEEPPP 1054

 Score =  130 bits (326), Expect = 1e-28
 Identities = 77/168 (45%), Positives = 83/168 (49%), Gaps = 1/168 (0%)
 Frame = -3

Query: 501  VYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYS 322
            + PP+ PPP + P   S PP   PP S PP   P   PP   S PPPP   PP      S
Sbjct: 706  ILPPLPPPPALPPAPSSEPP---PPSSEPP---PSSEPPPPSSEPPPPSSEPPPPS---S 756

Query: 321  SPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHS-P 145
             PPPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P    S P
Sbjct: 757  EPPPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEP 814

Query: 144  PPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            PPP   PPPP   SS PPPP        PPPP   PPPP   + PPPP
Sbjct: 815  PPPSSEPPPP---SSEPPPPSS-----EPPPPSSEPPPP--SSEPPPP 852

 Score =  119 bits (297), Expect = 3e-25
 Identities = 72/166 (43%), Positives = 81/166 (48%), Gaps = 1/166 (0%)
 Frame = -3

Query: 495  PPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKPYHYSSP 316
            PP+ P P  +  +  P   + PP+ PPP +     PP   S PPPP   PP      S P
Sbjct: 691  PPI-PVPLFFRSITVP---ILPPLPPPPAL-----PPAPSSEPPPPSSEPPPS----SEP 737

Query: 315  PPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYYHS-PPP 139
            PPP   PPPP   S PPPP  +P   SS PPP     P P    PPP  +P    S PPP
Sbjct: 738  PPPSSEPPPPS--SEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPP 795

Query: 138  PVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            P   PPPP   SS PPPP        PPPP   PPPP   + PPPP
Sbjct: 796  PSSEPPPP---SSEPPPPSS-----EPPPPSSEPPPP--SSEPPPP 831

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 50/110 (45%), Positives = 52/110 (47%)
 Frame = -3

Query: 522  SSPPPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPP 343
            S PPPP   PP  PP    PP  S PP   PP S PP   PP S P   SS PPP  S P
Sbjct: 959  SEPPPPSSEPP--PPSSEPPPPSSEPP---PPSSEPP---PPSSEPPPPSSEPPPPSSEP 1010

Query: 342  KKPYHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPY 193
              P   SS PPP  S PPP     PPP  + P   S PPPP     P  +
Sbjct: 1011 PPP---SSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSEEPPPSEF 1057

[143][TOP]
>UniRef100_B8A9G0 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8A9G0_ORYSI
          Length = 682

 Score =  139 bits (350), Expect = 2e-31
 Identities = 83/171 (48%), Positives = 90/171 (52%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKP 334
           PPP+  PPV+PPP   PP  SPPP   PPV+PPP   PPVSPP      PPPV  PP  P
Sbjct: 15  PPPQT-PPVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPVSPP---PVTPPPVSPPPVTP 70

Query: 333 YHYSSPPPPVYSPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKKPYYY 154
                  PPV  P P    + PP PP       SPPPP    +P P   SPPPP  P   
Sbjct: 71  -------PPVTPPTP---VAPPPVPP-------SPPPPTP--TPTPVTPSPPPPVTP--- 108

Query: 153 HSPPPPVYSPPPPYHYSSPPPPPKKPYYYHSPPPPVYSPPPPYHYTSPPPP 1
            SPPPPV SPPPP   ++PPP    P    SP     SPPPP    SPPPP
Sbjct: 109 -SPPPPVASPPPPDVPTAPPPSNNPPSLPPSPSNVPASPPPPRISLSPPPP 158

 Score =  114 bits (285), Expect = 6e-24
 Identities = 71/150 (47%), Positives = 77/150 (51%), Gaps = 4/150 (2%)
 Frame = -3

Query: 513 PPPKVYPPVSPPPKVYPPVYSPPPKVYPPVSPPPKVYPPVSPPYHYSSPPPPVYSPPKKP 334
           PPP   PPV+PPP V PP  SPPP   PPVSPPP   PPV+PP   + PP P   PP  P
Sbjct: 35  PPPVTPPPVTPPP-VSPPPVSPPPVTPPPVSPPPVTPPPVTPPTPVAPPPVPPSPPPPTP 93

Query: 333 YHYS---SPPPPVY-SPPPPYHYSSPPPPPKKPYKYSSPPPPEHHVSPKPYYHSPPPPKK 166
                  SPPPPV  SPPPP    + PPPP  P   ++PPP            S  PP  
Sbjct: 94  TPTPVTPSPPPPVTPSPPPPV---ASPPPPDVP---TAPPP------------SNNPPSL 135

Query: 165 PYYYHSPPPPVYSPPPPYHYSSPPPPPKKP 76
           P    SP     SPPPP    SPPPPP  P
Sbjct: 136 P---PSPSNVPASPPPPRISLSPPPPPSTP 162

 Score = 94.4 bits (233), Expect = 7e-18
 Identities = 60/132 (45%), Positives = 67/132 (50%), Gaps = 8/132 (6%)
 Frame = -3

Query: 375 SSPPPPVYSPPKKPYHYSSPPPPVYSPPP--PYHYSSPP--PPPKKPYKYSSPPPPEHHV 208
           S+P  P   PP+ P      PPPV +PPP  P   + PP  PPP  P   S PP     V
Sbjct: 7   SAPVTPAAPPPQTP---PVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPVSPPPVTPPPV 63

Query: 207 SPKPYYHSPPPPKKPYYYHSPPPPVYSPPPPYHYSSP----PPPPKKPYYYHSPPPPVYS 40
           SP P     PPP  P    +PPP   SPPPP    +P    PPPP  P    SPPPPV S
Sbjct: 64  SPPPV---TPPPVTPPTPVAPPPVPPSPPPPTPTPTPVTPSPPPPVTP----SPPPPVAS 116

Query: 39  PPPPYHYTSPPP 4
           PPPP   T+PPP
Sbjct: 117 PPPPDVPTAPPP 128

[144][TOP]
>UniRef100_Q94ES5 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES5_PEA
          Length = 144

 Scor