BB908104 ( RCE06661 )

[UP]


[1][TOP]
>UniRef100_Q39835 Extensin n=1 Tax=Glycine max RepID=Q39835_SOYBN
          Length = 432

 Score =  400 bits (1028), Expect = e-110
 Identities = 178/212 (83%), Positives = 179/212 (84%), Gaps = 18/212 (8%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           YKSPPPPPKKPYKYPSPPPPVYKY SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV
Sbjct: 208 YKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 267

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
           YKYKSPPPP YKY SPPPP YKY SPPPP    YKY SPPPPVYKY SPPPPYKYPSPPP
Sbjct: 268 YKYKSPPPP-YKYPSPPPPPYKYPSPPPPV---YKYKSPPPPVYKYKSPPPPYKYPSPPP 323

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK------KPYKYPSPPPPVYKYKSPPPP 523
           PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP K       PYKYPSPPPPVYKYKSPPPP
Sbjct: 324 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 383

Query: 524 VY------------SPPPPVYKYKSPPPPVYS 583
                         SPPPPVYKYKSPPPPV+S
Sbjct: 384 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVHS 415

 Score =  330 bits (847), Expect = 4e-89
 Identities = 161/230 (70%), Positives = 164/230 (71%), Gaps = 37/230 (16%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVY 154
           Y SPPPP   P  PY Y SPPPP +   SPPPPY Y SPPPP      PY Y SPPPP +
Sbjct: 128 YHSPPPPKHSPPPPYYYHSPPPPKH---SPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKH 184

Query: 155 KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPP 334
              SPPPP Y Y SPPPP +   SPPPP Y YKSPPPPPKKPYKYPSPPPPVYKY SPPP
Sbjct: 185 ---SPPPPYY-YHSPPPPKH---SPPPPYY-YKSPPPPPKKPYKYPSPPPPVYKYKSPPP 236

Query: 335 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK------KPYKYPSPPPPV 496
           PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP K       PYKYPSPPPPV
Sbjct: 237 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPV 296

Query: 497 YKYKSPPPPVY----------------------SPPPPVYKYKSPPPPVY 580
           YKYKSPPPPVY                      SPPPPVYKYKSPPPPVY
Sbjct: 297 YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 346

 Score =  250 bits (638), Expect = 7e-65
 Identities = 146/286 (51%), Positives = 148/286 (51%), Gaps = 106/286 (37%)
 Frame = +2

Query: 35  YKYPSP------PPPVYKY-------NSPPPPYKYPSP------PPPPYKYPSP------ 139
           Y Y SP      PPP Y Y       +SPPPPY Y SP      PPPPY Y SP      
Sbjct: 30  YIYSSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHS 89

Query: 140 PPPVYKYKSP------PPPVYKYKSP------PPPVYKYKSP------PPPVYKYKSPPP 265
           PPP Y Y SP      PPP Y Y SP      PPP Y Y SP      PPP Y Y SPPP
Sbjct: 90  PPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPP 149

Query: 266 P---PKKPYKYPSP------PPPVYKYNSPPP---------------------------- 334
           P   P  PY Y SP      PPP Y Y+SPPP                            
Sbjct: 150 PKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYK 209

Query: 335 --------PYKYPSP---------PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKK 463
                   PYKYPSP         PPPPYKYPSPPPP YKY SPPPPVYKYKSPPPP  K
Sbjct: 210 SPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 269

Query: 464 ------PYKYPSPPPPVYKYKSPPPPVY---SPPPPVYKYKSPPPP 574
                 PYKYPSPPPP YKY SPPPPVY   SPPPPVYKYKSPPPP
Sbjct: 270 YKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 315

 Score =  244 bits (623), Expect = 4e-63
 Identities = 114/155 (73%), Positives = 116/155 (74%), Gaps = 22/155 (14%)
 Frame = +2

Query: 2   YKSPPPPPKK-------PYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKY 160
           Y SPPPPP K        YKY SPPPPVYKY SPPPPYKYPSPPPPPYKYPSPPPPVYKY
Sbjct: 279 YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKY 338

Query: 161 KSPPPPVYKYKSPPPPV---------YKYKSPPPPVYKYKSPPPP------PKKPYKYPS 295
           KSPPPPVYKYKSPPPP          YKY SPPPPVYKYKSPPPP      P  PYKYPS
Sbjct: 339 KSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPS 398

Query: 296 PPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVY 400
           PPPPVYKY SPPPP  + SPPPP Y Y SPPPP +
Sbjct: 399 PPPPVYKYKSPPPPV-H-SPPPPHYIYASPPPPYH 431

 Score =  202 bits (515), Expect = 1e-50
 Identities = 94/122 (77%), Positives = 94/122 (77%), Gaps = 7/122 (5%)
 Frame = +2

Query: 2   YKSPPPPPKK-------PYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKY 160
           Y SPPPPP K        YKY SPPPPVYKY SPPPPYKYPSPPPPPYKYPSPPPPVYKY
Sbjct: 318 YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKY 377

Query: 161 KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY 340
           KSPPPP YKY SPPPP YKY SPPPPVYKYKSPPPP        SPPPP Y Y SPPPPY
Sbjct: 378 KSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPP----VH--SPPPPHYIYASPPPPY 430

Query: 341 KY 346
            Y
Sbjct: 431 HY 432

 Score =  201 bits (512), Expect = 3e-50
 Identities = 118/205 (57%), Positives = 127/205 (61%), Gaps = 11/205 (5%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           Y SPPPP   P  PY Y SPPPP +   SPPPPY Y SPPPP +   SPPPP Y Y SPP
Sbjct: 32  YSSPPPPKHSPPPPYYYHSPPPPKH---SPPPPYYYHSPPPPKH---SPPPPYY-YHSPP 84

Query: 173 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPS 352
           PP +   SPPPP Y Y SPPPP +   SPPPP    Y Y SPPPP +   SPPPPY Y S
Sbjct: 85  PPKH---SPPPPYY-YHSPPPPKH---SPPPP----YYYHSPPPPKH---SPPPPYYYHS 130

Query: 353 PPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY- 529
           PPPP +   SPPPP Y Y SPPPP +   SPPPP    Y Y SPPPP +   SPPPP Y 
Sbjct: 131 PPPPKH---SPPPPYY-YHSPPPPKH---SPPPP----YYYHSPPPPKH---SPPPPYYY 176

Query: 530 -SP------PPPVYKYKSPPPPVYS 583
            SP      PPP Y Y SPPPP +S
Sbjct: 177 HSPPPPKHSPPPPYYYHSPPPPKHS 201

 Score =  181 bits (460), Expect = 3e-44
 Identities = 102/173 (58%), Positives = 109/173 (63%)
 Frame = +2

Query: 65  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 244
           Y Y+SPPPP      PPPPY Y SPPPP +   SPPPP Y Y SPPPP +   SPPPP Y
Sbjct: 30  YIYSSPPPP---KHSPPPPYYYHSPPPPKH---SPPPPYY-YHSPPPPKH---SPPPPYY 79

Query: 245 KYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 424
            Y SPPPP        SPPPP Y Y+SPPPP      PPPPY Y SPPPP +   SPPPP
Sbjct: 80  -YHSPPPPKH------SPPPPYY-YHSPPPP---KHSPPPPYYYHSPPPPKH---SPPPP 125

Query: 425 VYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
            Y Y SPPPP        SPPPP Y Y SPPPP +SPPPP Y Y SPPPP +S
Sbjct: 126 YY-YHSPPPPKH------SPPPPYY-YHSPPPPKHSPPPPYY-YHSPPPPKHS 169

[2][TOP]
>UniRef100_Q09083 Hydroxyproline-rich glycoprotein n=1 Tax=Phaseolus vulgaris
           RepID=Q09083_PHAVU
          Length = 580

 Score =  390 bits (1002), Expect = e-107
 Identities = 175/226 (77%), Positives = 175/226 (77%), Gaps = 35/226 (15%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           Y   PPPPK PYKY SPPPPVYKY SPPPPYKYPSPPPPPYKY SPPPPVYKYKSPPPPV
Sbjct: 267 YYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPV 326

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPP------PKKPYKYP----------------- 292
           YKYKSPPPPVYKY SPPPPVYKYKSPPPP      P  PYKYP                 
Sbjct: 327 YKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVY 386

Query: 293 ---SPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKK 463
              SPPPPVYKY SPPPPYKYPSPPPPPYKYPSPPPPVYKY SPPPPVYKYKSPPPP  K
Sbjct: 387 KYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYK 446

Query: 464 ------PYKYPSPPPPVYKYKSPPPPVY---SPPPPVYKYKSPPPP 574
                 PYKYPSPPPP YKY SPPPPVY   SPPPPVYKYKSPPPP
Sbjct: 447 YKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPP 492

 Score =  378 bits (971), Expect = e-103
 Identities = 175/236 (74%), Positives = 176/236 (74%), Gaps = 42/236 (17%)
 Frame = +2

Query: 2    YKSPPPP-------PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKY 160
            YKSPPPP       P   YKY SPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKY
Sbjct: 329  YKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKY 388

Query: 161  KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP-------PKKPYKYPSPPPPVYKY 319
            KSPPPPVYKYKSPPPP YKY SPPPP YKY SPPPP       P   YKY SPPPPVYKY
Sbjct: 389  KSPPPPVYKYKSPPPP-YKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKY 447

Query: 320  NSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK------KPYKYPS 481
             SPPPPYKYPSPPPPPYKY SPPPPVYKYKSPPPPVYKYKSPPPP K       PYKY S
Sbjct: 448  KSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSS 507

Query: 482  PPPPVYKYKSPPPPVY----------------------SPPPPVYKYKSPPPPVYS 583
            PPPPVYKYKSPPPPVY                      SPPPPVYKY SPPPPV+S
Sbjct: 508  PPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPVYKYKSPPPPVYKYNSPPPPVHS 563

 Score =  371 bits (953), Expect = e-101
 Identities = 169/215 (78%), Positives = 171/215 (79%), Gaps = 22/215 (10%)
 Frame = +2

Query: 2    YKSPPPPPKK-------PYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKY 160
            Y SPPPPP K        YKY SPPPPVYKY SPPPPYKYPSPPPPPYKYPSPPPPVYKY
Sbjct: 368  YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKY 427

Query: 161  KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKK---------PYKYPSPPPPVY 313
             SPPPPVYKYKSPPPPVYKYKSPPPP YKY SPPPPP K           KY SPPPPVY
Sbjct: 428  NSPPPPVYKYKSPPPPVYKYKSPPPP-YKYPSPPPPPYKYSSPPPPVY--KYKSPPPPVY 484

Query: 314  KYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP------YKY 475
            KY SPPPPYKYPSPPPPPYKY SPPPPVYKYKSPPPPVYKYKSPPPP K P      YKY
Sbjct: 485  KYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPVYKY 544

Query: 476  PSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
             SPPPPVYKY SPPPPV+SPPPP Y Y SPPPP +
Sbjct: 545  KSPPPPVYKYNSPPPPVHSPPPPHYIYASPPPPYH 579

 Score =  346 bits (888), Expect = 7e-94
 Identities = 167/222 (75%), Positives = 168/222 (75%), Gaps = 31/222 (13%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPV------YKYNSPPPP---YKYPSPPPPPYKYPSPPP 145
           Y SPPPP   P  PY Y SPPPP       Y Y+SPPPP   YKY SPPPP YKY SPPP
Sbjct: 236 YHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPP 295

Query: 146 PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS 325
           P YKY SPPPP YKY SPPPPVYKYKSPPPPVYKYKSPPPP    YKY SPPPPVYKY S
Sbjct: 296 P-YKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPV---YKYNSPPPPVYKYKS 351

Query: 326 PPPP-YK---------YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK----- 460
           PPPP YK         YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP K     
Sbjct: 352 PPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPP 411

Query: 461 -KPYKYPSPPPPVYKYKSPPPPVY---SPPPPVYKYKSPPPP 574
             PYKYPSPPPPVYKY SPPPPVY   SPPPPVYKYKSPPPP
Sbjct: 412 PPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPP 453

 Score =  318 bits (815), Expect = 2e-85
 Identities = 159/229 (69%), Positives = 160/229 (69%), Gaps = 36/229 (15%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV- 151
           Y SPPPP   P  PY Y SPPPP +   SPPPPY Y SPPPP      PY Y SPPPP  
Sbjct: 204 YHSPPPPKHSPPPPYYYHSPPPPKH---SPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKH 260

Query: 152 -----YKYKSPPPPV--YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPV 310
                Y Y SPPPP   YKY SPPPPVYKYKSPPPP YKY SPPPPP   YKY SPPPPV
Sbjct: 261 SPPPPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPPP-YKYPSPPPPP---YKYSSPPPPV 316

Query: 311 YKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK------KPY 469
           YKY SPPPP YKY SPPPP YKY SPPPPVYKYKSPPPPVYKY SPPPP K       PY
Sbjct: 317 YKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPY 376

Query: 470 KYPSPPPPVYKYKSPPPPVY------------SPPPPVYKYKSPPPPVY 580
           KYPSPPPPVYKYKSPPPPVY            SPPPP YKY SPPPPVY
Sbjct: 377 KYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVY 425

 Score =  308 bits (789), Expect = 2e-82
 Identities = 151/234 (64%), Positives = 155/234 (66%), Gaps = 41/234 (17%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVY 154
           Y SPPPP   P  PY Y SPPPP +   SPPPPY Y SPPPP      PY Y SPPPP +
Sbjct: 172 YHSPPPPKHSPPPPYYYHSPPPPKH---SPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKH 228

Query: 155 KYKSPPPPVYKYKSPPP-----PVYKYKSPPPPVYK-----YKSPPPPPKKPYKYPSPPP 304
              SPPPP Y +  PPP     P Y Y SPPPP +      Y   PPPPK PYKY SPPP
Sbjct: 229 ---SPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKNPYKYSSPPP 285

Query: 305 PVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSP 484
           PVYKY SPPPPYKYPSPPPPPYKY SPPPPVYKYKSPPPPVYKYKSPPPP    YKY SP
Sbjct: 286 PVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPV---YKYNSP 342

Query: 485 PPPVYKYKSPPPPVY----------------------SPPPPVYKYKSPPPPVY 580
           PPPVYKYKSPPPPVY                      SPPPPVYKYKSPPPPVY
Sbjct: 343 PPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 396

 Score =  262 bits (669), Expect = 2e-68
 Identities = 146/251 (58%), Positives = 150/251 (59%), Gaps = 58/251 (23%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVY 154
           Y SPPPP   P  PY Y SPPPP +   SPPPPY Y SPPPP      PY Y SPPPP +
Sbjct: 108 YHSPPPPKHSPPPPYYYHSPPPPKH---SPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKH 164

Query: 155 KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPSP------PPP 307
              SPPPP Y Y SPPPP +   SPPPP Y Y SPPPP   P  PY Y SP      PPP
Sbjct: 165 ---SPPPPYY-YHSPPPPKH---SPPPPYY-YHSPPPPKHSPPPPYYYHSPPPPKHSPPP 216

Query: 308 VYKY-------NSPPPPYKYPSP------PPPPYKYPSPPPP------------------ 394
            Y Y       +SPPPPY Y SP      PPPPY Y SPPPP                  
Sbjct: 217 PYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKN 276

Query: 395 VYKYKSPPPPVYKYKSPPPPAK------KPYKYPSPPPPVYKYKSPPPPVY---SPPPPV 547
            YKY SPPPPVYKYKSPPPP K       PYKY SPPPPVYKYKSPPPPVY   SPPPPV
Sbjct: 277 PYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPV 336

Query: 548 YKYKSPPPPVY 580
           YKY SPPPPVY
Sbjct: 337 YKYNSPPPPVY 347

 Score =  231 bits (588), Expect = 4e-59
 Identities = 129/218 (59%), Positives = 136/218 (62%), Gaps = 24/218 (11%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVYKYK 163
           Y SPPPPPK PY Y SPPPP +   SPPPPY Y SPPPP      PY Y SPPPP +   
Sbjct: 32  YSSPPPPPK-PYYYQSPPPPKH---SPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKH--- 84

Query: 164 SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNSPPP 334
           SPPPP Y Y SPPPP +   SPPPP Y Y SPPPP   P  PY Y SPPPP +   SPPP
Sbjct: 85  SPPPPYY-YHSPPPPKH---SPPPPYY-YHSPPPPKHSPPPPYYYHSPPPPKH---SPPP 136

Query: 335 PYKYPSPPPP------PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP---YKYPSPP 487
           PY Y SPPPP      PY Y SPPPP +   SPPPP Y Y SPPPP   P   Y Y SPP
Sbjct: 137 PYYYHSPPPPKHSPPPPYYYHSPPPPKH---SPPPPYY-YHSPPPPKHSPPPPYYYHSPP 192

Query: 488 PPV------YKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           PP       Y Y SPPPP +SPPPP Y Y SPPPP +S
Sbjct: 193 PPKHSPPPPYYYHSPPPPKHSPPPPYY-YHSPPPPKHS 229

 Score =  189 bits (481), Expect = 1e-46
 Identities = 109/189 (57%), Positives = 116/189 (61%), Gaps = 6/189 (3%)
 Frame = +2

Query: 35  YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVY 214
           Y Y SPPPP       P PY Y SPPPP +   SPPPP Y Y SPPPP +   SPPPP Y
Sbjct: 30  YIYSSPPPP-------PKPYYYQSPPPPKH---SPPPPYY-YHSPPPPKH---SPPPPYY 75

Query: 215 KYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKY 376
            Y SPPPP +   SPPPP    Y Y SPPPP +   SPPPPY Y SPPPP      PY Y
Sbjct: 76  -YHSPPPPKH---SPPPP----YYYHSPPPPKH---SPPPPYYYHSPPPPKHSPPPPYYY 124

Query: 377 PSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKY 556
            SPPPP +   SPPPP Y Y SPPPP        SPPPP Y Y SPPPP +SPPPP Y Y
Sbjct: 125 HSPPPPKH---SPPPPYY-YHSPPPPKH------SPPPPYY-YHSPPPPKHSPPPPYY-Y 172

Query: 557 KSPPPPVYS 583
            SPPPP +S
Sbjct: 173 HSPPPPKHS 181

[3][TOP]
>UniRef100_Q39864 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39864_SOYBN
          Length = 199

 Score =  385 bits (990), Expect = e-105
 Identities = 170/195 (87%), Positives = 170/195 (87%), Gaps = 8/195 (4%)
 Frame = +2

Query: 20  PPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSP 199
           PPKKPYKYPSPPPPVYKY SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSP
Sbjct: 1   PPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSP 60

Query: 200 PPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYP 379
           PPP YKY SPPPP YKY SPPPP    YKY SPPPPVYKY SPPPPYKYPSPPPPPYKYP
Sbjct: 61  PPP-YKYPSPPPPPYKYPSPPPP---VYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYP 116

Query: 380 SPPPPVYKYKSPPPPVYKYKSPPPPAK------KPYKYPSPPPPVYKYKSPPPPVY--SP 535
           SPPPPVYKYKSPPPPVYKYKSPPPP K       PYKYPSPPPPVYKYKSPPPP    SP
Sbjct: 117 SPPPPVYKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSP 176

Query: 536 PPPVYKYKSPPPPVY 580
           PPP YKY SPPPPVY
Sbjct: 177 PPPPYKYPSPPPPVY 191

 Score =  338 bits (868), Expect = 1e-91
 Identities = 160/199 (80%), Positives = 161/199 (80%), Gaps = 8/199 (4%)
 Frame = +2

Query: 2   YKSPPPP------PKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKY 160
           YKSPPPP      P  PYKYPSPPPPVYKY SPPPP YKY SPPPP YKYPSPPPP YKY
Sbjct: 18  YKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP-YKYPSPPPPPYKY 76

Query: 161 KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP- 337
            SPPPPVYKYKSPPPPVYKYKSPPPP YKY SPPPP   PYKYPSPPPPVYKY SPPPP 
Sbjct: 77  PSPPPPVYKYKSPPPPVYKYKSPPPP-YKYPSPPPP---PYKYPSPPPPVYKYKSPPPPV 132

Query: 338 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPP 517
           YKY S PPPP+KYPSPPPP YKY SPPPPVYKYKSPPP    PYKYPSPPPP YKY SPP
Sbjct: 133 YKYKS-PPPPHKYPSPPPPPYKYPSPPPPVYKYKSPPP----PYKYPSPPPPPYKYPSPP 187

Query: 518 PPVYSPPPPVYKYKSPPPP 574
           P       PVYKYKSPPPP
Sbjct: 188 P-------PVYKYKSPPPP 199

[4][TOP]
>UniRef100_Q8H9E0 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Solanum
           tuberosum RepID=Q8H9E0_SOLTU
          Length = 217

 Score =  361 bits (926), Expect = 3e-98
 Identities = 170/202 (84%), Positives = 171/202 (84%), Gaps = 9/202 (4%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPP--YKYPSPPPPVYKYKS-- 166
           YKSPPPP  K YK P PPPPVYKY SPPPP YKY SPPPPP  YKY SPPPPVYKYKS  
Sbjct: 4   YKSPPPPVYK-YKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPP 62

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YK 343
           PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP    YKY SPPPPVYKY SPPPP YK
Sbjct: 63  PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---VYKYKSPPPPVYKYKSPPPPVYK 119

Query: 344 YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPP 523
           Y SPPPP YKY SPPPPVYKYKSPPPPVYKYKSPPPP  K YK P PPPPVYKYKSPPPP
Sbjct: 120 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYK-YKSPPPPPPVYKYKSPPPP 178

Query: 524 VY---SPPPPVYKYKSPPPPVY 580
           VY   SPPPPVYKYKSPPPPV+
Sbjct: 179 VYKYKSPPPPVYKYKSPPPPVH 200

 Score =  353 bits (905), Expect = 7e-96
 Identities = 167/206 (81%), Positives = 168/206 (81%), Gaps = 15/206 (7%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP---YKYPSPPPPPYKY--PSPPPPVYKYKS 166
           YKSPPPPP   YKY SPPPPVYKY SPPPP   YKY SPPPP YKY  P PPPPVYKYKS
Sbjct: 14  YKSPPPPPPV-YKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKS 72

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YK 343
           PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP    YKY SPPPPVYKY SPPPP YK
Sbjct: 73  PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPV---YKYKSPPPPVYKYKSPPPPVYK 129

Query: 344 YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPP 523
           Y SPPPP YKY SPPPPVYKYKSPPPPVYKYKSPPPP    YKY SPPPPVYKYKSPPPP
Sbjct: 130 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP-PPVYKYKSPPPPVYKYKSPPPP 188

Query: 524 VY---SPPPPVYK------YKSPPPP 574
           VY   SPPPPV+K      Y SPPPP
Sbjct: 189 VYKYKSPPPPVHKSPAPYYYTSPPPP 214

 Score =  326 bits (836), Expect = 7e-88
 Identities = 155/186 (83%), Positives = 155/186 (83%), Gaps = 13/186 (6%)
 Frame = +2

Query: 62  VYKYNSPPPP-YKYPSPPPPP--YKYPSPPPPVYKYKS--PPPPVYKYKSPPPPVYKYKS 226
           VYKY SPPPP YKY SPPPPP  YKY SPPPPVYKYKS  PPPPVYKYKSPPPPVYKYKS
Sbjct: 1   VYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKS 60

Query: 227 --PPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPV 397
             PPPPVYKYKSPPPP    YKY SPPPPVYKY SPPPP YKY SPPPP YKY SPPPPV
Sbjct: 61  PPPPPPVYKYKSPPPP---VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPV 117

Query: 398 YKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYS-----PPPPVYKYKS 562
           YKYKSPPPPVYKYKSPPPP    YKY SPPPPVYKYKSPPPPVY      PPPPVYKYKS
Sbjct: 118 YKYKSPPPPVYKYKSPPPPV---YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKS 174

Query: 563 PPPPVY 580
           PPPPVY
Sbjct: 175 PPPPVY 180

 Score =  323 bits (827), Expect = 8e-87
 Identities = 152/191 (79%), Positives = 154/191 (80%), Gaps = 6/191 (3%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP---YKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           YKSPPPPP   YKY SPPPPVYKY SPPPP   YKY SPPPP YKY SPPPPVYKYKSPP
Sbjct: 36  YKSPPPPPPV-YKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP 94

Query: 173 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYP 349
           PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP    YKY SPPPPVYKY SPPPP YKY 
Sbjct: 95  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---VYKYKSPPPPVYKYKSPPPPVYKYK 151

Query: 350 SPPPPPYKY--PSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPP 523
           SPPPP YKY  P PPPPVYKYKSPPPPVYKYKSPPPP    YKY SPPPPV  +KSP P 
Sbjct: 152 SPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPV---YKYKSPPPPV--HKSPAPY 206

Query: 524 VYSPPPPVYKY 556
            Y+ PPP   Y
Sbjct: 207 YYTSPPPPSHY 217

[5][TOP]
>UniRef100_Q9M6R7 Extensin n=1 Tax=Pisum sativum RepID=Q9M6R7_PEA
          Length = 327

 Score =  340 bits (873), Expect = 4e-92
 Identities = 168/256 (65%), Positives = 172/256 (67%), Gaps = 62/256 (24%)
 Frame = +2

Query: 2   YKSPPP----------------PPKKPYKYPSPPPPVYKY-------NSPPPPYKYPSPP 112
           Y SPPP                PPKK YKY SPPPP+YKY       +SPPPPY Y SPP
Sbjct: 58  YSSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPP 117

Query: 113 PPP---YKYPSPPPPVYKYKSPPPPVYKYKSPPPPV---YKYKSPPPPVYKYKSPPPPPK 274
           PPP   YKY SPPPPVYKYKSPPPPVYKYKSPPPPV   YKY SPPPPVYKYKSPPPP  
Sbjct: 118 PPPKKSYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYKSPPPP-- 175

Query: 275 KPYKYPSPPPPVYKYNSPPPP---YKYPSP-------PPPPYKYPSPPPPVYKYKSPPPP 424
             YKY SPPPPVYKY SPPPP   YKYPSP       PPPPYKY SPPPP YKY SPPPP
Sbjct: 176 -VYKYKSPPPPVYKYQSPPPPKKSYKYPSPPPPVYKSPPPPYKYQSPPPPPYKYSSPPPP 234

Query: 425 VYKYKSPPPPAK--------KPYKYPSP---------------PPPVYKYKSPPPPVYSP 535
           VYKY SPPPP K        KP+K+P P               PPPVYKYKSPPPPVYSP
Sbjct: 235 VYKYNSPPPPYKHISPPTPGKPFKFPPPPTPIYKYKSPPPVYSPPPVYKYKSPPPPVYSP 294

Query: 536 PPPVYKYKSPPPPVYS 583
           PPP Y Y SPPPPVYS
Sbjct: 295 PPPHYVYSSPPPPVYS 310

 Score =  334 bits (856), Expect = 3e-90
 Identities = 157/220 (71%), Positives = 163/220 (74%), Gaps = 27/220 (12%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPP---PYKYPSPPPPVYKYKSP 169
           Y SPPPPPKK YKY SPPPPVYKY SPPPP YKY SPPPP   PYKY SPPPPVYKYKSP
Sbjct: 113 YSSPPPPPKKSYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYKSP 172

Query: 170 PPPVYKYKSPPPPVYKYKSPPPPV--YKYKSPPPP--------------PKKPYKYPSPP 301
           PPPVYKYKSPPPPVYKY+SPPPP   YKY SPPPP              P  PYKY SPP
Sbjct: 173 PPPVYKYKSPPPPVYKYQSPPPPKKSYKYPSPPPPVYKSPPPPYKYQSPPPPPYKYSSPP 232

Query: 302 PPVYKYNSPPPPYKYPSPPPP--PYKYPSPPPPVYKYKSP-----PPPVYKYKSPPPPAK 460
           PPVYKYNSPPPPYK+ SPP P  P+K+P PP P+YKYKSP     PPPVYKYKSPPPP  
Sbjct: 233 PPVYKYNSPPPPYKHISPPTPGKPFKFPPPPTPIYKYKSPPPVYSPPPVYKYKSPPPPVY 292

Query: 461 KPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
                 SPPPP Y Y SPPPPVYSPPPP Y Y SPPPP +
Sbjct: 293 ------SPPPPHYVYSSPPPPVYSPPPPHYIYASPPPPYH 326

 Score =  281 bits (719), Expect = 3e-74
 Identities = 134/183 (73%), Positives = 140/183 (76%), Gaps = 13/183 (7%)
 Frame = +2

Query: 65  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 244
           Y Y+SPPPP       P PY Y SPPPPV+   SPPPP Y Y SPPPPV+   SPPPP Y
Sbjct: 28  YLYSSPPPP-------PKPYYYQSPPPPVH---SPPPP-YHYSSPPPPVH---SPPPP-Y 72

Query: 245 KYKSPPPPPKKPYKYPSPPPPVYKY-------NSPPPPYKYPSPPPPP---YKYPSPPPP 394
            Y SPPPPPKK YKY SPPPP+YKY       +SPPPPY Y SPPPPP   YKY SPPPP
Sbjct: 73  HYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPP 132

Query: 395 VYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY---SPPPPVYKYKSP 565
           VYKYKSPPPPVYKYKSPPPP KKPYKY SPPPPVYKYKSPPPPVY   SPPPPVYKY+SP
Sbjct: 133 VYKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYQSP 192

Query: 566 PPP 574
           PPP
Sbjct: 193 PPP 195

 Score =  191 bits (484), Expect = 5e-47
 Identities = 96/154 (62%), Positives = 102/154 (66%), Gaps = 29/154 (18%)
 Frame = +2

Query: 2   YKSPPPP---------PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVY 154
           YKSPPPP         PKK YKYPSPPPPVYK  SPPPPYKY SPPPPPYKY SPPPPVY
Sbjct: 179 YKSPPPPVYKYQSPPPPKKSYKYPSPPPPVYK--SPPPPYKYQSPPPPPYKYSSPPPPVY 236

Query: 155 KYKSPPPPV-----------YKYKSPPPPVYKYKSPPP-----PVYKYKSPPPP---PKK 277
           KY SPPPP            +K+  PP P+YKYKSPPP     PVYKYKSPPPP   P  
Sbjct: 237 KYNSPPPPYKHISPPTPGKPFKFPPPPTPIYKYKSPPPVYSPPPVYKYKSPPPPVYSPPP 296

Query: 278 PYKYP-SPPPPVYKYNSPPPPYKYPSPPPPPYKY 376
           P+    SPPPPVY   SPPPP+   + PPPPY Y
Sbjct: 297 PHYVYSSPPPPVY---SPPPPHYIYASPPPPYHY 327

 Score =  183 bits (464), Expect = 1e-44
 Identities = 95/154 (61%), Positives = 97/154 (62%), Gaps = 41/154 (26%)
 Frame = +2

Query: 242 YKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY--K--------------YPSPPPPP-- 367
           Y Y SPPPPPK PY Y SPPPPV+   SPPPPY                 Y SPPPPP  
Sbjct: 28  YLYSSPPPPPK-PYYYQSPPPPVH---SPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPKK 83

Query: 368 -YKYPSPPPPVYKYKSPPPPV------YKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV 526
            YKY SPPPP+YKYKSPPPPV      Y Y SPPPP KK YKY SPPPPVYKYKSPPPPV
Sbjct: 84  SYKYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPVYKYKSPPPPV 143

Query: 527 Y----------------SPPPPVYKYKSPPPPVY 580
           Y                SPPPPVYKYKSPPPPVY
Sbjct: 144 YKYKSPPPPVKKPYKYSSPPPPVYKYKSPPPPVY 177

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 30/47 (63%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +2

Query: 449 PPAKKPYKYPSPPPPV--YKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           P     Y Y SPPPP   Y Y+SPPPPV+SPPPP Y Y SPPPPV+S
Sbjct: 22  PSQANNYLYSSPPPPPKPYYYQSPPPPVHSPPPP-YHYSSPPPPVHS 67

[6][TOP]
>UniRef100_Q9FSG1 Putative extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG1_NICSY
          Length = 311

 Score =  327 bits (839), Expect = 3e-88
 Identities = 164/232 (70%), Positives = 166/232 (71%), Gaps = 41/232 (17%)
 Frame = +2

Query: 2   YKSPPPP-------PKKPYKYPSPPPPVYKYNSPPPP-----------YKYPSPPPPPYK 127
           YKSPPPP       P   YKY SPPPPVYKY SPPPP           YKY SPPPP YK
Sbjct: 52  YKSPPPPLPIYRSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYK 111

Query: 128 YPSPPPPVYKYKSPPPPVYKYKSPPPPVYK----------YKSPPPPVYKYKSPPPPP-- 271
           Y SPPPP   YKSPPPPVYKYKSPPPPVYK          YKSPPPPVYKYKSPPPPP  
Sbjct: 112 YKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPV 171

Query: 272 -KKP----YKYPSPPPPVYKYNS-PPPPYKYPSPPPPPYKY--PSPPPPVYKYKSPPPPV 427
            K P    YKY SPPPPVYKY S PPPP  Y SPPPP YK+  P PPPPVYKYKSPPPPV
Sbjct: 172 HKSPPPPIYKYKSPPPPVYKYKSPPPPPPMYKSPPPPVYKHKSPPPPPPVYKYKSPPPPV 231

Query: 428 YKYKSPPPPAKKPYKYPSPPPPVYKYKS--PPPPVY-SPPPPVYKYKSPPPP 574
           YKYKSPPPP   P  Y SPPPP+YKYKS  PPPPVY SPPPPVYKYKSPPPP
Sbjct: 232 YKYKSPPPP---PPVYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPP 280

 Score =  327 bits (837), Expect = 5e-88
 Identities = 160/236 (67%), Positives = 162/236 (68%), Gaps = 45/236 (19%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP---------------------YKYPSPPPP 118
           Y S PPPP K Y Y SPPPPVYKY SPPPP                     YKY SPPPP
Sbjct: 29  YYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPVYKYKSPPPP 88

Query: 119 PYKYPSPPPPVYKYKSPPPPVYK----------YKSPPPPVYKYKSPPPPVYKYKSPPPP 268
           P  Y SPPPPVYKYKSPPPPVYK          YKSPPPPVYKYKSPPPPVYKYKSPPPP
Sbjct: 89  PPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPP 148

Query: 269 PKKPYKYPSPPPPVYKYNSPPPP-----------YKYPSPPPPPYKYPSPPPPVYKYKSP 415
           P     Y SPPPPVYKY SPPPP           YKY SPPPP YKY SPPPP   YKSP
Sbjct: 149 PP---VYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPPPPPPMYKSP 205

Query: 416 PPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKS--PPPPVY-SPPPPVYKYKSPPPP 574
           PPPVYK+KSPPPP    YKY SPPPPVYKYKS  PPPPVY SPPPP+YKYKSPPPP
Sbjct: 206 PPPVYKHKSPPPP-PPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPP 260

 Score =  325 bits (834), Expect = 1e-87
 Identities = 158/216 (73%), Positives = 161/216 (74%), Gaps = 25/216 (11%)
 Frame = +2

Query: 2   YKSPPP-PPKKPYKYPSPPPPVYKYNSPPPPYK-YPSPPPPPYKYPSPPPPVYKYKSPPP 175
           Y    P PP K Y Y SPPPPVYKY SPPPP   Y SPPPP YKY SPPPPVYKYKSPPP
Sbjct: 28  YYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPVYKYKSPPP 87

Query: 176 PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP---KKP----YKYPSPPPPVYKYNSPPP 334
           P   YKSPPPPVYKYKSPPPPVYKYKSPPPPP   K P    YKY SPPPPVYKY SPPP
Sbjct: 88  PPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPP 147

Query: 335 P-----------YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPS 481
           P           YKY SPPPPP  + SPPPP+YKYKSPPPPVYKYKSPPPP   P  Y S
Sbjct: 148 PPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPPPP---PPMYKS 204

Query: 482 PPPPVYKYKS--PPPPVY---SPPPPVYKYKSPPPP 574
           PPPPVYK+KS  PPPPVY   SPPPPVYKYKSPPPP
Sbjct: 205 PPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPP 240

 Score =  317 bits (811), Expect = 6e-85
 Identities = 160/236 (67%), Positives = 163/236 (69%), Gaps = 43/236 (18%)
 Frame = +2

Query: 2   YKSPPPPP---KKP----YKYPSPPPPVYKYNSPPPP-----------YKYPSPPPPPYK 127
           YKSPPPPP   K P    YKY SPPPPVYKY SPPPP           YKY SPPPP YK
Sbjct: 82  YKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYK 141

Query: 128 YPSPPPPVYKYKSPPPPVYKY----------KSPPPPVYKYKSPPPPVYKYKSPPPPPKK 277
           Y SPPPP   YKSPPPPVYKY          KSPPPP+YKYKSPPPPVYKYKSPPPPP  
Sbjct: 142 YKSPPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPPPPPP- 200

Query: 278 PYKYPSPPPPVYKYNSPPPP---YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPP 448
              Y SPPPPVYK+ SPPPP   YKY SPPPP YKY SPPPP   YKSPPPP+YKYKSPP
Sbjct: 201 --MYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPP 258

Query: 449 PPAKKPYKYPSPPPPVYKYKS--PPPPVY-SPPPPVYK---------YKSPPPPVY 580
           PP   P  Y SPPPPVYKYKS  PPPPVY SPPPPVYK         Y SPPPP Y
Sbjct: 259 PP---PPVYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKSPPPPYHYYYTSPPPPHY 311

 Score =  289 bits (739), Expect = 1e-76
 Identities = 134/169 (79%), Positives = 137/169 (81%), Gaps = 6/169 (3%)
 Frame = +2

Query: 92  YKYPSPPPPP--YKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP 265
           Y Y SPPPP   Y Y SPPPPVYKYKSPPPP+  Y+SPPPPVYKYKSPPPPVYKYKSPPP
Sbjct: 28  YYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPVYKYKSPPP 87

Query: 266 PPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKS 442
           PP     Y SPPPPVYKY SPPPP YKY SPPPPP  Y SPPPPVYKYKSPPPPVYKYKS
Sbjct: 88  PPPV---YKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKS 144

Query: 443 PPPPAKKPYKYPSPPPPVYKYKSPPPPV---YSPPPPVYKYKSPPPPVY 580
           PPPP   P  Y SPPPPVYKYKSPPPP     SPPPP+YKYKSPPPPVY
Sbjct: 145 PPPP---PPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVY 190

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 36/60 (60%), Positives = 37/60 (61%), Gaps = 15/60 (25%)
 Frame = +2

Query: 446 PPPAKKPYKYPSPPP------------PVYKYKSPPPPV---YSPPPPVYKYKSPPPPVY 580
           P   K  Y Y SPPP            PVYKYKSPPPP+    SPPPPVYKYKSPPPPVY
Sbjct: 21  PLECKANYYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPVY 80

[7][TOP]
>UniRef100_Q9C668 Putative uncharacterized protein F28B23.10 n=1 Tax=Arabidopsis
           thaliana RepID=Q9C668_ARATH
          Length = 478

 Score =  310 bits (795), Expect = 4e-83
 Identities = 146/212 (68%), Positives = 146/212 (68%), Gaps = 19/212 (8%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           YKSPPPPP         PY Y SPPPP Y YNSPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 107 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYV 166

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP-------PPKKPYKYPSPPPPVYK 316
           YKSPPPP Y Y SPPPP Y YKSPPPP Y Y SPPP       PP  PY Y SPPPP Y 
Sbjct: 167 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 226

Query: 317 YNS-PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPP 493
           Y S PPPPY Y SPPPPPY Y SPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP
Sbjct: 227 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPP 283

Query: 494 VYKYKSPPPPVY---SPPPPVYKYKSPPPPVY 580
            Y YKSPPPP Y   SPPPP Y YKSPPPP Y
Sbjct: 284 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 315

 Score =  308 bits (790), Expect = 2e-82
 Identities = 145/212 (68%), Positives = 146/212 (68%), Gaps = 19/212 (8%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           YKSPPPPP         PY Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 127 YKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 186

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP-------KKPYKYPSPPPPVYK 316
           YKSPPPP Y Y SPPPP Y YKSPPPP Y Y SPPPPP         PY Y SPPPP Y 
Sbjct: 187 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 246

Query: 317 YNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPP 493
           Y SPPPP Y Y SPPPPPY Y SPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP
Sbjct: 247 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPP 303

Query: 494 VYKYKSPPPPVY---SPPPPVYKYKSPPPPVY 580
            Y YKSPPPP Y   SPPPP Y YKSPPPP Y
Sbjct: 304 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 335

 Score =  308 bits (788), Expect = 3e-82
 Identities = 145/212 (68%), Positives = 146/212 (68%), Gaps = 19/212 (8%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           YKSPPPPP         PY Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 67  YKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYV 126

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP-------PPKKPYKYPSPPPPVYK 316
           YKSPPPP Y Y SPPPP Y YKSPPPP Y Y SPPP       PP  PY Y SPPPP Y 
Sbjct: 127 YKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 186

Query: 317 YNS-PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPP 493
           Y S PPPPY Y SPPPPPY Y SPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP
Sbjct: 187 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPP 243

Query: 494 VYKYKSPPPPVY---SPPPPVYKYKSPPPPVY 580
            Y YKSPPPP Y   SPPPP Y YKSPPPP Y
Sbjct: 244 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 275

 Score =  306 bits (783), Expect = 1e-81
 Identities = 144/212 (67%), Positives = 146/212 (68%), Gaps = 19/212 (8%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           YKSPPPPP         PY Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 147 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 206

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP 337
           YKSPPPP Y Y SPPPP Y YKSPPPP Y Y SPPPPP   Y Y SPPPP Y Y+SPPPP
Sbjct: 207 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP---YVYKSPPPPPYVYSSPPPP 263

Query: 338 -YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP-------PAKKPYKYPSPPPP 493
            Y Y SPPPPPY Y SPPPP Y YKSPPPP Y Y SPPP       P   PY Y SPPPP
Sbjct: 264 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 323

Query: 494 VYKYKSPPPPVY---SPPPPVYKYKSPPPPVY 580
            Y YKSPPPP Y   SPPPP Y YKSPPPP Y
Sbjct: 324 PYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPY 355

 Score =  305 bits (782), Expect = 1e-81
 Identities = 144/212 (67%), Positives = 145/212 (68%), Gaps = 19/212 (8%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           Y SPPPPP         PY Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 47  YSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYI 106

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP-------PPKKPYKYPSPPPPVYK 316
           YKSPPPP Y Y SPPPP Y YKSPPPP Y Y SPPP       PP  PY Y SPPPP Y 
Sbjct: 107 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYV 166

Query: 317 YNS-PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPP 493
           Y S PPPPY Y SPPPPPY Y SPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP
Sbjct: 167 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPP 223

Query: 494 VYKYKSPPPPVY---SPPPPVYKYKSPPPPVY 580
            Y YKSPPPP Y   SPPPP Y YKSPPPP Y
Sbjct: 224 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 255

 Score =  305 bits (782), Expect = 1e-81
 Identities = 144/212 (67%), Positives = 145/212 (68%), Gaps = 19/212 (8%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           YKSPPPPP         PY Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 187 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 246

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP-------KKPYKYPSPPPPVYK 316
           YKSPPPP Y Y SPPPP Y YKSPPPP Y Y SPPPPP         PY Y SPPPP Y 
Sbjct: 247 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 306

Query: 317 YNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPP 493
           Y SPPPP Y Y SPPPPPY Y SPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPP 
Sbjct: 307 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPP---PYVYSSPPPS 363

Query: 494 VYKYKSPPPPVY---SPPPPVYKYKSPPPPVY 580
            Y YKSPPPP Y   SPPPP Y YKSPPPP Y
Sbjct: 364 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 395

 Score =  305 bits (782), Expect = 1e-81
 Identities = 144/212 (67%), Positives = 146/212 (68%), Gaps = 19/212 (8%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           YKSPPPPP         PY Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 207 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 266

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP 337
           YKSPPPP Y Y SPPPP Y YKSPPPP Y Y SPPPPP   Y Y SPPPP Y Y+SPPPP
Sbjct: 267 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPP---YVYKSPPPPPYVYSSPPPP 323

Query: 338 -YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP-------PAKKPYKYPSPPPP 493
            Y Y SPPPPPY Y SPPPP Y YKSPPPP Y Y SPPP       P   PY Y SPPPP
Sbjct: 324 PYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPP 383

Query: 494 VYKYKSPPPPVY---SPPPPVYKYKSPPPPVY 580
            Y YKSPPPP Y   SPPPP Y YKSPPPP Y
Sbjct: 384 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 415

 Score =  305 bits (781), Expect = 2e-81
 Identities = 144/212 (67%), Positives = 145/212 (68%), Gaps = 19/212 (8%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           YKSPPPPP   Y Y SPPPP Y Y SPPPP Y Y SPPPPPY Y SPPPP Y Y SPPPP
Sbjct: 87  YKSPPPPP---YVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPP 143

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP 337
            Y YKSPPPP Y Y SPPPP Y YKSPPPPP         PY Y SPPPP Y Y+SPPPP
Sbjct: 144 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 203

Query: 338 -YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP-------PAKKPYKYPSPPPP 493
            Y Y SPPPPPY Y SPPPP Y YKSPPPP Y Y SPPP       P   PY Y SPPPP
Sbjct: 204 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 263

Query: 494 VYKYKSPPPPVY---SPPPPVYKYKSPPPPVY 580
            Y YKSPPPP Y   SPPPP Y YKSPPPP Y
Sbjct: 264 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 295

 Score =  305 bits (781), Expect = 2e-81
 Identities = 144/212 (67%), Positives = 145/212 (68%), Gaps = 19/212 (8%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           YKSPPPPP         PY Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 167 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 226

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP-------PPKKPYKYPSPPPPVYK 316
           YKSPPPP Y Y SPPPP Y YKSPPPP Y Y SPPP       PP  PY Y SPPPP Y 
Sbjct: 227 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 286

Query: 317 YNS-PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPP 493
           Y S PPPPY Y SPPPPPY Y SPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP
Sbjct: 287 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYNSPPPP 343

Query: 494 VYKYKSPPPPVY---SPPPPVYKYKSPPPPVY 580
            Y YKSPPPP Y   SPPP  Y YKSPPPP Y
Sbjct: 344 PYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPY 375

 Score =  305 bits (781), Expect = 2e-81
 Identities = 144/212 (67%), Positives = 145/212 (68%), Gaps = 19/212 (8%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           YKSPPPPP         PY Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 227 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 286

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP-------PPKKPYKYPSPPPPVYK 316
           YKSPPPP Y Y SPPPP Y YKSPPPP Y Y SPPP       PP  PY Y SPPPP Y 
Sbjct: 287 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYV 346

Query: 317 YNS-PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPP 493
           Y S PPPPY Y SPPP PY Y SPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP
Sbjct: 347 YKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPP 403

Query: 494 VYKYKSPPPPVY---SPPPPVYKYKSPPPPVY 580
            Y YKSPPPP Y   SPPPP Y YKSPPPP Y
Sbjct: 404 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 435

 Score =  305 bits (780), Expect = 2e-81
 Identities = 142/205 (69%), Positives = 144/205 (70%), Gaps = 12/205 (5%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           YKSPPPPP         PY Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 247 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 306

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPP- 334
           YKSPPPP Y Y SPPPP Y YKSPPPP Y Y SPPPPP   Y Y SPPPP Y Y+SPPP 
Sbjct: 307 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPP---YVYKSPPPPPYVYSSPPPS 363

Query: 335 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSP 514
           PY Y SPPPPPY Y SPPPP Y YKSPPPP Y Y SPPPP   PY Y SPPPP Y Y SP
Sbjct: 364 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSP 420

Query: 515 PPPVY---SPPPPVYKYKSPPPPVY 580
           PPP Y   SPPPP Y Y SPPPP Y
Sbjct: 421 PPPPYVYKSPPPPPYVYSSPPPPPY 445

 Score =  301 bits (772), Expect = 2e-80
 Identities = 141/203 (69%), Positives = 142/203 (69%), Gaps = 12/203 (5%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           YKSPPPPP   Y Y SPPPP Y Y SPPPP Y Y SPPPPPY Y SPPPP Y Y SPPPP
Sbjct: 267 YKSPPPPP---YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 323

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP 337
            Y YKSPPPP Y Y SPPPP Y YKSPPPPP         PY Y SPPPP Y Y+SPPPP
Sbjct: 324 PYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPP 383

Query: 338 -YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSP 514
            Y Y SPPPPPY Y SPPPP Y YKSPPPP Y Y SPPPP   PY Y SPPPP Y Y SP
Sbjct: 384 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSP 440

Query: 515 PPPVY---SPPPPVYKYKSPPPP 574
           PPP Y   SP PP Y YKSPPPP
Sbjct: 441 PPPPYVYKSPSPPPYVYKSPPPP 463

 Score =  289 bits (740), Expect = 1e-76
 Identities = 136/202 (67%), Positives = 139/202 (68%), Gaps = 9/202 (4%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           YKSPPPPP         PY Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 287 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYV 346

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS-PPP 334
           YKSPPPP Y Y SPPP  Y YKSPPPP Y Y SPPPP   PY Y SPPPP Y Y+S PPP
Sbjct: 347 YKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPP 403

Query: 335 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSP 514
           PY Y SPPPPPY Y SPPPP Y YKSPPPP Y Y SPPPP   PY Y SP PP Y YKSP
Sbjct: 404 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPSPPPYVYKSP 460

Query: 515 PPPVYSPPPPVYKYKSPPPPVY 580
           PP    PP   Y Y SPPPP+Y
Sbjct: 461 PP----PPSYSYSYSSPPPPIY 478

 Score =  288 bits (738), Expect = 2e-76
 Identities = 138/210 (65%), Positives = 140/210 (66%), Gaps = 19/210 (9%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           SPP PP   YK     PP + Y+SPPPP Y Y SPPPPPY Y SPPPP Y Y SPPPP Y
Sbjct: 31  SPPSPPSYVYK-----PPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPY 85

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPP-------PPKKPYKYPSPPPPVYKYNS-PPPPY 340
            YKSPPPP Y Y SPPPP Y YKSPPP       PP  PY Y SPPPP Y YNS PPPPY
Sbjct: 86  IYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPY 145

Query: 341 KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP-------PAKKPYKYPSPPPPVY 499
            Y SPPPPPY Y SPPPP Y YKSPPPP Y Y SPPP       P   PY Y SPPPP Y
Sbjct: 146 VYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPY 205

Query: 500 KYKSPPPPVY---SPPPPVYKYKSPPPPVY 580
            YKSPPPP Y   SPPPP Y YKSPPPP Y
Sbjct: 206 VYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 235

 Score =  278 bits (710), Expect = 3e-73
 Identities = 130/193 (67%), Positives = 131/193 (67%), Gaps = 11/193 (5%)
 Frame = +2

Query: 35  YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVY 214
           Y Y  P PP Y Y   PP + Y SPPPPPY Y SPPPP Y YKSPPPP Y Y SPPPP Y
Sbjct: 28  YTYSPPSPPSYVYK--PPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPY 85

Query: 215 KYKSPPPPVYKYKSPPP-------PPKKPYKYPSPPPPVYKYNS-PPPPYKYPSPPPPPY 370
            YKSPPPP Y Y SPPP       PP  PY Y SPPPP Y Y S PPPPY Y SPPPPPY
Sbjct: 86  IYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPY 145

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY---SPPP 541
            Y SPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP Y YKSPPPP Y   SPPP
Sbjct: 146 VYKSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPPPYVYKSPPPPPYVYSSPPP 202

Query: 542 PVYKYKSPPPPVY 580
           P Y YKSPPPP Y
Sbjct: 203 PPYVYKSPPPPPY 215

 Score =  223 bits (568), Expect = 9e-57
 Identities = 107/165 (64%), Positives = 109/165 (66%), Gaps = 1/165 (0%)
 Frame = +2

Query: 92  YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP 271
           Y Y  P PP Y Y    PP + Y SPPPP Y Y SPPPP Y YKSPPPP Y Y SPPPPP
Sbjct: 28  YTYSPPSPPSYVYK---PPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPP 84

Query: 272 KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPP 448
              Y Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y SPPPP Y YKSPPPP Y Y SPP
Sbjct: 85  ---YIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPP 141

Query: 449 PPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           PP   PY Y SPPPP Y Y SPPPP Y     VYK   PPP VYS
Sbjct: 142 PP---PYVYKSPPPPPYVYSSPPPPPY-----VYKSPPPPPYVYS 178

[8][TOP]
>UniRef100_UPI00019859A1 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019859A1
          Length = 377

 Score =  306 bits (785), Expect = 6e-82
 Identities = 149/217 (68%), Positives = 152/217 (70%), Gaps = 24/217 (11%)
 Frame = +2

Query: 2   YKSPPPPPK-------KPYKY--PSPPPPVYKYNSPPPP----YKYPSPPPPPYKYPS-P 139
           YKSPPPPP         PYKY  P PPPPVYKY SPPPP    YKY SPPPPPY  PS  
Sbjct: 149 YKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGT 208

Query: 140 PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKY 319
               Y+YKSPPP  YK   PPPPVYKYKSPPPP   +  PPPPP   YK P PPPPVYKY
Sbjct: 209 SADEYEYKSPPPYKYKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKY 268

Query: 320 NSPPPP---YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPP 490
            SPPPP   YKY SPPPPPYKY SPPPP  +YKSPPPP YKYKSPPPP    YKY SPPP
Sbjct: 269 KSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPV-YKYKSPPP 327

Query: 491 PVYKYKSPPPPVYS-----PPPPVYKYKSP--PPPVY 580
           PVYKYKSPPPP Y      PPPPVYKYKSP  PPP Y
Sbjct: 328 PVYKYKSPPPPPYMYKSPPPPPPVYKYKSPPPPPPKY 364

 Score =  300 bits (767), Expect = 7e-80
 Identities = 163/277 (58%), Positives = 164/277 (59%), Gaps = 84/277 (30%)
 Frame = +2

Query: 2   YKSPPPPPK-------KPYKY--PSPPPPVYKYNSPPPP-----------YKYPSPPPPP 121
           YKSPPPPP         PYKY  P PPPPVYKY SPPPP           YKY SPPPPP
Sbjct: 57  YKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPP 116

Query: 122 YKYPSPPPPVYKYKSPPPPV----------YKYKSPPPPV----------YKYKSPPPP- 238
             Y  P  P YKYKSPPPP           YKYKSPPPP           YKYKSPPPP 
Sbjct: 117 PVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPP 176

Query: 239 -VYKYKSPPPPPKKPYKYPSPP-------------------PPVYKYNSPPPP---YKY- 346
            VYKYKSPPPP KKPYKY SPP                   PP YKY SPPPP   YKY 
Sbjct: 177 PVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPPPPPPVYKYK 236

Query: 347 ----------PSPPPPPYKY--PSPPPPVYKYKSPPP--PVYKYKSPPPPAKKPYKYPSP 484
                     P PPPPPYKY  P PPPPVYKYKSPPP  P YKYKSPPPP   PYKY SP
Sbjct: 237 SPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPP---PYKYKSP 293

Query: 485 PPPVYKYKSPPPPVYS-----PPPPVYKYKSPPPPVY 580
           PPP  +YKSPPPP Y      PPPPVYKYKSPPPPVY
Sbjct: 294 PPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVY 330

 Score =  269 bits (688), Expect = 1e-70
 Identities = 137/211 (64%), Positives = 139/211 (65%), Gaps = 28/211 (13%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVY-------------------KYNSPPPP---YKYPSPPP 115
           YKSPPPP KKPYKY SPPPP Y                   KY SPPPP   YKY SPPP
Sbjct: 181 YKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPPPPPPVYKYKSPPP 240

Query: 116 PPYKY-PSPPPPVYKYKSPPPP--VYKYKSPPPPV--YKYKSPPPPVYKYKSPPPPPKKP 280
           PP  + P PPPP YKYKSPPPP  VYKYKSPPPP   YKYKSPPPP YKYKSPPPP   P
Sbjct: 241 PPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPP---P 297

Query: 281 YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK 460
            +Y SPPPP YKY SPP       PPPP YKY SPPPPVYKYKSPPPP Y YKSPPPP  
Sbjct: 298 LQYKSPPPPPYKYKSPP-------PPPPVYKYKSPPPPVYKYKSPPPPPYMYKSPPPPPP 350

Query: 461 -KPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              YK P PPPP Y Y SPPP    PPP  Y
Sbjct: 351 VYKYKSPPPPPPKYYYSSPPP----PPPHHY 377

 Score =  269 bits (687), Expect = 1e-70
 Identities = 142/217 (65%), Positives = 144/217 (66%), Gaps = 23/217 (10%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP-PPYKY--PSPPPPVYKYKSPP 172
           Y SPPPP    YK P PPPPVYKY SPPPP    SPP  PPYKY  P PPPPVYKYKSPP
Sbjct: 36  YSSPPPPYY--YKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPP 93

Query: 173 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPP--PPYKY 346
           PP   Y  P  P YKYKSPPPP   Y  P  PP K YK P PPPPVY   SPP  PPYKY
Sbjct: 94  PPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYK-YKSPPPPPPVY---SPPHHPPYKY 149

Query: 347 PSPPPPPYKYPSPPPPVYKYKSPPPP--VYKYKSPPPPAKKPYKYPSPPPPVY------- 499
            SPPPPP  Y  P  P YKYKSPPPP  VYKYKSPPPP KKPYKY SPPPP Y       
Sbjct: 150 KSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTS 209

Query: 500 ----KYKSPPPPVYS---PPPPVYKYKSP--PPPVYS 583
               +YKSPPP  Y    PPPPVYKYKSP  PPPV+S
Sbjct: 210 ADEYEYKSPPPYKYKSPPPPPPVYKYKSPPPPPPVHS 246

 Score =  203 bits (517), Expect = 7e-51
 Identities = 117/224 (52%), Positives = 118/224 (52%), Gaps = 76/224 (33%)
 Frame = +2

Query: 131 PSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP-------KKPYKY 289
           PS     Y Y SPPPP Y YKSPPPP        PPVYKYKSPPPPP         PYKY
Sbjct: 27  PSETSANYHYSSPPPPYY-YKSPPPP--------PPVYKYKSPPPPPPVYSPPHHPPYKY 77

Query: 290 --PSPPPPVYKYNSPP-----------PPYKYPSPPP----------PPYKYPSPPP--- 391
             P PPPPVYKY SPP           PPYKY SPPP          PPYKY SPPP   
Sbjct: 78  KSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPP 137

Query: 392 -------PVYKYKS----------------------PPPPVYKYKSPPPPAKKPYKYPSP 484
                  P YKYKS                      PPPPVYKYKSPPPP KKPYKY SP
Sbjct: 138 VYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSP 197

Query: 485 PPP-----------VYKYKSPPPPVYS---PPPPVYKYKSPPPP 574
           PPP            Y+YKSPPP  Y    PPPPVYKYKSPPPP
Sbjct: 198 PPPPYNLPSGTSADEYEYKSPPPYKYKSPPPPPPVYKYKSPPPP 241

 Score =  139 bits (351), Expect = 1e-31
 Identities = 80/134 (59%), Positives = 81/134 (60%), Gaps = 36/134 (26%)
 Frame = +2

Query: 290 PSPPPPVYKYNSPPPPYKYPSPPPPP----YKYPSPPPPV--------YKYKS--PPPPV 427
           PS     Y Y+SPPPPY Y SPPPPP    YK P PPPPV        YKYKS  PPPPV
Sbjct: 27  PSETSANYHYSSPPPPYYYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPV 86

Query: 428 YKYKSPPPPA-------KKPYKYPSPPP----------PVYKYKS--PPPPVYSPP-PPV 547
           YKYKSPPPP          PYKY SPPP          P YKYKS  PPPPVYSPP  P 
Sbjct: 87  YKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPP 146

Query: 548 YKYKS--PPPPVYS 583
           YKYKS  PPPPVYS
Sbjct: 147 YKYKSPPPPPPVYS 160

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 39/76 (51%), Positives = 39/76 (51%), Gaps = 28/76 (36%)
 Frame = +2

Query: 440 SPPPPAKKPYKYPSP-----------PPPVYKYKS--PPPPVYS-------------PPP 541
           S P      Y Y SP           PPPVYKYKS  PPPPVYS             PPP
Sbjct: 25  SLPSETSANYHYSSPPPPYYYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPP 84

Query: 542 PVYKYKS--PPPPVYS 583
           PVYKYKS  PPPPVYS
Sbjct: 85  PVYKYKSPPPPPPVYS 100

[9][TOP]
>UniRef100_Q9C669 Putative uncharacterized protein F28B23.9 n=1 Tax=Arabidopsis
           thaliana RepID=Q9C669_ARATH
          Length = 443

 Score =  304 bits (778), Expect = 4e-81
 Identities = 142/205 (69%), Positives = 143/205 (69%), Gaps = 12/205 (5%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           Y SPPPPP         PY Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 67  YSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 126

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS-PPP 334
           YKSPPPP Y Y SPPPP Y Y SPPPP Y YKSPPPP   PY Y  PPPP Y Y S PPP
Sbjct: 127 YKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSPPPPPPYVYQSPPPP 183

Query: 335 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSP 514
           PY Y SPPPPPY Y SPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP Y YKSP
Sbjct: 184 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPPPYVYKSP 240

Query: 515 PPPVY---SPPPPVYKYKSPPPPVY 580
           PPP Y   SPPPP Y YKSPPPP Y
Sbjct: 241 PPPPYVYSSPPPPPYVYKSPPPPPY 265

 Score =  304 bits (778), Expect = 4e-81
 Identities = 142/205 (69%), Positives = 142/205 (69%), Gaps = 12/205 (5%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           YKSPPPPP         PY Y SPPPP Y Y SPPPP Y Y  PPPPPY Y SPPPP Y 
Sbjct: 127 YKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYV 186

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS-PPP 334
           Y SPPPP Y YKSPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP Y Y S PPP
Sbjct: 187 YSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPPPYVYKSPPPP 243

Query: 335 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSP 514
           PY Y SPPPPPY Y SPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP Y Y SP
Sbjct: 244 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPPPYVYSSP 300

Query: 515 PPPVY---SPPPPVYKYKSPPPPVY 580
           PPP Y   SPPPP Y YKSPPPP Y
Sbjct: 301 PPPPYVYSSPPPPPYVYKSPPPPPY 325

 Score =  303 bits (777), Expect = 5e-81
 Identities = 141/198 (71%), Positives = 141/198 (71%), Gaps = 5/198 (2%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           YKSPPPPP   Y Y  PPPP Y Y SPPPP Y Y SPPPPPY Y SPPPP Y Y SPPPP
Sbjct: 157 YKSPPPPP---YVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 213

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS-PPPPYKYPSP 355
            Y YKSPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP Y Y S PPPPY Y SP
Sbjct: 214 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPPPYVYKSPPPPPYVYSSP 270

Query: 356 PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY-- 529
           PPPPY Y SPPPP Y Y SPPPP Y Y SPPPP   PY Y SPPPP Y YKSPPPP Y  
Sbjct: 271 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPP---PYVYSSPPPPPYVYKSPPPPPYVY 327

Query: 530 -SPPPPVYKYKSPPPPVY 580
            SPPPP Y YKSPPPP Y
Sbjct: 328 TSPPPPPYVYKSPPPPPY 345

 Score =  303 bits (775), Expect = 8e-81
 Identities = 141/205 (68%), Positives = 143/205 (69%), Gaps = 12/205 (5%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           Y SPPPPP         PY Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 87  YNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 146

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP 337
           Y SPPPP Y YKSPPPP Y Y  PPPP Y Y+SPPPPP   Y Y SPPPP Y Y SPPPP
Sbjct: 147 YSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPP---YVYSSPPPPPYVYKSPPPP 203

Query: 338 -YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSP 514
            Y Y SPPPPPY Y SPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP Y YKSP
Sbjct: 204 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPPPYVYKSP 260

Query: 515 PPPVY---SPPPPVYKYKSPPPPVY 580
           PPP Y   SPPPP Y YKSPPPP Y
Sbjct: 261 PPPPYVYSSPPPPPYVYKSPPPPPY 285

 Score =  303 bits (775), Expect = 8e-81
 Identities = 141/205 (68%), Positives = 143/205 (69%), Gaps = 12/205 (5%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 157
           YKSPPPPP         PY Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 107 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYV 166

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP 337
           Y  PPPP Y Y+SPPPP Y Y SPPPP Y YKSPPPPP   Y Y SPPPP Y Y SPPPP
Sbjct: 167 YSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPP---YVYSSPPPPPYVYKSPPPP 223

Query: 338 -YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSP 514
            Y Y SPPPPPY Y SPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP Y YKSP
Sbjct: 224 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPPPYVYKSP 280

Query: 515 PPPVY---SPPPPVYKYKSPPPPVY 580
           PPP Y   SPPPP Y Y SPPPP Y
Sbjct: 281 PPPPYVYSSPPPPPYVYSSPPPPPY 305

 Score =  292 bits (748), Expect = 1e-77
 Identities = 141/210 (67%), Positives = 142/210 (67%), Gaps = 17/210 (8%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYK-----YNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYK 163
           Y SPPP     Y  PSPPP VYK     Y+SPPPP Y Y SPPPPPY Y SPPPP Y Y 
Sbjct: 42  YNSPPP---YVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYS 98

Query: 164 SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP-------PPKKPYKYPSPPPPVYKYN 322
           SPPPP Y YKSPPPP Y Y SPPPP Y YKSPPP       PP  PY Y SPPPP Y Y 
Sbjct: 99  SPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYK 158

Query: 323 S-PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVY 499
           S PPPPY Y  PPPPPY Y SPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP Y
Sbjct: 159 SPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPPPY 215

Query: 500 KYKSPPPPVY---SPPPPVYKYKSPPPPVY 580
            YKSPPPP Y   SPPPP Y YKSPPPP Y
Sbjct: 216 VYKSPPPPPYVYSSPPPPPYVYKSPPPPPY 245

 Score =  286 bits (732), Expect = 8e-76
 Identities = 137/207 (66%), Positives = 139/207 (67%), Gaps = 14/207 (6%)
 Frame = +2

Query: 2   YKSPPPP--PKKPYKYPSPPPPVYKYNSP--------PPPYKYPSPPPPPYKYPSPPPPV 151
           Y   P P  P  PY Y SPPP  Y YNSP        PPPY Y SPPPPPY Y SPPPP 
Sbjct: 27  YSPTPTPYSPLPPYVYNSPPP--YVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPP 84

Query: 152 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS-P 328
           Y Y SPPPP Y Y SPPPP Y YKSPPPP Y Y SPPPP   PY Y SPPPP Y Y+S P
Sbjct: 85  YVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPP 141

Query: 329 PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYK 508
           PPPY Y SPPPPPY Y SPPPP Y Y  PPPP Y Y+SPPPP   PY Y SPPPP Y YK
Sbjct: 142 PPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPP---PYVYSSPPPPPYVYK 198

Query: 509 SPPPPVY---SPPPPVYKYKSPPPPVY 580
           SPPPP Y   SPPPP Y YKSPPPP Y
Sbjct: 199 SPPPPPYVYSSPPPPPYVYKSPPPPPY 225

 Score =  285 bits (730), Expect = 1e-75
 Identities = 138/206 (66%), Positives = 142/206 (68%), Gaps = 12/206 (5%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNS-PPPPYKYPSPPPPPYKYPSPPPPVYK 157
           Y+SPPPPP         PY Y SPPPP Y Y+S PPPPY Y SPPPPPY Y SPPPP Y 
Sbjct: 177 YQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 236

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS-PPP 334
           YKSPPPP Y Y SPPPP Y YKSPPPP Y Y SPPPP   PY Y SPPPP Y Y+S PPP
Sbjct: 237 YKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPP 293

Query: 335 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVY--KYK 508
           PY Y SPPPPPY Y SPPPP Y YKSPPPP Y Y SPPPP   PY Y SPPPP Y   Y 
Sbjct: 294 PYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPP---PYVYKSPPPPPYVDSYS 350

Query: 509 SPPPP-VYSPPPPVYKYKSPPPPVYS 583
            PP P VY PPP VYK   PPP VY+
Sbjct: 351 PPPAPYVYKPPPYVYK---PPPYVYN 373

 Score =  282 bits (722), Expect = 1e-74
 Identities = 135/194 (69%), Positives = 136/194 (70%), Gaps = 3/194 (1%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           YKSPPPPP   Y Y SPPPP Y Y SPPPP Y Y SPPPPPY Y SPPPP Y Y SPPPP
Sbjct: 197 YKSPPPPP---YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 253

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS-PPPPYKYPSP 355
            Y YKSPPPP Y Y SPPPP Y YKSPPPP   PY Y SPPPP Y Y+S PPPPY Y SP
Sbjct: 254 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPPPYVYSSPPPPPYVYSSP 310

Query: 356 PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPY-KYPSPPPPVYKYKSPPPPVYS 532
           PPPPY Y SPPPP Y Y SPPPP Y YKSPPPP   PY    SPPP  Y YK PPP VY 
Sbjct: 311 PPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPP---PYVDSYSPPPAPYVYK-PPPYVYK 366

Query: 533 PPPPVYKYKSPPPP 574
           PPP VY Y  PP P
Sbjct: 367 PPPYVYNYSPPPAP 380

 Score =  264 bits (675), Expect = 3e-69
 Identities = 131/207 (63%), Positives = 131/207 (63%), Gaps = 16/207 (7%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           YKSPPPPP   Y Y SPPPP Y Y SPPPP Y Y SPPPPPY Y SPPPP Y Y SPPPP
Sbjct: 217 YKSPPPPP---YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 273

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS-PPPPYKYPSP 355
            Y YKSPPPP Y Y SPPPP Y Y SPPPP   PY Y SPPPP Y Y S PPPPY Y SP
Sbjct: 274 PYVYKSPPPPPYVYSSPPPPPYVYSSPPPP---PYVYSSPPPPPYVYKSPPPPPYVYTSP 330

Query: 356 PPPPYKYPSPPPPVY--KYKSPP------PPVYKYKSPP-----PPAKKPYKYPSPPPPV 496
           PPPPY Y SPPPP Y   Y  PP      PP Y YK PP      P   PY Y  PPP V
Sbjct: 331 PPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYSPPPAPYVY-KPPPYV 389

Query: 497 YKYKSPPPP-VYSPPPPVYKYKSPPPP 574
           Y Y  PP P VY PPP VY Y  PP P
Sbjct: 390 YSYSPPPAPYVYKPPPYVYSYSPPPAP 416

 Score =  227 bits (578), Expect = 6e-58
 Identities = 113/180 (62%), Positives = 114/180 (63%), Gaps = 1/180 (0%)
 Frame = +2

Query: 47  SPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKS 226
           SP P  Y   SP PPY Y SPPP  Y  PSPPP VYK     PP Y Y SPPPP Y Y S
Sbjct: 28  SPTPTPY---SPLPPYVYNSPPPYVYNSPSPPPYVYK-----PPPYIYSSPPPPPYVYSS 79

Query: 227 PPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYK 403
           PPPP Y Y SPPPPP   Y Y SPPPP Y Y SPPPP Y Y SPPPPPY Y SPPPP Y 
Sbjct: 80  PPPPPYVYNSPPPPP---YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 136

Query: 404 YKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           Y SPPPP Y Y SPPPP   PY Y SPPPP Y Y  PPPP Y     VY+   PPP VYS
Sbjct: 137 YSSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSPPPPPPY-----VYQSPPPPPYVYS 188

 Score =  199 bits (507), Expect = 1e-49
 Identities = 113/187 (60%), Positives = 116/187 (62%), Gaps = 4/187 (2%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKY--PSPPPPVYKYKSPP 172
           YKSPPPPP   Y Y SPPPP Y Y+SPPPP Y Y SPPPPPY Y  P PPP  Y Y SPP
Sbjct: 277 YKSPPPPP---YVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPP--YVYTSPP 331

Query: 173 PPVYKYKSPPPPVY-KYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP 349
           PP Y YKSPPPP Y    SPPP  Y YK P      PY Y  PPP VY Y+ PP PY Y 
Sbjct: 332 PPPYVYKSPPPPPYVDSYSPPPAPYVYKPP------PYVY-KPPPYVYNYSPPPAPYVY- 383

Query: 350 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY 529
            PPP  Y Y SPPP  Y YK PPP VY Y   PPPA  PY Y  PPP VY   SPPP   
Sbjct: 384 KPPPYVYSY-SPPPAPYVYK-PPPYVYSYS--PPPA--PYVY-KPPPYVYSSPSPPPYYS 436

Query: 530 SPPPPVY 550
           SP PP+Y
Sbjct: 437 SPSPPLY 443

[10][TOP]
>UniRef100_P06599 Extensin n=1 Tax=Daucus carota RepID=EXTN_DAUCA
          Length = 306

 Score =  269 bits (687), Expect = 1e-70
 Identities = 142/232 (61%), Positives = 152/232 (65%), Gaps = 38/232 (16%)
 Frame = +2

Query: 2   YKSPPPPPKKP------YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYK 163
           Y+SPPPP   P      YKY SPPPP++   SPPPPY + SPPPP +  P PP PVYKYK
Sbjct: 59  YESPPPPKHSPPPPTPVYKYKSPPPPMH---SPPPPYHFESPPPPKHS-PPPPTPVYKYK 114

Query: 164 SPPPPV--------YKYKSPPPP--VYKYKSPPPPV--------YKYKSPPPPPKKP--- 280
           SPPPP         YKYKSPPPP  VYKYKSPPPP         YKYKSPPPP   P   
Sbjct: 115 SPPPPKHSPAPVHHYKYKSPPPPTPVYKYKSPPPPKHSPAPEHHYKYKSPPPPKHFPAPE 174

Query: 281 ----YKYPSPPPP--VYKYNSPPPP---YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 433
               YKY SPPPP  VYKY SPPPP   YKY SPPPP  K+   P   YKYKSPPPP   
Sbjct: 175 HHYKYKYKSPPPPTPVYKYKSPPPPTPVYKYKSPPPP--KHSPAPVHHYKYKSPPPPTPV 232

Query: 434 YKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPP--VYKYKSPPPPVYS 583
           YKSPPPP   P     PP PVYKYKSPPPP++SPPPP  VYKYKSPPPP++S
Sbjct: 233 YKSPPPPEHSP----PPPTPVYKYKSPPPPMHSPPPPTPVYKYKSPPPPMHS 280

 Score =  259 bits (661), Expect = 1e-67
 Identities = 140/233 (60%), Positives = 151/233 (64%), Gaps = 50/233 (21%)
 Frame = +2

Query: 35  YKYPSPPPPVYKY------NSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV----- 181
           Y Y SPPPP  ++      +SPPPPY Y SPPPP +  P PP PVYKYKSPPPP+     
Sbjct: 34  YTYSSPPPP--EHSPPPPEHSPPPPYHYESPPPPKHS-PPPPTPVYKYKSPPPPMHSPPP 90

Query: 182 -YKYKSPPPPVYKYKSPPP-PVYKYKSPPPPPKKP-----YKYPSPPP--PVYKYNSPPP 334
            Y ++SPPPP  K+  PPP PVYKYKSPPPP   P     YKY SPPP  PVYKY SPPP
Sbjct: 91  PYHFESPPPP--KHSPPPPTPVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYKYKSPPP 148

Query: 335 P---------YKYPSPPPP----------PYKYPSPPP--PVYKYKSPPP--PVYKYKSP 445
           P         YKY SPPPP           YKY SPPP  PVYKYKSPPP  PVYKYKSP
Sbjct: 149 PKHSPAPEHHYKYKSPPPPKHFPAPEHHYKYKYKSPPPPTPVYKYKSPPPPTPVYKYKSP 208

Query: 446 PPPAKKP-----YKYPSPPPPVYKYKSPPPPVYSPPP--PVYKYKSPPPPVYS 583
           PPP   P     YKY SPPPP   YKSPPPP +SPPP  PVYKYKSPPPP++S
Sbjct: 209 PPPKHSPAPVHHYKYKSPPPPTPVYKSPPPPEHSPPPPTPVYKYKSPPPPMHS 261

 Score =  248 bits (632), Expect = 3e-64
 Identities = 137/243 (56%), Positives = 140/243 (57%), Gaps = 52/243 (21%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPP---------VYKYNSPPPP---------YKYPSPPPP 118
           YKSPPPP   P  PY + SPPPP         VYKY SPPPP         YKY SPPPP
Sbjct: 78  YKSPPPPMHSPPPPYHFESPPPPKHSPPPPTPVYKYKSPPPPKHSPAPVHHYKYKSPPPP 137

Query: 119 P--YKYPSPPPPV--------YKYKSPPPPV----------YKYKSPPPP--VYKYKSPP 232
              YKY SPPPP         YKYKSPPPP           YKYKSPPPP  VYKYKSPP
Sbjct: 138 TPVYKYKSPPPPKHSPAPEHHYKYKSPPPPKHFPAPEHHYKYKYKSPPPPTPVYKYKSPP 197

Query: 233 PP--VYKYKSPPPPPKKP-----YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPP 391
           PP  VYKYKSPPPP   P     YKY SPPPP   Y SPPPP   P PP P YKY SPPP
Sbjct: 198 PPTPVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYKSPPPPEHSPPPPTPVYKYKSPPP 257

Query: 392 PVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV--YKYKSP 565
           P++    PP PVYKYKSPPPP                  SPPPPVYSPPPP   Y Y SP
Sbjct: 258 PMHS-PPPPTPVYKYKSPPPP----------------MHSPPPPVYSPPPPKHHYSYTSP 300

Query: 566 PPP 574
           PPP
Sbjct: 301 PPP 303

 Score =  142 bits (358), Expect = 2e-32
 Identities = 81/147 (55%), Positives = 84/147 (57%), Gaps = 41/147 (27%)
 Frame = +2

Query: 2   YKSPPPPPKKP-------YKYPSPPPP--VYKYNSPPPP---YKYPSPPPPP-------- 121
           YKSPPPP   P       YKY SPPPP  VYKY SPPPP   YKY SPPPP         
Sbjct: 161 YKSPPPPKHFPAPEHHYKYKYKSPPPPTPVYKYKSPPPPTPVYKYKSPPPPKHSPAPVHH 220

Query: 122 YKYPSPPPPVYKYKSPPPP---------VYKYKSPPPP---------VYKYKSPPPPVYK 247
           YKY SPPPP   YKSPPPP         VYKYKSPPPP         VYKYKSPPPP++ 
Sbjct: 221 YKYKSPPPPTPVYKSPPPPEHSPPPPTPVYKYKSPPPPMHSPPPPTPVYKYKSPPPPMHS 280

Query: 248 YKSP---PPPPKKPYKYPSPPPPVYKY 319
              P   PPPPK  Y Y SPP P + Y
Sbjct: 281 PPPPVYSPPPPKHHYSYTSPP-PPHHY 306

[11][TOP]
>UniRef100_Q39599 Extensin n=1 Tax=Catharanthus roseus RepID=Q39599_CATRO
          Length = 225

 Score =  261 bits (666), Expect = 4e-68
 Identities = 139/218 (63%), Positives = 142/218 (65%), Gaps = 24/218 (11%)
 Frame = +2

Query: 2   YKSPPPPP-KKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           Y SPPPP    PY Y SPPPP       PP +KYP PPPP YK P PPPPV  YKSPPPP
Sbjct: 16  YSSPPPPHYSPPYHYKSPPPP-------PPVHKYPPPPPPFYKSPPPPPPV--YKSPPPP 66

Query: 179 VYKYKSPPPP---VYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPP------VYKYNSPP 331
            YKYKSPPPP    YKYKSPPPP   YKSPPPPP KPYKY SPPPP       YKY SPP
Sbjct: 67  PYKYKSPPPPPHKPYKYKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPP 126

Query: 332 ------PPYKYPSPPPPP--YKYPSP-PPPVYKYKSPPPP--VYKYKSPPPPAKKPYKYP 478
                 PPY Y SPPPPP  +KYP P PPPVYK    PPP   YKYKSPPPP       P
Sbjct: 127 PPPVYKPPYVYKSPPPPPSVHKYPPPSPPPVYKSPPSPPPKKPYKYKSPPPPPIHKSPLP 186

Query: 479 SPPPPVYKYKSPPP-PVY-SPPPP-VYKYKSPPPPVYS 583
           SPP   YKYK PPP PVY SPPPP  Y Y SPPPP Y+
Sbjct: 187 SPPKKPYKYKYPPPTPVYKSPPPPHHYLYTSPPPPPYN 224

 Score =  194 bits (494), Expect = 3e-48
 Identities = 109/199 (54%), Positives = 112/199 (56%), Gaps = 54/199 (27%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPV---YKYKSPP 172
           YKSPPPPP   +KYP PPPP YK + PPPP  Y SPPPPPYKY SPPPP    YKYKSPP
Sbjct: 30  YKSPPPPPPV-HKYPPPPPPFYK-SPPPPPPVYKSPPPPPYKYKSPPPPPHKPYKYKSPP 87

Query: 173 PPVYKYKSPPPPV---YKYKSPPPPV------YKYKSPPPPP--KKPYKYPSPPPPV--- 310
           PP   YKSPPPP    YKYKSPPPP       YKYKSPPPPP  K PY Y SPPPP    
Sbjct: 88  PPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPPYVYKSPPPPPSVH 147

Query: 311 ----------------------YKYNSPPPP--------------YKYPSPPPPPYKYPS 382
                                 YKY SPPPP              YKY  PPP P  Y S
Sbjct: 148 KYPPPSPPPVYKSPPSPPPKKPYKYKSPPPPPIHKSPLPSPPKKPYKYKYPPPTPV-YKS 206

Query: 383 PPPP-VYKYKSPPPPVYKY 436
           PPPP  Y Y SPPPP Y +
Sbjct: 207 PPPPHHYLYTSPPPPPYNH 225

[12][TOP]
>UniRef100_Q09082 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q09082_SOLLC
          Length = 388

 Score =  261 bits (666), Expect = 4e-68
 Identities = 142/235 (60%), Positives = 144/235 (61%), Gaps = 42/235 (17%)
 Frame = +2

Query: 2   YKSPPPP-PKKPYKYPSPPPPVYKYNSPPPP-----YKYPSPPPPPYKYPSPPPPV--YK 157
           YKSPPPP PK  YK P PP P Y Y SPPPP     YK P PP P Y Y SPPPP   Y 
Sbjct: 156 YKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYV 215

Query: 158 YKSPPPPV--YKYKSPPPPV--YKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYK 316
           YKSPPPP   Y YKSPPPP   Y YKSPPPP Y YKSPPPP   P  PY Y SPPPP   
Sbjct: 216 YKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS-- 273

Query: 317 YNSPPPPYKYPSPPPP------PYKYPSPPPPV------YKYKSPPPPV------YKYKS 442
             SPPPPY Y SPPPP      PY Y SPPPP       Y YK PPPP       Y YKS
Sbjct: 274 -PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKCPPPPSPSPPPPYYYKS 332

Query: 443 PPPPAKKP---YKYPSPPPPV------YKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
           PPPP+  P   Y Y SPPPPV      Y Y SPPPPV SPPPPVY Y SPPPPV+
Sbjct: 333 PPPPSPSPPPPYYYHSPPPPVNSPPPPYYYSSPPPPVKSPPPPVYIYGSPPPPVH 387

 Score =  257 bits (656), Expect = 5e-67
 Identities = 139/226 (61%), Positives = 140/226 (61%), Gaps = 35/226 (15%)
 Frame = +2

Query: 2   YKSPPPP-PKKPYKYPSPPPPVYKYNSPPPP-----YKYPSPPPPPYKYPSPPPPV--YK 157
           YKSPPPP PK  YK P PP P Y Y SPPPP     YK P PP P Y Y SPPPP   Y 
Sbjct: 96  YKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYV 155

Query: 158 YKSPPPPV--YKYKSPPPPV--YKYKSPPPPV--YKYKSPPPP-PKKPYKYPSPPPPVYK 316
           YKSPPPP   Y YKSPPPP   Y YKSPPPP   Y YKSPPPP PK  YK P PP P Y 
Sbjct: 156 YKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYV 215

Query: 317 YNSPPPP-----YKYPSPPPPPYKYPSPPPPVYKYKSP------PPPVYKYKSPPPPAKK 463
           Y SPPPP     YK P PP P Y Y SPPPP Y YKSP      PPP Y YKSPPPP+  
Sbjct: 216 YKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 275

Query: 464 P-----YKYPSP----PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           P     YK P P    PPP Y YKSPPPP  SPPPP Y YK PPPP
Sbjct: 276 PPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYY-YKCPPPP 320

 Score =  253 bits (647), Expect = 6e-66
 Identities = 143/237 (60%), Positives = 144/237 (60%), Gaps = 43/237 (18%)
 Frame = +2

Query: 2   YKSPPPP-PKKPYKYPSPPPPVYKYNSPPPP-----YKYPSPPPPPYKYPSPPPPV--YK 157
           YKSPPPP PK  YK P PP P Y Y SPPPP     YK P PP P Y Y SPPPP   Y 
Sbjct: 120 YKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYV 179

Query: 158 YKSPPPPV--YKYKSPPPPV--YKYKSPPPPV--YKYKSPPPP-PKKPYKYPSPPPPVYK 316
           YKSPPPP   Y YKSPPPP   Y YKSPPPP   Y YKSPPPP PK  YK P PP P Y 
Sbjct: 180 YKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYV 239

Query: 317 YNSPPPP---YKYPSPP----PPPYKYPSPPPPV------YKYKSPPPPV------YKYK 439
           Y SPPPP   YK P PP    PPPY Y SPPPP       Y YKSPPPP       Y YK
Sbjct: 240 YKSPPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYK 299

Query: 440 SPPPPAKKP-----YKYPSPP----PPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           SPPPP+  P     YK P PP    PP Y YKSPPPP  SPPPP Y Y SPPPPV S
Sbjct: 300 SPPPPSPSPPPPYYYKCPPPPSPSPPPPYYYKSPPPPSPSPPPPYY-YHSPPPPVNS 355

 Score =  252 bits (644), Expect = 1e-65
 Identities = 141/223 (63%), Positives = 142/223 (63%), Gaps = 32/223 (14%)
 Frame = +2

Query: 2   YKSPPPP-PKKPYKYPSPPPPVYKYNSPPPP---YKYPSPPPPP----YKYPSPPPPVYK 157
           YKSPPPP PK  YK P PP P Y Y SPPPP   Y Y SPPPP     YK P PP P Y 
Sbjct: 12  YKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYV 71

Query: 158 YKSPPP--PVYKYKSPPP--PVYKYKSPPP--PVYKYKSPPPP-PKKPYKYPSPPPPVYK 316
           YKSPPP  P Y YKSPPP  P Y YKSPPP  P Y YKSPPPP PK  YK P PP P Y 
Sbjct: 72  YKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYV 131

Query: 317 YNSPPPP---YKYPSPPPPP----YKYPSPPPPVYKYKSPPP--PVYKYKSPPPPAKK-P 466
           Y SPPPP   Y Y SPPPP     YK P PP P Y YKSPPP  P Y YKSPPPP+ K  
Sbjct: 132 YKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYV 191

Query: 467 YKYPSPPPPVYKYKSPPPP----VY-SPPP--PVYKYKSPPPP 574
           YK P PP P Y YKSPPPP    VY SPPP  P Y YKSPPPP
Sbjct: 192 YKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP 234

 Score =  241 bits (615), Expect = 3e-62
 Identities = 136/220 (61%), Positives = 137/220 (62%), Gaps = 33/220 (15%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPV--YKYNSPPPP---YKYPSPPPPP----YKYPSPPPPVYKYKS 166
           P P   PY Y SPPPP   Y Y SPPPP   Y Y SPPPP     YK P PP P Y YKS
Sbjct: 3   PKPTPTPYYYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKS 62

Query: 167 PPP--PVYKYKSPPP--PVYKYKSPPP--PVYKYKSPPPP-PKKPYKYPSPPPPVYKYNS 325
           PPP  P Y YKSPPP  P Y YKSPPP  P Y YKSPPPP PK  YK P PP P Y Y S
Sbjct: 63  PPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKS 122

Query: 326 PPPP---YKYPSPPPPP----YKYPSPPPPVYKYKSPPP--PVYKYKSPPPPAKK-PYKY 475
           PPPP   Y Y SPPPP     YK P PP P Y YKSPPP  P Y YKSPPPP+ K  YK 
Sbjct: 123 PPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKS 182

Query: 476 PSPPPPVYKYKSPPPP----VY-SPPP--PVYKYKSPPPP 574
           P PP P Y YKSPPPP    VY SPPP  P Y YKSPPPP
Sbjct: 183 PPPPSPKYVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP 222

 Score =  135 bits (341), Expect = 2e-30
 Identities = 80/137 (58%), Positives = 80/137 (58%), Gaps = 22/137 (16%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKY-------P 133
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y       P
Sbjct: 266 YKSPPPPSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKCPPPPSP 322

Query: 134 SPPPPVYKYKSPPPPV------YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPS 295
           SPPPP Y YKSPPPP       Y Y SPPPPV    SPPPP Y Y SPPPP K      S
Sbjct: 323 SPPPPYY-YKSPPPPSPSPPPPYYYHSPPPPV-N--SPPPPYY-YSSPPPPVK------S 371

Query: 296 PPPPVYKYNSPPPPYKY 346
           PPPPVY Y SPPPP  Y
Sbjct: 372 PPPPVYIYGSPPPPVHY 388

[13][TOP]
>UniRef100_Q9FG06 Genomic DNA, chromosome 5, BAC clone:F15M7 n=1 Tax=Arabidopsis
           thaliana RepID=Q9FG06_ARATH
          Length = 689

 Score =  253 bits (647), Expect = 6e-66
 Identities = 141/249 (56%), Positives = 147/249 (59%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 100 YKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 159

Query: 131 PSPPPPVY------KYKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPP-- 268
            SPPPP Y      +YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPPPP  
Sbjct: 160 SSPPPPYYSPSPKVEYKSPPPP-YVYNSPPPPYYSPSPKIEYKSPPPP-YVYSSPPPPYY 217

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVY------KYK 409
            P     Y SPPPP Y YNSPPPPY  PSP      PPPPY Y SPPPP +      +YK
Sbjct: 218 SPSPKVDYKSPPPP-YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYFSPSPKVEYK 276

Query: 410 SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P    +Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 277 SPPPP-YVYNSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVY 334

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 335 SSPPPPYYS 343

 Score =  253 bits (645), Expect = 1e-65
 Identities = 142/249 (57%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y YNSPPPPY  PSP      PPPPY Y
Sbjct: 150 YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPPYVY 209

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 210 SSPPPPYYSPSPKVDYKSPPPP-YVYNSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYF 267

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P    +Y SPPPP Y YNSPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 268 SPSPKVEYKSPPPP-YVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVYYK 326

Query: 410 SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 327 SPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVY 384

Query: 557 KSPPPPVYS 583
            SPPP  YS
Sbjct: 385 SSPPPQYYS 393

 Score =  250 bits (639), Expect = 5e-65
 Identities = 141/249 (56%), Positives = 145/249 (58%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 125 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVY 184

Query: 131 PSPPPPVY------KYKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y      +YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 185 NSPPPPYYSPSPKIEYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYNSPPPPYY 242

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVY------KYK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y      +YK
Sbjct: 243 SPSPKVDYKSPPPP-YVYSSPPPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVEYK 301

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 302 SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVY 359

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 360 SSPPPPYYS 368

 Score =  248 bits (632), Expect = 3e-64
 Identities = 140/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 225 YKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYFSPSPKVEYKSPPPPYVY 284

Query: 131 PSPPPPVY------KYKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y      +YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 285 NSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 342

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPP  Y       YK
Sbjct: 343 SPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYK 401

Query: 410 SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 402 SPPPP-YVYSSPPPPYYSPSPKVAYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVY 459

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 460 SSPPPPYYS 468

 Score =  244 bits (622), Expect = 5e-63
 Identities = 138/249 (55%), Positives = 142/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPP Y  PSP      PPPPY Y
Sbjct: 350  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPPYVY 409

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 410  SSPPPPYYSPSPKVAYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYY 467

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P    +Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP +       YK
Sbjct: 468  SPSPKVEYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYK 526

Query: 410  SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
            SPPPP Y Y S PPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 527  SPPPP-YVYSSHPPPYYSPSPKVNYKSPPPP-YVYSSPPPPYYSPSPKVNYKSPPPPYVY 584

Query: 557  KSPPPPVYS 583
             SPPPP YS
Sbjct: 585  SSPPPPYYS 593

 Score =  242 bits (618), Expect = 1e-62
 Identities = 139/255 (54%), Positives = 144/255 (56%), Gaps = 61/255 (23%)
 Frame = +2

Query: 2   YKSPP-PPPKKPYKYPSPPPPVY----------------KYNSPPPPYKYPSP------P 112
           +KSP   P  KPY Y SPPPP Y                 YNSPPPPY  PSP      P
Sbjct: 69  HKSPKYAPHPKPYVYISPPPPSYYSPSPKVNYKSPPPPNVYNSPPPPYYSPSPKVDYKSP 128

Query: 113 PPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKS 256
           PPPY Y SPPPP Y       YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y S
Sbjct: 129 PPPYVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPP-YVYNS 186

Query: 257 PPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK-- 403
           PPPP   P    +Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y   
Sbjct: 187 PPPPYYSPSPKIEYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPS 245

Query: 404 ----YKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------P 538
               YKSPPPP Y Y SPPPP   P    +Y SPPPP Y Y SPPPP YSP        P
Sbjct: 246 PKVDYKSPPPP-YVYSSPPPPYFSPSPKVEYKSPPPP-YVYNSPPPPYYSPSPKVEYKSP 303

Query: 539 PPVYKYKSPPPPVYS 583
           PP Y Y SPPPP YS
Sbjct: 304 PPPYVYSSPPPPYYS 318

 Score =  239 bits (610), Expect = 1e-61
 Identities = 135/241 (56%), Positives = 140/241 (58%), Gaps = 47/241 (19%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P   Y  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 375  YKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPPYVY 434

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPPPP  
Sbjct: 435  SSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPYY 492

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P    +Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y S PPP Y       YK
Sbjct: 493  SPSPKVEYKSPPPP-YVYSSPPPPYHSPSPKVNYKSPPPPYVYSSHPPPYYSPSPKVNYK 551

Query: 410  SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
            SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP P V    +PPP VY
Sbjct: 552  SPPPP-YVYSSPPPPYYSPSPKVNYKSPPPP-YVYSSPPPPYYSPSPMVDYKSTPPPYVY 609

Query: 581  S 583
            S
Sbjct: 610  S 610

 Score =  234 bits (596), Expect = 5e-60
 Identities = 139/272 (51%), Positives = 142/272 (52%), Gaps = 78/272 (28%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 400  YKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 459

Query: 131  PSPPPPVY------KYKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPP-- 268
             SPPPP Y      +YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPPPP  
Sbjct: 460  SSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPYH 517

Query: 269  ----------PKKPYKYPSPPPPVYK------YNSPPPPYKYPSPPPPPYK------YPS 382
                      P  PY Y S PPP Y       Y SPPPPY Y SPPPP Y       Y S
Sbjct: 518  SPSPKVNYKSPPPPYVYSSHPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVNYKS 577

Query: 383  PPPPVYKYKSPPPPVYK------YKSPPPP-----AKKPYKYPSP------PPPVYKYKS 511
            PPPP Y Y SPPPP Y       YKS PPP        PY  PSP      PP  Y Y S
Sbjct: 578  PPPP-YVYSSPPPPYYSPSPMVDYKSTPPPYVYSFPPLPYYSPSPKVDYKSPPLPYVYSS 636

Query: 512  PPPPVYSP--------PPPVYKYKSPPPPVYS 583
            PPP  YSP        PPP Y Y SPPPP YS
Sbjct: 637  PPPLYYSPSPKVHYKSPPPPYVYNSPPPPYYS 668

 Score =  223 bits (569), Expect = 7e-57
 Identities = 130/247 (52%), Positives = 132/247 (53%), Gaps = 53/247 (21%)
 Frame = +2

Query: 2   YKSPPPPPKKP-YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSP------PPPVYKY 160
           Y SP   P+ P Y  PS      KY   P PY Y SPPPP Y  PSP      PPP   Y
Sbjct: 50  YSSPYSSPQTPHYNSPSHEHKSPKYAPHPKPYVYISPPPPSYYSPSPKVNYKSPPPPNVY 109

Query: 161 KSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPP-----PKKPYKY 289
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP     P  PY  
Sbjct: 110 NSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 168

Query: 290 PSP------PPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSP 415
           PSP      PPP Y YNSPPPPY  PSP      PPPPY Y SPPPP Y       YKSP
Sbjct: 169 PSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 228

Query: 416 PPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKS 562
           PPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP +SP        PPP Y Y S
Sbjct: 229 PPP-YVYNSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYFSPSPKVEYKSPPPPYVYNS 286

Query: 563 PPPPVYS 583
           PPPP YS
Sbjct: 287 PPPPYYS 293

 Score =  198 bits (503), Expect = 3e-49
 Identities = 115/209 (55%), Positives = 120/209 (57%), Gaps = 25/209 (11%)
 Frame = +2

Query: 32  PYKYPSPPPPVYKYNSPPPPYKYP--SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 205
           PY  P   P    YNSP   +K P  +P P PY Y SPPPP   Y SP P V  YKSPPP
Sbjct: 49  PYSSPYSSPQTPHYNSPSHEHKSPKYAPHPKPYVYISPPPP--SYYSPSPKV-NYKSPPP 105

Query: 206 PVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPP 367
           P   Y SPPPP Y      P PK  YK  SPPPP Y Y+SPPPPY  PSP      PPPP
Sbjct: 106 PNV-YNSPPPPYYS-----PSPKVDYK--SPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP 156

Query: 368 YKYPSPPPPVY------KYKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPP 520
           Y Y SPPPP Y      +YKSPPPP Y Y SPPPP   P    +Y SPPPP Y Y SPPP
Sbjct: 157 YVYSSPPPPYYSPSPKVEYKSPPPP-YVYNSPPPPYYSPSPKIEYKSPPPP-YVYSSPPP 214

Query: 521 PVYSP--------PPPVYKYKSPPPPVYS 583
           P YSP        PPP Y Y SPPPP YS
Sbjct: 215 PYYSPSPKVDYKSPPPPYVYNSPPPPYYS 243

 Score =  196 bits (498), Expect = 1e-48
 Identities = 117/218 (53%), Positives = 120/218 (55%), Gaps = 47/218 (21%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 475  YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSPPPPYVY 534

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             S PPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 535  SSHPPPYYSPSPKVNYKSPPPP-YVYSSPPPPYYSPSPKVNYKSPPPP-YVYSSPPPPYY 592

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y S PPP Y Y+ PP PY  PSP      PP PY Y SPPP  Y       YK
Sbjct: 593  SPSPMVDYKSTPPP-YVYSFPPLPYYSPSPKVDYKSPPLPYVYSSPPPLYYSPSPKVHYK 651

Query: 410  SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSP 514
            SPPPP Y Y SPPPP   P     Y SPPPP Y YK+P
Sbjct: 652  SPPPP-YVYNSPPPPYYSPSPKVTYKSPPPP-YVYKAP 687

 Score =  193 bits (490), Expect = 9e-48
 Identities = 116/229 (50%), Positives = 120/229 (52%), Gaps = 56/229 (24%)
 Frame = +2

Query: 65  YKYNSPPPPYKYPSPPPPPYKYPS---------PPPPVYKYKSPPPPVY-------KYKS 196
           Y Y+SP     Y SP  P Y  PS         P P  Y Y SPPPP Y        YKS
Sbjct: 48  YPYSSP-----YSSPQTPHYNSPSHEHKSPKYAPHPKPYVYISPPPPSYYSPSPKVNYKS 102

Query: 197 PPPPVYKYKSPPPPVYK------YKSPPPP-----PKKPYKYPSP------PPPVYKYNS 325
           PPPP   Y SPPPP Y       YKSPPPP     P  PY  PSP      PPP Y Y+S
Sbjct: 103 PPPP-NVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSS 161

Query: 326 PPPPYKYPSP------PPPPYKYPSPPPPVY------KYKSPPPPVYKYKSPPPPAKKP- 466
           PPPPY  PSP      PPPPY Y SPPPP Y      +YKSPPPP Y Y SPPPP   P 
Sbjct: 162 PPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPP-YVYSSPPPPYYSPS 220

Query: 467 --YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
               Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP +S
Sbjct: 221 PKVDYKSPPPP-YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYFS 268

[14][TOP]
>UniRef100_Q9SK35 Putative uncharacterized protein At2g24980 n=1 Tax=Arabidopsis
           thaliana RepID=Q9SK35_ARATH
          Length = 559

 Score =  252 bits (644), Expect = 1e-65
 Identities = 142/249 (57%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y YNSPPPPY  PSP      PPPPY Y
Sbjct: 120 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVY 179

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 180 SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 237

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 238 SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 296

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 297 SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVY 354

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 355 SSPPPPYYS 363

 Score =  252 bits (644), Expect = 1e-65
 Identities = 140/248 (56%), Positives = 142/248 (57%), Gaps = 54/248 (21%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 270  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 329

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 330  SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 387

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y YNSPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 388  SPSPKVYYKSPPPP-YVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 446

Query: 410  SPPPPVYKYKSPPPP--AKKPYKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYK 559
            SPPPP Y Y SPPPP  +  P  Y   PPP Y Y SPPPP YSP        PPP Y Y 
Sbjct: 447  SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPSYVYS 505

Query: 560  SPPPPVYS 583
            SPPPP YS
Sbjct: 506  SPPPPYYS 513

 Score =  250 bits (639), Expect = 5e-65
 Identities = 141/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 70  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 129

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 130 SSPPPPYYSPSPKVDYKSPPPP-YVYNSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYY 187

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 188 SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 246

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 247 SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVY 304

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 305 SSPPPPYYS 313

 Score =  250 bits (639), Expect = 5e-65
 Identities = 141/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 145 YKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 204

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 205 SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 262

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 263 SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 321

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 322 SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVY 379

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 380 SSPPPPYYS 388

 Score =  250 bits (639), Expect = 5e-65
 Identities = 141/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 195 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 254

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 255 SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 312

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 313 SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 371

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 372 SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYNSPPPPYYSPSPKVYYKSPPPPYVY 429

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 430 SSPPPPYYS 438

 Score =  250 bits (639), Expect = 5e-65
 Identities = 141/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 220 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 279

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 280 SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 337

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 338 SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 396

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 397 SPPPP-YVYNSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVY 454

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 455 SSPPPPYYS 463

 Score =  250 bits (638), Expect = 7e-65
 Identities = 141/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 95  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 154

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 155 NSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 212

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 213 SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 271

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 272 SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVY 329

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 330 SSPPPPYYS 338

 Score =  250 bits (638), Expect = 7e-65
 Identities = 141/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 245 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 304

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 305 SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 362

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 363 SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPPPPYYSPSPKVYYK 421

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 422 SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPSYVY 479

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 480 SSPPPPYYS 488

 Score =  247 bits (631), Expect = 4e-64
 Identities = 138/248 (55%), Positives = 141/248 (56%), Gaps = 54/248 (21%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 295  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 354

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 355  SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYNSPPPPYY 412

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 413  SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 471

Query: 410  SPPPPVYKYKSPPPP--AKKPYKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYK 559
            SPPP  Y Y SPPPP  +  P  Y   PPP Y Y SPPPP YSP        PPP Y Y 
Sbjct: 472  SPPPS-YVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPPYVYS 530

Query: 560  SPPPPVYS 583
            SPPPP YS
Sbjct: 531  SPPPPYYS 538

 Score =  243 bits (621), Expect = 6e-63
 Identities = 137/241 (56%), Positives = 139/241 (57%), Gaps = 48/241 (19%)
 Frame = +2

Query: 5   KSPPPP----PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVY 154
           KS PPP    P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y
Sbjct: 54  KSSPPPQYYTPSPKVNYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYY 112

Query: 155 K------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKKPYKY 289
                  YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP   P     Y
Sbjct: 113 SPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYNSPPPPYYSPSPKVDY 170

Query: 290 PSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYK 433
            SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP Y 
Sbjct: 171 KSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP-YV 228

Query: 434 YKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVY 580
           Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP Y
Sbjct: 229 YSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY 287

Query: 581 S 583
           S
Sbjct: 288 S 288

 Score =  239 bits (609), Expect = 2e-61
 Identities = 136/238 (57%), Positives = 138/238 (57%), Gaps = 47/238 (19%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 320  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 379

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 380  SSPPPPYYSPSPKVYYKSPPPP-YVYNSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 437

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPP Y Y SPPPP Y       YK
Sbjct: 438  SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYK 496

Query: 410  SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            SPPP  Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP P V  YKSPPPP
Sbjct: 497  SPPPS-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKV-TYKSPPPP 551

 Score =  230 bits (586), Expect = 7e-59
 Identities = 132/238 (55%), Positives = 133/238 (55%), Gaps = 44/238 (18%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK-- 157
           Y SP    K P   P P P  Y  +SPPP Y  PSP      PPPPY Y SPPPP Y   
Sbjct: 33  YNSPSYEHKGPKYAPHPKP--YVKSSPPPQYYTPSPKVNYKSPPPPYVYSSPPPPYYSPS 90

Query: 158 ----YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKKPYKYPSP 298
               YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP   P     Y SP
Sbjct: 91  PKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSP 148

Query: 299 PPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKS 442
           PPP Y YNSPPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP Y Y S
Sbjct: 149 PPP-YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP-YVYSS 206

Query: 443 PPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
           PPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 207 PPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYS 263

 Score =  211 bits (537), Expect = 3e-53
 Identities = 120/217 (55%), Positives = 123/217 (56%), Gaps = 46/217 (21%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 345 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 404

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 405 NSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 462

Query: 269 PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKS 412
              P  Y   PPP Y Y+SPPPPY  PSP      PPP Y Y SPPPP Y       YKS
Sbjct: 463 SPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKS 522

Query: 413 PPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSP 514
           PPPP Y Y SPPPP   P     Y SPPPP Y YK+P
Sbjct: 523 PPPP-YVYSSPPPPYYSPSPKVTYKSPPPP-YVYKTP 557

 Score =  171 bits (432), Expect = 5e-41
 Identities = 103/218 (47%), Positives = 105/218 (48%), Gaps = 74/218 (33%)
 Frame = +2

Query: 152 YKYKSP----------------------------PPPVY-------KYKSPPPPVYKYKS 226
           Y Y SP                            PPP Y        YKSPPPP Y Y S
Sbjct: 23  YPYSSPQTPSYNSPSYEHKGPKYAPHPKPYVKSSPPPQYYTPSPKVNYKSPPPP-YVYSS 81

Query: 227 PPPPVYK------YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP 355
           PPPP Y       YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP
Sbjct: 82  PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 141

Query: 356 ------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPP--AKKPYKYPSPPPP 493
                 PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP  +  P  Y   PPP
Sbjct: 142 KVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPP 200

Query: 494 VYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
            Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 201 PYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYS 238

[15][TOP]
>UniRef100_UPI0001739340 ATHRGP1 (HYDROXYPROLINE-RICH GLYCOPROTEIN); structural constituent of
            cell wall n=1 Tax=Arabidopsis thaliana
            RepID=UPI0001739340
          Length = 699

 Score =  252 bits (643), Expect = 2e-65
 Identities = 141/241 (58%), Positives = 143/241 (59%), Gaps = 47/241 (19%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 374  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 433

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 434  SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 491

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 492  SPSPKVHYKSPPPP-YVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYK 550

Query: 410  SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
            SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP P VY YKSPPPP Y
Sbjct: 551  SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVY-YKSPPPPYY 607

Query: 581  S 583
            S
Sbjct: 608  S 608

 Score =  251 bits (641), Expect = 3e-65
 Identities = 141/249 (56%), Positives = 144/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 249 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 308

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPPPP  
Sbjct: 309 SSPPPPTYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPTY 366

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 367 SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 425

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 426 SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVY 483

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 484 SSPPPPYYS 492

 Score =  249 bits (635), Expect = 1e-64
 Identities = 143/272 (52%), Positives = 145/272 (53%), Gaps = 78/272 (28%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 199  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 258

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 259  SSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPTY 316

Query: 269  ----------PKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPPPYK------YPS 382
                      P  PY Y SPPPP Y      +Y SPPPPY Y SPPPP Y       Y S
Sbjct: 317  SPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKS 376

Query: 383  PPPPVYKYKSPPPPVYK------YKSPPPP-----AKKPYKYPSP------PPPVYKYKS 511
            PPPP Y Y SPPPP Y       YKSPPPP        PY  PSP      PPP Y Y S
Sbjct: 377  PPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSS 435

Query: 512  PPPPVYSP--------PPPVYKYKSPPPPVYS 583
            PPPP YSP        PPP Y Y SPPPP YS
Sbjct: 436  PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYS 467

 Score =  247 bits (630), Expect = 6e-64
 Identities = 140/252 (55%), Positives = 141/252 (55%), Gaps = 58/252 (23%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPPPVYK------YNSPPPPYKYPSPPPPPYK------YPSPPP 145
            YKSPPPP    Y Y SPPPP Y       Y SPPPPY Y SPPPP Y       Y SPPP
Sbjct: 349  YKSPPPP----YVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP 404

Query: 146  PVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPP-----PK 274
            P Y Y SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP     P 
Sbjct: 405  P-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 462

Query: 275  KPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK----- 403
             PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y      
Sbjct: 463  PPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKV 522

Query: 404  -YKSPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPV 547
             YKSPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP 
Sbjct: 523  HYKSPPPP-YVYNSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP 580

Query: 548  YKYKSPPPPVYS 583
            Y Y SPPPP YS
Sbjct: 581  YVYSSPPPPYYS 592

 Score =  241 bits (616), Expect = 2e-62
 Identities = 140/272 (51%), Positives = 143/272 (52%), Gaps = 78/272 (28%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 424  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 483

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 484  SSPPPPYYSPSPKVHYKSPPPP-YVYSSPPPPYYSPSPKVHYKSPPPP-YVYNSPPPPYY 541

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 542  SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 600

Query: 410  SPPPPVYK------YKSPPPP----------------------AKKPYKYPSPPPPVYK- 502
            SPPPP Y       YKSPP P                         PY Y SPPPP Y  
Sbjct: 601  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 660

Query: 503  -----YKSPPPPVYSPPPPVYKYKSPPPPVYS 583
                 YKSPPPP Y  P P  +YKSPPPP YS
Sbjct: 661  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 692

 Score =  229 bits (584), Expect = 1e-58
 Identities = 131/243 (53%), Positives = 133/243 (54%), Gaps = 49/243 (20%)
 Frame = +2

Query: 2   YKSPPP------------PPKKPYKYPSPPP-----PVYKYNSPPPPYKYPSPPPPPYKY 130
           Y SPPP             P  PY   SPPP     P  +Y SPPPPY Y SPPPP Y  
Sbjct: 34  YASPPPLYSSPLPEVEYKTPPLPYVDSSPPPTYTPAPEVEYKSPPPPYVYSSPPPPTYS- 92

Query: 131 PSPPPPVYKYKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKKPY 283
              P P   YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP   P    
Sbjct: 93  ---PSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYNSPPPPYYSPSPKV 147

Query: 284 KYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPV 427
            Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP 
Sbjct: 148 DYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP- 205

Query: 428 YKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPP 574
           Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP
Sbjct: 206 YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 264

Query: 575 VYS 583
            YS
Sbjct: 265 YYS 267

 Score =  228 bits (581), Expect = 3e-58
 Identities = 131/230 (56%), Positives = 133/230 (57%), Gaps = 36/230 (15%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYK------YNSPPPPYKYPSPPPPPYKYPSPPPPVYKYK 163
           YKSPPPP    Y Y SPPPP Y       Y SPPPPY Y SPPPP Y     P P   YK
Sbjct: 74  YKSPPPP----YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYS----PSPKVDYK 125

Query: 164 SPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYK 316
           SPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP   P    +Y SPPPP Y 
Sbjct: 126 SPPPP-YVYNSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPP-YV 182

Query: 317 YNSPPPPYKYPSP------PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYP 478
           Y+SPPPPY  PSP      PPPPY Y SPPPP Y     P P   YKSPPPP    Y Y 
Sbjct: 183 YSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS----PSPKVDYKSPPPP----YVYS 234

Query: 479 SPPPPVYK------YKSPPPP-VYSPPPPVY-------KYKSPPPP-VYS 583
           SPPPP Y       YKSPPPP VYS PPP Y        YKSPPPP VYS
Sbjct: 235 SPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYS 284

 Score =  199 bits (507), Expect = 1e-49
 Identities = 123/265 (46%), Positives = 125/265 (47%), Gaps = 85/265 (32%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 449  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVY 508

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 509  SSPPPPYYSPSPKVHYKSPPPP-YVYNSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 566

Query: 269  ----------PKKPYKYPSPPPPVYK------YNSPPPPYKYPSP--------------- 355
                      P  PY Y SPPPP Y       Y SPPPPY  PSP               
Sbjct: 567  SPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVC 626

Query: 356  -----------------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKP 466
                             PPPPY Y SPPPP Y       YKSPPPP              
Sbjct: 627  PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP-------------- 672

Query: 467  YKYPSPPPPVYKYKSPPPPVYSPPP 541
              Y SP P V +YKSPPPP YSP P
Sbjct: 673  -SYYSPSPKV-EYKSPPPPSYSPSP 695

 Score =  166 bits (419), Expect = 2e-39
 Identities = 97/182 (53%), Positives = 100/182 (54%), Gaps = 17/182 (9%)
 Frame = +2

Query: 89  PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 268
           P  Y SPPP    Y SP P V +YK+PP P     S PPP Y     P P  +YKSPPPP
Sbjct: 31  PETYASPPP---LYSSPLPEV-EYKTPPLPYVD--SSPPPTYT----PAPEVEYKSPPPP 80

Query: 269 PKKPYKYPSPPPPVYK------YNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 430
               Y Y SPPPP Y       Y SPPPPY Y SPPPP Y     P P   YKSPPPP Y
Sbjct: 81  ----YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYS----PSPKVDYKSPPPP-Y 131

Query: 431 KYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPV 577
            Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP 
Sbjct: 132 VYNSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 190

Query: 578 YS 583
           YS
Sbjct: 191 YS 192

 Score =  119 bits (298), Expect = 2e-25
 Identities = 77/161 (47%), Positives = 79/161 (49%), Gaps = 46/161 (28%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY  
Sbjct: 549  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYS 608

Query: 131  PSP-----------------PPPVYK------YKSPPPPVYKYKSPPPPVYK------YK 223
            PSP                 PPP Y       YKSPPPP Y Y SPPPP Y       YK
Sbjct: 609  PSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP-YVYNSPPPPYYSPSPKVYYK 667

Query: 224  SPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKY 346
            SPPPP Y      P PK  YK  SPPPP Y   SP P  +Y
Sbjct: 668  SPPPPSYY----SPSPKVEYK--SPPPPSY---SPSPKTEY 699

[16][TOP]
>UniRef100_Q9M1G9 Extensin-2 n=1 Tax=Arabidopsis thaliana RepID=EXTN2_ARATH
          Length = 743

 Score =  252 bits (643), Expect = 2e-65
 Identities = 141/241 (58%), Positives = 143/241 (59%), Gaps = 47/241 (19%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 418  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 477

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 478  SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 535

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 536  SPSPKVHYKSPPPP-YVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYK 594

Query: 410  SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
            SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP P VY YKSPPPP Y
Sbjct: 595  SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVY-YKSPPPPYY 651

Query: 581  S 583
            S
Sbjct: 652  S 652

 Score =  251 bits (641), Expect = 3e-65
 Identities = 141/249 (56%), Positives = 144/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 293  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 352

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPPPP  
Sbjct: 353  SSPPPPTYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPTY 410

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 411  SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 469

Query: 410  SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
            SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 470  SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVY 527

Query: 557  KSPPPPVYS 583
             SPPPP YS
Sbjct: 528  SSPPPPYYS 536

 Score =  249 bits (635), Expect = 1e-64
 Identities = 143/272 (52%), Positives = 145/272 (53%), Gaps = 78/272 (28%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 243  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 302

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 303  SSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPTY 360

Query: 269  ----------PKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPPPYK------YPS 382
                      P  PY Y SPPPP Y      +Y SPPPPY Y SPPPP Y       Y S
Sbjct: 361  SPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKS 420

Query: 383  PPPPVYKYKSPPPPVYK------YKSPPPP-----AKKPYKYPSP------PPPVYKYKS 511
            PPPP Y Y SPPPP Y       YKSPPPP        PY  PSP      PPP Y Y S
Sbjct: 421  PPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSS 479

Query: 512  PPPPVYSP--------PPPVYKYKSPPPPVYS 583
            PPPP YSP        PPP Y Y SPPPP YS
Sbjct: 480  PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYS 511

 Score =  248 bits (632), Expect = 3e-64
 Identities = 138/241 (57%), Positives = 141/241 (58%), Gaps = 47/241 (19%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVY 154
           Y SPPPP   P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y
Sbjct: 77  YSSPPPPTYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYY 135

Query: 155 K------YKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPP---PKKPYKY 289
                  YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPPPP   P     Y
Sbjct: 136 SPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPYYSPSPKVDY 193

Query: 290 PSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYK 433
            SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP Y 
Sbjct: 194 KSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP-YV 251

Query: 434 YKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVY 580
           Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP Y
Sbjct: 252 YSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYY 310

Query: 581 S 583
           S
Sbjct: 311 S 311

 Score =  247 bits (630), Expect = 6e-64
 Identities = 140/252 (55%), Positives = 141/252 (55%), Gaps = 58/252 (23%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPPPVYK------YNSPPPPYKYPSPPPPPYK------YPSPPP 145
            YKSPPPP    Y Y SPPPP Y       Y SPPPPY Y SPPPP Y       Y SPPP
Sbjct: 393  YKSPPPP----YVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP 448

Query: 146  PVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPP-----PK 274
            P Y Y SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP     P 
Sbjct: 449  P-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 506

Query: 275  KPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK----- 403
             PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y      
Sbjct: 507  PPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKV 566

Query: 404  -YKSPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPV 547
             YKSPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP 
Sbjct: 567  HYKSPPPP-YVYNSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP 624

Query: 548  YKYKSPPPPVYS 583
            Y Y SPPPP YS
Sbjct: 625  YVYSSPPPPYYS 636

 Score =  242 bits (617), Expect = 2e-62
 Identities = 140/247 (56%), Positives = 143/247 (57%), Gaps = 53/247 (21%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y YNSPPPPY  PSP      PPPPY Y
Sbjct: 93  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVY 152

Query: 131 PSPPPPVY------KYKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y      +YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 153 SSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYY 210

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYKYKSPPPPV 427
            P    +Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y     P P 
Sbjct: 211 SPSPKVEYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS----PSPK 265

Query: 428 YKYKSPPPPAKKPYKYPSPPPPVYK------YKSPPPP-VYSPPPPVY-------KYKSP 565
             YKSPPPP    Y Y SPPPP Y       YKSPPPP VYS PPP Y        YKSP
Sbjct: 266 VDYKSPPPP----YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 321

Query: 566 PPP-VYS 583
           PPP VYS
Sbjct: 322 PPPYVYS 328

 Score =  241 bits (616), Expect = 2e-62
 Identities = 140/272 (51%), Positives = 143/272 (52%), Gaps = 78/272 (28%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 468  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 527

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 528  SSPPPPYYSPSPKVHYKSPPPP-YVYSSPPPPYYSPSPKVHYKSPPPP-YVYNSPPPPYY 585

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 586  SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 644

Query: 410  SPPPPVYK------YKSPPPP----------------------AKKPYKYPSPPPPVYK- 502
            SPPPP Y       YKSPP P                         PY Y SPPPP Y  
Sbjct: 645  SPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSP 704

Query: 503  -----YKSPPPPVYSPPPPVYKYKSPPPPVYS 583
                 YKSPPPP Y  P P  +YKSPPPP YS
Sbjct: 705  SPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYS 736

 Score =  241 bits (614), Expect = 4e-62
 Identities = 133/232 (57%), Positives = 136/232 (58%), Gaps = 38/232 (16%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYK------YNSPPPPYKYPSPPPPPYKYPSPPPPVYKYK 163
           YKSPPPP    Y Y SPPPP Y       Y SPPPPY Y SPPPP Y     P P   YK
Sbjct: 68  YKSPPPP----YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYS----PSPKVDYK 119

Query: 164 SPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYK 316
           SPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP   P    +Y SPPPP Y 
Sbjct: 120 SPPPP-YVYNSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPP-YV 176

Query: 317 YNSPPPPYKYPSP------PPPPYKYPSPPPPVY------KYKSPPPPVYKYKSPPPPAK 460
           Y+SPPPPY  PSP      PPPPY Y SPPPP Y      +YKSPPPP Y Y SPPPP  
Sbjct: 177 YSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPYY 235

Query: 461 KP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
            P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 236 SPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 286

 Score =  230 bits (586), Expect = 7e-59
 Identities = 131/243 (53%), Positives = 134/243 (55%), Gaps = 49/243 (20%)
 Frame = +2

Query: 2   YKSPPP------------PPKKPYKYPSPPP-----PVYKYNSPPPPYKYPSPPPPPYKY 130
           Y SPPP             P  PY   SPPP     P  +Y SPPPPY Y SPPPP Y  
Sbjct: 28  YASPPPLYSSPLPEVEYKTPPLPYVDSSPPPTYTPAPEVEYKSPPPPYVYSSPPPPTYS- 86

Query: 131 PSPPPPVYKYKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKKPY 283
              P P   YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP   P    
Sbjct: 87  ---PSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYNSPPPPYYSPSPKV 141

Query: 284 KYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPV 427
            Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP 
Sbjct: 142 DYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP- 199

Query: 428 YKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPP 574
           Y Y SPPPP   P    +Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP
Sbjct: 200 YVYSSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 258

Query: 575 VYS 583
            YS
Sbjct: 259 YYS 261

 Score =  199 bits (507), Expect = 1e-49
 Identities = 123/265 (46%), Positives = 125/265 (47%), Gaps = 85/265 (32%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 493  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVY 552

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 553  SSPPPPYYSPSPKVHYKSPPPP-YVYNSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 610

Query: 269  ----------PKKPYKYPSPPPPVYK------YNSPPPPYKYPSP--------------- 355
                      P  PY Y SPPPP Y       Y SPPPPY  PSP               
Sbjct: 611  SPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVC 670

Query: 356  -----------------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKP 466
                             PPPPY Y SPPPP Y       YKSPPPP              
Sbjct: 671  PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP-------------- 716

Query: 467  YKYPSPPPPVYKYKSPPPPVYSPPP 541
              Y SP P V +YKSPPPP YSP P
Sbjct: 717  -SYYSPSPKV-EYKSPPPPSYSPSP 739

 Score =  157 bits (396), Expect = 8e-37
 Identities = 95/178 (53%), Positives = 99/178 (55%), Gaps = 23/178 (12%)
 Frame = +2

Query: 119 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSP 298
           P  Y SPPP    Y SP P V +YK+PP P     S PPP Y      P P+  YK  SP
Sbjct: 25  PETYASPPP---LYSSPLPEV-EYKTPPLPYVD--SSPPPTYT-----PAPEVEYK--SP 71

Query: 299 PPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKS 442
           PPP Y Y+SPPPP   PSP      PPPPY Y SPPPP Y       YKSPPPP Y Y S
Sbjct: 72  PPP-YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP-YVYNS 129

Query: 443 PPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
           PPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 130 PPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYS 186

 Score =  119 bits (298), Expect = 2e-25
 Identities = 77/161 (47%), Positives = 79/161 (49%), Gaps = 46/161 (28%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY  
Sbjct: 593  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYS 652

Query: 131  PSP-----------------PPPVYK------YKSPPPPVYKYKSPPPPVYK------YK 223
            PSP                 PPP Y       YKSPPPP Y Y SPPPP Y       YK
Sbjct: 653  PSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP-YVYNSPPPPYYSPSPKVYYK 711

Query: 224  SPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKY 346
            SPPPP Y      P PK  YK  SPPPP Y   SP P  +Y
Sbjct: 712  SPPPPSYY----SPSPKVEYK--SPPPPSY---SPSPKTEY 743

[17][TOP]
>UniRef100_Q9FG07 Gb|AAD23015.1 n=2 Tax=Arabidopsis thaliana RepID=Q9FG07_ARATH
          Length = 434

 Score =  251 bits (640), Expect = 4e-65
 Identities = 141/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 170 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 229

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 230 SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 287

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 288 SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYK 346

Query: 410 SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 347 SPPPP-YVYSSPPPPYYSPSPKVHYKSPPPP-YVYSSPPPPYYSPSPKVHYKSPPPPYVY 404

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 405 SSPPPPYYS 413

 Score =  250 bits (639), Expect = 5e-65
 Identities = 141/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 145 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 204

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 205 SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 262

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 263 SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 321

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 322 SPPPP-YVYSSPPPPYYSPSPNVYYKSPPPP-YVYSSPPPPYYSPSPKVHYKSPPPPYVY 379

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 380 SSPPPPYYS 388

 Score =  246 bits (629), Expect = 7e-64
 Identities = 140/249 (56%), Positives = 142/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 70  YKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 129

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPP  Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 130 SSPPPLYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 187

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 188 SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 246

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 247 SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVY 304

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 305 SSPPPPYYS 313

 Score =  246 bits (629), Expect = 7e-64
 Identities = 140/249 (56%), Positives = 142/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPP Y  PSP      PPPPY Y
Sbjct: 95  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPPYVY 154

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 155 SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 212

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 213 SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 271

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 272 SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVY 329

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 330 SSPPPPYYS 338

 Score =  246 bits (629), Expect = 7e-64
 Identities = 140/249 (56%), Positives = 142/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P   Y  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 120 YKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 179

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 180 SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 237

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 238 SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 296

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 297 SPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPNVYYKSPPPPYVY 354

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 355 SSPPPPYYS 363

 Score =  245 bits (626), Expect = 2e-63
 Identities = 138/241 (57%), Positives = 139/241 (57%), Gaps = 47/241 (19%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVY 154
           Y SPPPP   P     Y SPPPP Y YNSPPPPY  PSP      PPPPY Y SPPPP Y
Sbjct: 54  YSSPPPPYYTPSPKVNYKSPPPP-YVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY 112

Query: 155 K------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKKPYKY 289
                  YKSPPPP Y Y SPPP  Y       YKSPPPP Y Y SPPPP   P     Y
Sbjct: 113 SPSPKVYYKSPPPP-YVYSSPPPLYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYY 170

Query: 290 PSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYK 433
            SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP Y 
Sbjct: 171 KSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP-YV 228

Query: 434 YKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVY 580
           Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP Y
Sbjct: 229 YSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYY 287

Query: 581 S 583
           S
Sbjct: 288 S 288

 Score =  245 bits (626), Expect = 2e-63
 Identities = 138/238 (57%), Positives = 140/238 (58%), Gaps = 47/238 (19%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 195 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 254

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 255 SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 312

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 313 SPSPKVYYKSPPPP-YVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPPPPYYSPSPKVHYK 371

Query: 410 SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP P V  YKSPPPP
Sbjct: 372 SPPPP-YVYSSPPPPYYSPSPKVHYKSPPPP-YVYSSPPPPYYSPSPKV-TYKSPPPP 426

 Score =  233 bits (594), Expect = 8e-60
 Identities = 133/227 (58%), Positives = 134/227 (59%), Gaps = 39/227 (17%)
 Frame = +2

Query: 20  PPKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           P  KPY Y SPPPP Y       Y SPPPPY Y SPPPP Y   SP P VY YKSPPPP 
Sbjct: 47  PHPKPYVYSSPPPPYYTPSPKVNYKSPPPPYVYNSPPPPYY---SPSPKVY-YKSPPPP- 101

Query: 182 YKYKSPPPPVYK------YKSPPPPVYKYKSPPP----PPKKPYKYPSPPPPVYKYNSPP 331
           Y Y SPPPP Y       YKSPPPP Y Y SPPP    P  K Y Y SPPPP Y Y+SPP
Sbjct: 102 YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPLYYSPSPKVY-YKSPPPP-YVYSSPP 158

Query: 332 PPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKPYK- 472
           PPY  PSP      PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP   P   
Sbjct: 159 PPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPK 217

Query: 473 --YPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
             Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 218 VYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYS 263

 Score =  216 bits (549), Expect = 1e-54
 Identities = 123/218 (56%), Positives = 126/218 (57%), Gaps = 47/218 (21%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 220 YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 279

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 280 SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 337

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 338 SPSPNVYYKSPPPP-YVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYK 396

Query: 410 SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSP 514
           SPPPP Y Y SPPPP   P     Y SPPPP Y YK+P
Sbjct: 397 SPPPP-YVYSSPPPPYYSPSPKVTYKSPPPP-YVYKTP 432

 Score =  135 bits (341), Expect = 2e-30
 Identities = 83/171 (48%), Positives = 84/171 (49%), Gaps = 47/171 (27%)
 Frame = +2

Query: 212 YKYKSPPPPVYKYKSPPPPPKKPYKYPSP-----------------------PPPVYKYN 322
           Y Y SP  P Y   SP    K P   P P                       PPP Y YN
Sbjct: 23  YPYSSPHTPAYD--SPSYEHKGPKYAPHPKPYVYSSPPPPYYTPSPKVNYKSPPPPYVYN 80

Query: 323 SPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPP----P 454
           SPPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP Y Y SPPP    P
Sbjct: 81  SPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPLYYSP 139

Query: 455 AKKPYKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
           + K Y Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 140 SPKVY-YKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYS 188

[18][TOP]
>UniRef100_Q9LJK0 Genomic DNA, chromosome 3, P1 clone: MZN14 n=1 Tax=Arabidopsis
            thaliana RepID=Q9LJK0_ARATH
          Length = 1018

 Score =  251 bits (640), Expect = 4e-65
 Identities = 141/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 677  YKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVY 736

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 737  SSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYY 794

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 795  SPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYK 853

Query: 410  SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
            SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 854  SPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVY 911

Query: 557  KSPPPPVYS 583
             SPPPP YS
Sbjct: 912  SSPPPPYYS 920

 Score =  251 bits (640), Expect = 4e-65
 Identities = 141/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 702  YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVY 761

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 762  SSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYY 819

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 820  SPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYK 878

Query: 410  SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
            SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 879  SPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVY 936

Query: 557  KSPPPPVYS 583
             SPPPP YS
Sbjct: 937  SSPPPPYYS 945

 Score =  251 bits (640), Expect = 4e-65
 Identities = 141/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 727  YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVY 786

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 787  SSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYY 844

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 845  SPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 903

Query: 410  SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
            SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 904  SPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPAPKVDYKSPPPPYVY 961

Query: 557  KSPPPPVYS 583
             SPPPP YS
Sbjct: 962  SSPPPPYYS 970

 Score =  251 bits (640), Expect = 4e-65
 Identities = 143/264 (54%), Positives = 145/264 (54%), Gaps = 70/264 (26%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 752  YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVY 811

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 812  SSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYY 869

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 870  SPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 928

Query: 410  SPPPPVYKYKSPPPP------------AKKPYKYPSPPPPVYK------YKSPPPPVYSP 535
            SPPPP Y Y SPPPP               PY Y SPPPP Y       YKSPPPP YSP
Sbjct: 929  SPPPP-YVYSSPPPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSP 987

Query: 536  --------PPPVYKYKSPPPPVYS 583
                    PPP Y Y SPPPP YS
Sbjct: 988  SPKVDYKSPPPPYVYSSPPPPSYS 1011

 Score =  250 bits (639), Expect = 5e-65
 Identities = 141/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 260 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVY 319

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 320 SSPPPPYYSPTPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYY 377

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 378 SPSPKIVYKSPPPP-YVYSSPPPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYK 436

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 437 SPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVY 494

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 495 SSPPPPYYS 503

 Score =  250 bits (638), Expect = 7e-65
 Identities = 141/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 210 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVY 269

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 270 SSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYY 327

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 328 SPTPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYK 386

Query: 410 SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 387 SPPPP-YVYSSPPPPYYTPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVY 444

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 445 SSPPPPYYS 453

 Score =  248 bits (632), Expect = 3e-64
 Identities = 143/264 (54%), Positives = 147/264 (55%), Gaps = 70/264 (26%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVY 154
           YKSPPPP   P    +Y SPPPP Y YNSPPPPY  PSP      PPPPY Y SPPPP+Y
Sbjct: 69  YKSPPPPYYSPSPKVEYKSPPPP-YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPIY 127

Query: 155 K------YKSPPPPVYKYKSPPPPVY------KYKSPP--------PPVY-------KYK 253
                  YKSPPPP Y Y SPPPP Y      +YKSPP        PP Y        YK
Sbjct: 128 SPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPSPYVYNSPPPSYYSPSPKVDYK 186

Query: 254 SPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKYPS 382
           SPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y S
Sbjct: 187 SPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSS 246

Query: 383 PPPPVYK------YKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP 535
           PPPP Y       YKSPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP
Sbjct: 247 PPPPYYSPSPKIVYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSP 304

Query: 536 --------PPPVYKYKSPPPPVYS 583
                   PPP Y Y SPPPP YS
Sbjct: 305 SPKVVYKSPPPPYVYSSPPPPYYS 328

 Score =  248 bits (632), Expect = 3e-64
 Identities = 140/249 (56%), Positives = 142/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKS PPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 652  YKSSPPPYVYSSPPPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVY 711

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 712  SSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYY 769

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 770  SPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYK 828

Query: 410  SPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
            SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 829  SPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVY 886

Query: 557  KSPPPPVYS 583
             SPPPP YS
Sbjct: 887  SSPPPPYYS 895

 Score =  243 bits (619), Expect = 1e-62
 Identities = 138/253 (54%), Positives = 140/253 (55%), Gaps = 59/253 (23%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYK------YNSPPPPYKYPSPPPP--------------- 118
           YKSPPPP    Y Y SPPPP+Y       Y SPPPPY Y SPPPP               
Sbjct: 110 YKSPPPP----YVYSSPPPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPS 165

Query: 119 PYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPP 262
           PY Y SPPP  Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPP
Sbjct: 166 PYVYNSPPPSYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPP 223

Query: 263 PP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK---- 403
           PP   P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y     
Sbjct: 224 PPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSPSPK 282

Query: 404 --YKSPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPP 544
             YKSPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP
Sbjct: 283 VDYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPTPKVDYKSPPP 340

Query: 545 VYKYKSPPPPVYS 583
            Y Y SPPPP YS
Sbjct: 341 PYVYSSPPPPYYS 353

 Score =  240 bits (613), Expect = 5e-62
 Identities = 138/250 (55%), Positives = 140/250 (56%), Gaps = 56/250 (22%)
 Frame = +2

Query: 2    YKSPPPP------PKKPYKYPSPP------PPVYKYNSPPPPYKYPSP------PPPPYK 127
            YKSPP P      P  P   PSP       PP Y Y+SPPPPY  PSP      PPPPY 
Sbjct: 626  YKSPPHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSPSPKVHYKSPPPPYV 685

Query: 128  YPSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP- 268
            Y SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP 
Sbjct: 686  YSSPPPPYYSPSPKVHYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPY 743

Query: 269  --PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------Y 406
              P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       Y
Sbjct: 744  YSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVY 802

Query: 407  KSPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYK 553
            KSPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y 
Sbjct: 803  KSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPPYV 860

Query: 554  YKSPPPPVYS 583
            Y SPPPP YS
Sbjct: 861  YSSPPPPYYS 870

 Score =  238 bits (606), Expect = 3e-61
 Identities = 142/290 (48%), Positives = 144/290 (49%), Gaps = 96/290 (33%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 485  YKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVY 544

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 545  SSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYY 602

Query: 269  ----------PKKPYKYPSPP--------------------------------PPVYKYN 322
                      P  PY  PSP                                 PP Y Y+
Sbjct: 603  SPSPKVYYKSPPSPYHAPSPKVLYKSPPHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYS 662

Query: 323  SPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKP 466
            SPPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP   P
Sbjct: 663  SPPPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP-YVYSSPPPPYYSP 721

Query: 467  YK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
                 Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 722  SPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS 770

 Score =  236 bits (601), Expect = 1e-60
 Identities = 135/245 (55%), Positives = 138/245 (56%), Gaps = 51/245 (20%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPV-------YKYNSPPPPYKYPSP------PPPPYKYPSPP 142
           YKSPP P      Y SPPPP+         Y SPPPPY  PSP      PPPPY Y SPP
Sbjct: 43  YKSPPLPDV----YSSPPPPLEYSPAPKVDYKSPPPPYYSPSPKVEYKSPPPPYVYNSPP 98

Query: 143 PPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKK 277
           PP Y       YKSPPPP Y Y SPPPP+Y       YKSPPPP Y Y SPPPP   P  
Sbjct: 99  PPYYSPSPKVDYKSPPPP-YVYSSPPPPIYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSP 156

Query: 278 PYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPP 421
             +Y SPP P Y YNSPPP Y  PSP      PPPPY Y SPPPP Y       YKSPPP
Sbjct: 157 KVEYKSPPSP-YVYNSPPPSYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPP 215

Query: 422 PVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPP 568
           P Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPP
Sbjct: 216 P-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPP 273

Query: 569 PPVYS 583
           PP YS
Sbjct: 274 PPYYS 278

 Score =  236 bits (601), Expect = 1e-60
 Identities = 143/289 (49%), Positives = 145/289 (50%), Gaps = 95/289 (32%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 510  YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVY 569

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK----------------------YKS 226
             SPPPP Y       YKSPPPP Y Y SPPPP Y                       YKS
Sbjct: 570  SSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPSPYHAPSPKVLYKS 628

Query: 227  PP----------PPVYK------YKSPPPP-----PKKPYKYPSP------PPPVYKYNS 325
            PP          PP Y       YKS PPP     P  PY  PSP      PPP Y Y+S
Sbjct: 629  PPHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSPSPKVHYKSPPPPYVYSS 688

Query: 326  PPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKPY 469
            PPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP   P 
Sbjct: 689  PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPS 747

Query: 470  K---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
                Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 748  PKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS 795

 Score =  235 bits (600), Expect = 2e-60
 Identities = 141/288 (48%), Positives = 145/288 (50%), Gaps = 94/288 (32%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 535  YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVY 594

Query: 131  PSPPPPVYK------YKSPPPPVYK------YKSPP------------------------ 202
             SPPPP Y       YKSPP P +       YKSPP                        
Sbjct: 595  SSPPPPYYSPSPKVYYKSPPSPYHAPSPKVLYKSPPHPHVCVCPPPPPCYSPSPKVVYKS 654

Query: 203  -PPVYKYKSPPPPVYK------YKSPPPP-----PKKPYKYPSP------PPPVYKYNSP 328
             PP Y Y SPPPP +       YKSPPPP     P  PY  PSP      PPP Y Y+SP
Sbjct: 655  SPPPYVYSSPPPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSP 714

Query: 329  PPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKPYK 472
            PPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP   P  
Sbjct: 715  PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSP 773

Query: 473  ---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
               Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 774  KVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS 820

 Score =  235 bits (599), Expect = 2e-60
 Identities = 141/290 (48%), Positives = 143/290 (49%), Gaps = 96/290 (33%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 435  YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 494

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 495  SSPPPPYYSPSPKVLYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYY 552

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK-------- 403
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y         
Sbjct: 553  SPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYK 611

Query: 404  --------------YKSPP-------------------------PPVYKYKSPPPPAKKP 466
                          YKSPP                         PP Y Y SPPPP   P
Sbjct: 612  SPPSPYHAPSPKVLYKSPPHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSP 671

Query: 467  ---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
                 Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 672  SPKVHYKSPPPP-YVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYS 720

 Score =  234 bits (598), Expect = 3e-60
 Identities = 138/245 (56%), Positives = 140/245 (57%), Gaps = 55/245 (22%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 777  YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVY 836

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 837  SSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYY 894

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 895  SPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYK 953

Query: 410  SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYK------YKSPPPP-VY-SPPPPVYKY 556
            SPPPP Y Y SPPPP   P     Y SPPPP Y       YKSPPPP VY SPPPP Y  
Sbjct: 954  SPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPSY-- 1010

Query: 557  KSPPP 571
             SP P
Sbjct: 1011 -SPSP 1014

 Score =  233 bits (595), Expect = 6e-60
 Identities = 140/290 (48%), Positives = 142/290 (48%), Gaps = 96/290 (33%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 460  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPPYVY 519

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 520  SSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYY 577

Query: 269  ----------PKKPYKYPSPPPPVYK------YNSPPPPYKYPSPP-------------- 358
                      P  PY Y SPPPP Y       Y SPP PY  PSP               
Sbjct: 578  SPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSPYHAPSPKVLYKSPPHPHVCVC 637

Query: 359  ------------------PPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKP 466
                              PPPY Y SPPPP +       YKSPPPP Y Y SPPPP   P
Sbjct: 638  PPPPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSPSPKVHYKSPPPP-YVYSSPPPPYYSP 696

Query: 467  ---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
                 Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 697  SPKVHYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS 745

 Score =  231 bits (590), Expect = 2e-59
 Identities = 140/289 (48%), Positives = 143/289 (49%), Gaps = 95/289 (32%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PP PY  
Sbjct: 560  YKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSPYHA 619

Query: 131  PSPP--------------------------------PPVYKYKSPPPPVYK------YKS 196
            PSP                                 PP Y Y SPPPP +       YKS
Sbjct: 620  PSPKVLYKSPPHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSPSPKVHYKS 679

Query: 197  PPPPVYKYKSPPPPVYK------YKSPPPP-----PKKPYKYPSP------PPPVYKYNS 325
            PPPP Y Y SPPPP Y       YKSPPPP     P  PY  PSP      PPP Y Y+S
Sbjct: 680  PPPP-YVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSS 738

Query: 326  PPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKPY 469
            PPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP   P 
Sbjct: 739  PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPS 797

Query: 470  K---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
                Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 798  PKVVYKSPPPP-YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYS 845

 Score =  215 bits (547), Expect = 2e-54
 Identities = 126/232 (54%), Positives = 131/232 (56%), Gaps = 40/232 (17%)
 Frame = +2

Query: 8   SPPP--PPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVY------KYK 163
           SPPP   P    +Y SPP P   Y+SPPPP +Y   P P   Y SPPPP Y      +YK
Sbjct: 30  SPPPYSVPLPKVEYKSPPLPDV-YSSPPPPLEYS--PAPKVDYKSPPPPYYSPSPKVEYK 86

Query: 164 SPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYK 316
           SPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP   P     Y SPPPP Y 
Sbjct: 87  SPPPP-YVYNSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPIYSPSPKVDYKSPPPP-YV 143

Query: 317 YNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAK 460
           Y+SPPPPY  PSP      PP PY Y SPPP  Y       YKSPPPP Y Y SPPPP  
Sbjct: 144 YSSPPPPYYSPSPKVEYKSPPSPYVYNSPPPSYYSPSPKVDYKSPPPP-YVYSSPPPPYY 202

Query: 461 KPYK---YPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
            P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 203 SPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 253

 Score =  163 bits (412), Expect = 1e-38
 Identities = 92/171 (53%), Positives = 93/171 (54%), Gaps = 38/171 (22%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 852  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 911

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 912  SSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPAPKVDYKSPPPP-YVYSSPPPPYY 969

Query: 269  -PKKPYKYPSPPPPVYK------YNSPPPPYKYPSPPPPPYKYPSPPPPVY 400
             P     Y SPPPP Y       Y SPPPPY Y SPPPP   Y   P   Y
Sbjct: 970  SPSPKVDYKSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP--SYSPSPKTEY 1018

 Score =  127 bits (320), Expect = 5e-28
 Identities = 76/145 (52%), Positives = 81/145 (55%), Gaps = 11/145 (7%)
 Frame = +2

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
           Y   SPPP      S P P  +YKSPP P      Y SPPPP+ +Y SP P   Y SPPP
Sbjct: 26  YTDSSPPP-----YSVPLPKVEYKSPPLPDV----YSSPPPPL-EY-SPAPKVDYKSPPP 74

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYS 532
           P Y     P P  +YKSPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP+YS
Sbjct: 75  PYYS----PSPKVEYKSPPPP-YVYNSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPIYS 128

Query: 533 P--------PPPVYKYKSPPPPVYS 583
           P        PPP Y Y SPPPP YS
Sbjct: 129 PSPKVDYKSPPPPYVYSSPPPPYYS 153

[19][TOP]
>UniRef100_Q9FH26 Genomic DNA, chromosome 5, TAC clone: K20J1 n=1 Tax=Arabidopsis
            thaliana RepID=Q9FH26_ARATH
          Length = 609

 Score =  251 bits (640), Expect = 4e-65
 Identities = 141/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 295  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 354

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 355  SSPPPPYYSPTPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYY 412

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 413  SPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYK 471

Query: 410  SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
            SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 472  SPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVY 529

Query: 557  KSPPPPVYS 583
             SPPPP YS
Sbjct: 530  SSPPPPYYS 538

 Score =  250 bits (638), Expect = 7e-65
 Identities = 140/249 (56%), Positives = 143/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  P+P      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 345  YKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 404

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 405  SSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYNSPPPPYY 462

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 463  SPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 521

Query: 410  SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
            SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 522  SPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYNSPPPPYYSPSPKVDYKSPPPPYVY 579

Query: 557  KSPPPPVYS 583
             SPPPP YS
Sbjct: 580  SSPPPPYYS 588

 Score =  248 bits (632), Expect = 3e-64
 Identities = 143/272 (52%), Positives = 145/272 (53%), Gaps = 78/272 (28%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 170 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 229

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK---------------YKSPPPPVYK 247
            SPPPP Y       YKSPPPP Y Y SPPPP Y                Y SPPPP Y 
Sbjct: 230 SSPPPPYYSPTPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPLPYVYSSPPPPYYS 288

Query: 248 ------YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------P 358
                 YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      P
Sbjct: 289 PSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 348

Query: 359 PPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKS 511
           PPPY Y SPPPP Y       YKSPPPP Y Y SPPPP   P     Y SPPPP Y Y S
Sbjct: 349 PPPYVYSSPPPPYYSPTPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSS 406

Query: 512 PPPPVYSP--------PPPVYKYKSPPPPVYS 583
           PPPP YSP        PPP Y Y SPPPP YS
Sbjct: 407 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 438

 Score =  248 bits (632), Expect = 3e-64
 Identities = 138/241 (57%), Positives = 140/241 (58%), Gaps = 47/241 (19%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVY 154
           Y SPPPP   P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y
Sbjct: 279 YSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYY 337

Query: 155 K------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKKPYKY 289
                  YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP   P     Y
Sbjct: 338 SPSPKVDYKSPPPP-YVYSSPPPPYYSPTPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDY 395

Query: 290 PSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYK 433
            SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP Y 
Sbjct: 396 KSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP-YV 453

Query: 434 YKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVY 580
           Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP Y
Sbjct: 454 YNSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYY 512

Query: 581 S 583
           S
Sbjct: 513 S 513

 Score =  247 bits (630), Expect = 6e-64
 Identities = 140/249 (56%), Positives = 142/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PP  Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 245 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPLPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 304

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 305 SSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYY 362

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 363 SPTPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 421

Query: 410 SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 422 SPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYNSPPPPYYSPSPKVDYKSPPPPYVY 479

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 480 SSPPPPYYS 488

 Score =  246 bits (629), Expect = 7e-64
 Identities = 142/273 (52%), Positives = 145/273 (53%), Gaps = 79/273 (28%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  P+P      PPPPY Y
Sbjct: 120 YKSPPPPYVYSSPPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVY 179

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 180 SSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYY 237

Query: 269 ----------PKKPYKYPSPPPPVYK---------------YNSPPPPYKYPSP------ 355
                     P  PY Y SPPPP Y                Y+SPPPPY  PSP      
Sbjct: 238 SPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPLPYVYSSPPPPYYSPSPKVDYKS 297

Query: 356 PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYK 508
           PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP   P     Y SPPPP Y Y 
Sbjct: 298 PPPPYVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYS 355

Query: 509 SPPPPVYSP--------PPPVYKYKSPPPPVYS 583
           SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 356 SPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYS 388

 Score =  242 bits (617), Expect = 2e-62
 Identities = 137/238 (57%), Positives = 139/238 (58%), Gaps = 47/238 (19%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 370  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 429

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 430  SSPPPPYYSPSPKVDYKSPPPP-YVYNSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYY 487

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 488  SPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 546

Query: 410  SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP P V  YKS PPP
Sbjct: 547  SPPPP-YVYNSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKV-TYKSLPPP 601

 Score =  231 bits (589), Expect = 3e-59
 Identities = 130/233 (55%), Positives = 134/233 (57%), Gaps = 39/233 (16%)
 Frame = +2

Query: 2   YKSPP-PPPKKPYKYPSPPPPVYK------YNSPPPPYKYPSPPPPPYKYPSPPPPVYKY 160
           +KSP   P  KPY Y SPPPP Y       Y SPPPPY Y SPPPP Y     P P   Y
Sbjct: 40  HKSPKYTPHSKPYIYNSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYT----PSPKVDY 95

Query: 161 KSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVY 313
           KSPPPP Y+Y SPPPP Y       YKSPPPP Y Y SPP P   P     Y SPPPP Y
Sbjct: 96  KSPPPP-YEYSSPPPPYYSPSPKIDYKSPPPP-YVYSSPPLPYYSPSPKVDYKSPPPP-Y 152

Query: 314 KYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPA 457
            Y+SPPPPY  P+P      PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP 
Sbjct: 153 VYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPY 211

Query: 458 KKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
             P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 212 YSPSPKVDYKSPPPP-YVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYS 263

 Score =  212 bits (539), Expect = 2e-53
 Identities = 122/218 (55%), Positives = 125/218 (57%), Gaps = 47/218 (21%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 395  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 454

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 455  NSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYY 512

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 513  SPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYK 571

Query: 410  SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSP 514
            SPPPP Y Y SPPPP   P     Y S PPP Y YK+P
Sbjct: 572  SPPPP-YVYSSPPPPYYSPSPKVTYKSLPPP-YVYKAP 607

 Score =  130 bits (328), Expect = 6e-29
 Identities = 75/147 (51%), Positives = 78/147 (53%), Gaps = 23/147 (15%)
 Frame = +2

Query: 212 YKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYK 373
           Y Y SP  P Y +  P    K P   P   P +Y   SPPPPY  PSP      PPPPY 
Sbjct: 23  YPYSSPQTPQYNF--PSHQHKSPKYTPHSKPYIYN--SPPPPYYSPSPKVNYKSPPPPYV 78

Query: 374 YPSPPPPVY------KYKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPV 526
           Y SPPPP Y       YKSPPPP Y+Y SPPPP   P     Y SPPPP Y Y SPP P 
Sbjct: 79  YSSPPPPYYTPSPKVDYKSPPPP-YEYSSPPPPYYSPSPKIDYKSPPPP-YVYSSPPLPY 136

Query: 527 YSP--------PPPVYKYKSPPPPVYS 583
           YSP        PPP Y Y SPPPP YS
Sbjct: 137 YSPSPKVDYKSPPPPYVYSSPPPPYYS 163

 Score =  114 bits (284), Expect = 7e-24
 Identities = 68/140 (48%), Positives = 69/140 (49%), Gaps = 46/140 (32%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 470 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 529

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPP------------ 238
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP            
Sbjct: 530 SSPPPPYYSPSPKVDYKSPPPP-YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 588

Query: 239 -----VYKYKSPPPPPKKPY 283
                 YK   PP   K PY
Sbjct: 589 PSPKVTYKSLPPPYVYKAPY 608

[20][TOP]
>UniRef100_Q9STM8 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STM8_ARATH
          Length = 513

 Score =  249 bits (635), Expect = 1e-64
 Identities = 140/248 (56%), Positives = 142/248 (57%), Gaps = 54/248 (21%)
 Frame = +2

Query: 2   YKSPPPP----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKYP 133
           YKSPPPP    P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y 
Sbjct: 255 YKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYS 314

Query: 134 SPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP--- 268
           SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP   
Sbjct: 315 SPPPPYYSPTPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYS 372

Query: 269 PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKS 412
           P     Y SPPPP Y YNSPPPPY  PSP      PPPPY Y SPPPP Y       YK+
Sbjct: 373 PSPKVDYKSPPPP-YVYNSPPPPYYSPSPKVDYKSPPPPYIYNSPPPPYYSPSPKVNYKT 431

Query: 413 PPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYK 559
           PPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y 
Sbjct: 432 PPPP-YVYSSPPPPYYSPSPKVNYKSPPPP-YVYSSPPPPYYSPSPNVDYKSPPPPYVYS 489

Query: 560 SPPPPVYS 583
           SPP P YS
Sbjct: 490 SPPTPYYS 497

 Score =  245 bits (626), Expect = 2e-63
 Identities = 140/249 (56%), Positives = 142/249 (57%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y SPPPPY  PSP      PPPPY Y
Sbjct: 230 YKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPY-YRSPPPPYYSPSPKVDYKSPPPPYVY 288

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 289 SSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPTPKVDYKSPPPP-YVYSSPPPPYY 346

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 347 SPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYK 405

Query: 410 SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y Y SPPPP   P     Y +PPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 406 SPPPP-YIYNSPPPPYYSPSPKVNYKTPPPP-YVYSSPPPPYYSPSPKVNYKSPPPPYVY 463

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 464 SSPPPPYYS 472

 Score =  243 bits (619), Expect = 1e-62
 Identities = 138/249 (55%), Positives = 141/249 (56%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSPP------PPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPP      P  PY  PSP       PP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 80  YKSPPPSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVY 139

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 140 SSPPPPYYSPSPKGDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYY 197

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 198 SPTPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYK 256

Query: 410 SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
           SPPPP Y+  SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 257 SPPPPYYR--SPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVY 313

Query: 557 KSPPPPVYS 583
            SPPPP YS
Sbjct: 314 SSPPPPYYS 322

 Score =  240 bits (612), Expect = 7e-62
 Identities = 136/238 (57%), Positives = 138/238 (57%), Gaps = 47/238 (19%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  P+P      PPPPY Y
Sbjct: 279 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVY 338

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 339 SSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYNSPPPPYY 396

Query: 269 -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
            P     Y SPPPP Y YNSPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 397 SPSPKVDYKSPPPP-YIYNSPPPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYK 455

Query: 410 SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPP P YSP   V  YKSPPPP
Sbjct: 456 SPPPP-YVYSSPPPPYYSPSPNVDYKSPPPP-YVYSSPPTPYYSPSSKV-TYKSPPPP 510

 Score =  213 bits (542), Expect = 9e-54
 Identities = 125/237 (52%), Positives = 127/237 (53%), Gaps = 44/237 (18%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSP------PPPVYKYK 163
           Y SP  P    Y  PS    + KY   P P  Y S PPP Y  PSP      PPP Y Y 
Sbjct: 34  YTSPQTPH---YNSPSHEHKIPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPSYVYS 90

Query: 164 SPPPPVYK------YKSPPPPVYKYKSPPPPVY------KYKSPPPP-----PKKPYKYP 292
           SPPPP Y       YKS PPP Y Y SPPPP Y       YKSPPPP     P  PY  P
Sbjct: 91  SPPPPYYSPSPKVDYKSLPPP-YVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSP 149

Query: 293 SP------PPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPP 418
           SP      PPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YKSPP
Sbjct: 150 SPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPP 209

Query: 419 PPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
           PP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP P V  YKSPPPP Y
Sbjct: 210 PP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKV-NYKSPPPPYY 263

 Score =  166 bits (420), Expect = 1e-39
 Identities = 106/216 (49%), Positives = 108/216 (50%), Gaps = 33/216 (15%)
 Frame = +2

Query: 35  YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKY-PSPPPPVYKYKSPPPPVYKYKSPPPPV 211
           Y Y SP  P   YNSP   +K P       KY P P P +Y   SPPP  Y     P P 
Sbjct: 32  YPYTSPQTP--HYNSPSHEHKIP-------KYTPHPKPSIYS-SSPPPSYYS----PSPK 77

Query: 212 YKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP------------ 355
             YKSPPP  Y Y SPPPP      Y SP P V  Y S PPPY Y SP            
Sbjct: 78  VDYKSPPPS-YVYSSPPPP------YYSPSPKV-DYKSLPPPYVYSSPPPPYYSPSPKVN 129

Query: 356 ---PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVY 499
              PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP   P     Y SPPPP Y
Sbjct: 130 YKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-Y 187

Query: 500 KYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
            Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 188 VYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYS 223

[21][TOP]
>UniRef100_Q9ZUC3 F5O8.27 protein n=1 Tax=Arabidopsis thaliana RepID=Q9ZUC3_ARATH
          Length = 895

 Score =  248 bits (634), Expect = 2e-64
 Identities = 143/267 (53%), Positives = 149/267 (55%), Gaps = 76/267 (28%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  P+P      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 631  YKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVY 690

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPPP- 271
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPPP 
Sbjct: 691  SSPPPPYYSPAPKPTYKSPPPP-YVYSSPPPPYYSPSPKPTYKSPPPP-YVYSSPPPPPY 748

Query: 272  ------------KKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPPPYKYPSP---- 385
                          PY Y SPPPP Y      +Y SPPPPY Y SPPPPPY  PSP    
Sbjct: 749  YSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEY 808

Query: 386  --PPPVYKYKSPPPPVY-------KYKSPPPPAKKPYKYPSPPPPVY-------KYKSPP 517
              PPP Y Y SPPPP Y       +YKSPPPP    Y Y SPPPP Y       +YKSPP
Sbjct: 809  KSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPP----YVYNSPPPPAYYSPSPKIEYKSPP 864

Query: 518  PP-VY-SPPPPVY------KYKSPPPP 574
            PP VY SPPPP Y      +YKSPPPP
Sbjct: 865  PPYVYSSPPPPSYSPSPKAEYKSPPPP 891

 Score =  247 bits (631), Expect = 4e-64
 Identities = 138/262 (52%), Positives = 141/262 (53%), Gaps = 71/262 (27%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKS PPP     P  PY  P+P      PPP Y YNSPPPPY  PSP      PPPPY Y
Sbjct: 581  YKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVY 640

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 641  SSPPPPYYSPTPKPTYKSPPPP-YVYSSPPPPYYSPSPKPTYKSPPPP-YVYSSPPPPYY 698

Query: 269  ----------PKKPYKYPSPPPPVYK------YNSPPPPYKYPSPPPPPYKYPSP----- 385
                      P  PY Y SPPPP Y       Y SPPPPY Y SPPPPPY  PSP     
Sbjct: 699  SPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYK 758

Query: 386  -PPPVYKYKSPPPPVY------KYKSPPPP------AKKPYKYPSP------PPPVYKYK 508
             PPP Y Y SPPPP Y      +YKSPPPP         PY  PSP      PPP Y Y 
Sbjct: 759  SPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYS 818

Query: 509  SPPPPVYSPPPPVYKYKSPPPP 574
            SPPPP Y  P P  +YKSPPPP
Sbjct: 819  SPPPPTYYSPSPKVEYKSPPPP 840

 Score =  245 bits (625), Expect = 2e-63
 Identities = 142/272 (52%), Positives = 144/272 (52%), Gaps = 78/272 (28%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 54  YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 113

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPPPP  
Sbjct: 114 SSPPPPYYSPSPKPTYKSPPPP-YVYNSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPYY 171

Query: 269 ----------PKKPYKYPSPPPPVYK------YNSPPPPYKYPSPPPPPYK------YPS 382
                     P  PY Y SPPPP Y       Y SPPPPY Y SPPPP Y       Y S
Sbjct: 172 SPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKS 231

Query: 383 PPPPVYKYKSPPPPVYK------YKSPPPP-----AKKPYKYPSP------PPPVYKYKS 511
           PPPP Y Y SPPPP Y       YKSPPPP        PY  PSP      PPP Y Y S
Sbjct: 232 PPPP-YVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNS 290

Query: 512 PPPPVYSP--------PPPVYKYKSPPPPVYS 583
           PPPP YSP        PPP Y Y  PPPP YS
Sbjct: 291 PPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYS 322

 Score =  244 bits (624), Expect = 3e-63
 Identities = 140/250 (56%), Positives = 142/250 (56%), Gaps = 56/250 (22%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 229 YKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVY 288

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y  PPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 289 NSPPPPYYSPSPKPAYKSPPPP-YVYSFPPPPYYSPSPKPVYKSPPPP-YVYNSPPPPYY 346

Query: 269 ---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------ 403
              PK  YK  SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       
Sbjct: 347 SPSPKPAYK--SPPPP-YVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPV 403

Query: 404 YKSPPPPVYKYKSPPPPAKKPYKYPS--PPPPVYKYKSPPPPVYSP--------PPPVYK 553
           YKSPPPP Y Y SPPPP   P   PS   PPP Y Y SPPPP YSP         PP Y 
Sbjct: 404 YKSPPPP-YIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYV 462

Query: 554 YKSPPPPVYS 583
           Y SPPPP YS
Sbjct: 463 YSSPPPPYYS 472

 Score =  244 bits (623), Expect = 4e-63
 Identities = 139/243 (57%), Positives = 141/243 (58%), Gaps = 49/243 (20%)
 Frame = +2

Query: 2   YKSPPPP----PKKPYKYPSPPPPVYKYNSPPPPYKY-PSP------PPPPYKYPSPPPP 148
           Y SPPPP    P     Y SPPPP Y Y+SPPPP  Y PSP      PPPPY Y SPPPP
Sbjct: 11  YSSPPPPLYDSPTPKVDYKSPPPP-YVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPPPP 69

Query: 149 VY------KYKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKKPY 283
            Y      +YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP   P    
Sbjct: 70  YYSPSPKVEYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKP 127

Query: 284 KYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPV 427
            Y SPPPP Y YNSPPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP 
Sbjct: 128 TYKSPPPP-YVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP- 185

Query: 428 YKYKSPPPPAKKPY---KYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPP 574
           Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP
Sbjct: 186 YVYNSPPPPYYSPSPKPTYKSPPPP-YIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPP 244

Query: 575 VYS 583
            YS
Sbjct: 245 YYS 247

 Score =  244 bits (623), Expect = 4e-63
 Identities = 139/254 (54%), Positives = 143/254 (56%), Gaps = 60/254 (23%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPV----------------YKYNSPPPPYKYPSP------PP 115
           YKSPPPP    Y Y SPPPP+                Y Y+SPPPPY  PSP      PP
Sbjct: 28  YKSPPPP----YVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPP 83

Query: 116 PPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSP 259
           PPY Y SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SP
Sbjct: 84  PPYVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKPTYKSPPPP-YVYNSP 141

Query: 260 PPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK--- 403
           PPP   P    +Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y    
Sbjct: 142 PPPYYSPSPKVEYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSP 200

Query: 404 ---YKSPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYSP--------PP 541
              YKSPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PP
Sbjct: 201 KPTYKSPPPP-YIYSSPPPPYYSPSPKPVYKSPPPP-YVYSSPPPPYYSPSPKPAYKSPP 258

Query: 542 PVYKYKSPPPPVYS 583
           P Y Y SPPPP YS
Sbjct: 259 PPYVYSSPPPPYYS 272

 Score =  244 bits (623), Expect = 4e-63
 Identities = 142/272 (52%), Positives = 143/272 (52%), Gaps = 78/272 (28%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 179 YKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVY 238

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
            SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 239 SSPPPPYYSPSPKPAYKSPPPP-YVYSSPPPPYYSPSPKPIYKSPPPP-YVYNSPPPPYY 296

Query: 269 ----------PKKPYKYPSPPPPVYK------YNSPPPPYKYPSPPPPPYK------YPS 382
                     P  PY Y  PPPP Y       Y SPPPPY Y SPPPP Y       Y S
Sbjct: 297 SPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKS 356

Query: 383 PPPPVYKYKSPPPPVYK------YKSPPPP-----AKKPYKYPSP------PPPVYKYKS 511
           PPPP Y Y SPPPP Y       YKSPPPP        PY  PSP      PPP Y Y S
Sbjct: 357 PPPP-YVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPPYIYNS 415

Query: 512 PPPPVYSP--------PPPVYKYKSPPPPVYS 583
           PPPP YSP        PPP Y Y SPPPP YS
Sbjct: 416 PPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYS 447

 Score =  240 bits (613), Expect = 5e-62
 Identities = 138/248 (55%), Positives = 142/248 (57%), Gaps = 55/248 (22%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPP------PVYKYNSPPPPYKYPSP------PPPPYKYPSPPP 145
            Y SPPPPP   Y  PSP P      P Y Y+SPPPPY  P+P      PPPPY Y SPPP
Sbjct: 564  YHSPPPPP---YYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPP 620

Query: 146  PVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-----PK 274
            P Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP     PK
Sbjct: 621  PYYSPSPKPTYKSPPPP-YVYSSPPPPYYSPTPKPTYKSPPPP-YVYSSPPPPYYSPSPK 678

Query: 275  KPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPP 418
              YK  SPPPP Y Y+SPPPPY  P+P      PPPPY Y SPPPP Y       YKSPP
Sbjct: 679  PTYK--SPPPP-YVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPP 735

Query: 419  PPVYKYKSPPPPAKKPYKYPSP------PPPVYKYKSPPPPVYSP--------PPPVYKY 556
            PP Y Y SPPPP   PY  PSP      PPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 736  PP-YVYSSPPPP---PYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVY 791

Query: 557  KSPPPPVY 580
             SPPPP Y
Sbjct: 792  SSPPPPPY 799

 Score =  239 bits (609), Expect = 2e-61
 Identities = 141/273 (51%), Positives = 143/273 (52%), Gaps = 79/273 (28%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSPP------PPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP       PPPY Y
Sbjct: 404  YKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYVY 463

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 464  SSPPPPYYSPSPKVVYKSPPPP-YVYSSPPPPYYSPSPKPSYKSPPPP-YVYNSPPPPYY 521

Query: 269  ---PKKPYKYPS--------PPPPVY------KYNSPPPPYKYPSPPPPPYKYPSPPP-- 391
               PK  YK P         PPPP Y      +Y SPP PY Y SPPPPPY  PSP P  
Sbjct: 522  SPSPKVIYKSPPHPHVCVCPPPPPCYSHSPKIEYKSPPTPYVYHSPPPPPYYSPSPKPAY 581

Query: 392  ----PVYKYKSPPPPVYK------YKSPPPP-----AKKPYKYPSP------PPPVYKYK 508
                P Y Y SPPPP Y       YKSPPPP        PY  PSP      PPP Y Y 
Sbjct: 582  KSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYS 641

Query: 509  SPPPPVYSP--------PPPVYKYKSPPPPVYS 583
            SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 642  SPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYS 674

 Score =  235 bits (599), Expect = 2e-60
 Identities = 136/265 (51%), Positives = 139/265 (52%), Gaps = 71/265 (26%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPS--------PPPPVY------KYNSPPPPYKYPSPPPPPY 124
            Y SPPPP     PK  YK P         PPPP Y      +Y SPP PY Y SPPPPPY
Sbjct: 513  YNSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPPCYSHSPKIEYKSPPTPYVYHSPPPPPY 572

Query: 125  KYPSPPP------PVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------Y 250
              PSP P      P Y Y SPPPP Y       YKSPPPP Y Y SPPPP Y       Y
Sbjct: 573  YSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPP-YVYNSPPPPYYSPSPKPTY 631

Query: 251  KSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKYP 379
            KSPPPP     P  PY  P+P      PPP Y Y+SPPPPY  PSP      PPPPY Y 
Sbjct: 632  KSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYS 691

Query: 380  SPPPPVYK------YKSPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKYKSPPPPVYS 532
            SPPPP Y       YKSPPPP Y Y SPPPP   P     Y SPPPP      PPPP YS
Sbjct: 692  SPPPPYYSPAPKPTYKSPPPP-YVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYS 750

Query: 533  P--------PPPVYKYKSPPPPVYS 583
            P        PPP Y Y SPPPP YS
Sbjct: 751  PSPKVEYKSPPPPYVYSSPPPPYYS 775

 Score =  234 bits (598), Expect = 3e-60
 Identities = 141/274 (51%), Positives = 144/274 (52%), Gaps = 80/274 (29%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKS PPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 454  YKSSPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVY 513

Query: 131  PSPPPPVYK------YKSPP----------PPVY------KYKSPPPPVYKYKSPPPPVY 244
             SPPPP Y       YKSPP          PP Y      +YKSPP P Y Y SPPPP Y
Sbjct: 514  NSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPPCYSHSPKIEYKSPPTP-YVYHSPPPPPY 572

Query: 245  -------KYKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP----- 355
                    YKS PPP     P  PY  P+P      PPP Y YNSPPPPY  PSP     
Sbjct: 573  YSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYK 632

Query: 356  -PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYKY 505
             PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP   P     Y SPPPP Y Y
Sbjct: 633  SPPPPYVYSSPPPPYYSPTPKPTYKSPPPP-YVYSSPPPPYYSPSPKPTYKSPPPP-YVY 690

Query: 506  KSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
             SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 691  SSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYS 724

 Score =  231 bits (590), Expect = 2e-59
 Identities = 142/278 (51%), Positives = 144/278 (51%), Gaps = 85/278 (30%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------------- 109
            YKSPPPP     P  PY  PSP      PPP Y YNSPPPPY  PSP             
Sbjct: 479  YKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSPKVIYKSPPHPHVC 538

Query: 110  -------------------PPPPYKYPSPPPPVY-------KYKSPPPPVYKYKSPPPPV 211
                               PP PY Y SPPPP Y        YKS PPP Y Y SPPPP 
Sbjct: 539  VCPPPPPCYSHSPKIEYKSPPTPYVYHSPPPPPYYSPSPKPAYKSSPPP-YVYSSPPPPY 597

Query: 212  YK------YKSPPPPVYKYKSPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYPSP- 355
            Y       YKSPPPP Y Y SPPPP     PK  YK  SPPPP Y Y+SPPPPY  P+P 
Sbjct: 598  YSPAPKPVYKSPPPP-YVYNSPPPPYYSPSPKPTYK--SPPPP-YVYSSPPPPYYSPTPK 653

Query: 356  -----PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPP----AKKPYKYPSPPP 490
                 PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP    A KP  Y SPPP
Sbjct: 654  PTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP-YVYSSPPPPYYSPAPKP-TYKSPPP 711

Query: 491  PVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVY 580
            P Y Y SPPPP YSP        PPP Y Y SPPPP Y
Sbjct: 712  P-YVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPY 748

 Score =  212 bits (539), Expect = 2e-53
 Identities = 118/208 (56%), Positives = 124/208 (59%), Gaps = 23/208 (11%)
 Frame = +2

Query: 29  KPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 208
           +PY Y SPPPP+Y  +SP P   Y SPPPP Y Y SPPPP+      P P   YKSPPPP
Sbjct: 7   EPYTYSSPPPPLY--DSPTPKVDYKSPPPP-YVYSSPPPPL---SYSPSPKVDYKSPPPP 60

Query: 209 VYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPY 370
            Y Y SPPPP Y      P PK  YK  SPPPP Y Y+SPPPPY  PSP      PPPPY
Sbjct: 61  -YVYSSPPPPYYS-----PSPKVEYK--SPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPY 111

Query: 371 KYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPP 523
            Y SPPPP Y       YKSPPPP Y Y SPPPP   P    +Y SPPPP Y Y SPPPP
Sbjct: 112 VYSSPPPPYYSPSPKPTYKSPPPP-YVYNSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPP 169

Query: 524 VYSP--------PPPVYKYKSPPPPVYS 583
            YSP        PPP Y Y SPPPP YS
Sbjct: 170 YYSPSPKVDYKSPPPPYVYNSPPPPYYS 197

[22][TOP]
>UniRef100_Q9M1H0 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9M1H0_ARATH
          Length = 951

 Score =  248 bits (634), Expect = 2e-64
 Identities = 139/252 (55%), Positives = 145/252 (57%), Gaps = 58/252 (23%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPPPY------KYPSPPP 145
           YKSPPPP    Y Y SPPPP Y      +Y SPPPPY Y SPPPP Y      +Y SPPP
Sbjct: 93  YKSPPPP----YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPP 148

Query: 146 PVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPPVY------KYKSPPPP-----PK 274
           P Y Y SPPPP Y      +YKSPPPP Y Y SPPPP Y      +YKSPPPP     P 
Sbjct: 149 P-YVYSSPPPPTYSPSPKVEYKSPPPP-YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 206

Query: 275 KPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVY------ 400
            PY  PSP      PPP Y Y+SPPPP   PSP      PPPPY Y SPPPP Y      
Sbjct: 207 PPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKV 266

Query: 401 KYKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPV 547
           +YKSPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP 
Sbjct: 267 EYKSPPPP-YVYSSPPPPTYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP 324

Query: 548 YKYKSPPPPVYS 583
           Y Y SPPPP YS
Sbjct: 325 YVYSSPPPPTYS 336

 Score =  248 bits (634), Expect = 2e-64
 Identities = 139/252 (55%), Positives = 145/252 (57%), Gaps = 58/252 (23%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPPPY------KYPSPPP 145
           YKSPPPP    Y Y SPPPP Y      +Y SPPPPY Y SPPPP Y      +Y SPPP
Sbjct: 168 YKSPPPP----YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPP 223

Query: 146 PVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPPVY------KYKSPPPP-----PK 274
           P Y Y SPPPP Y       YKSPPPP Y Y SPPPP Y      +YKSPPPP     P 
Sbjct: 224 P-YVYSSPPPPTYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 281

Query: 275 KPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVY------ 400
            P   PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y      
Sbjct: 282 PPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKV 341

Query: 401 KYKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPV 547
           +YKSPPPP Y Y SPPPP   P    +Y SPPPP Y Y SPPPP YSP        PPP 
Sbjct: 342 EYKSPPPP-YVYSSPPPPTYSPSPKVEYKSPPPP-YVYSSPPPPTYSPSPKVEYKSPPPP 399

Query: 548 YKYKSPPPPVYS 583
           Y Y SPPPP YS
Sbjct: 400 YVYSSPPPPTYS 411

 Score =  248 bits (634), Expect = 2e-64
 Identities = 142/264 (53%), Positives = 146/264 (55%), Gaps = 70/264 (26%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPP   PSP      PPPPY Y
Sbjct: 293  YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVY 352

Query: 131  PSPPPPVY------KYKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPP-- 268
             SPPPP Y      +YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPPPP  
Sbjct: 353  SSPPPPTYSPSPKVEYKSPPPP-YVYSSPPPPTYSPSPKVEYKSPPPP-YVYSSPPPPTY 410

Query: 269  ----------PKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPPPYK------YPS 382
                      P  PY Y SPPPP Y      +Y SPPPPY Y SPPPP Y       Y S
Sbjct: 411  SPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKS 470

Query: 383  PPPPVYKYKSPPPPVYK------YKSPPPP-----AKKPYKYPSP------PPPVYKYKS 511
            PPPP Y Y SPPPP Y       YKSPPPP        PY  PSP      PPP Y Y S
Sbjct: 471  PPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSS 529

Query: 512  PPPPVYSPPPPVYKYKSPPPPVYS 583
            PPPP YSP P VY YKSPPPP YS
Sbjct: 530  PPPPYYSPSPKVY-YKSPPPPYYS 552

 Score =  248 bits (633), Expect = 2e-64
 Identities = 139/253 (54%), Positives = 143/253 (56%), Gaps = 59/253 (23%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPP--------------- 118
           YKSPPPP    Y Y SPPPP Y      +Y SPPPPY Y SPPPP               
Sbjct: 118 YKSPPPP----YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPP 173

Query: 119 PYKYPSPPPPVY------KYKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPP 262
           PY Y SPPPP Y      +YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPP
Sbjct: 174 PYVYSSPPPPTYSPSPKVEYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPP-YVYSSPP 231

Query: 263 PP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK---- 403
           PP   P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y     
Sbjct: 232 PPTYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPK 290

Query: 404 --YKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPP 544
             YKSPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP
Sbjct: 291 VDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPTYSPSPKVEYKSPPP 348

Query: 545 VYKYKSPPPPVYS 583
            Y Y SPPPP YS
Sbjct: 349 PYVYSSPPPPTYS 361

 Score =  246 bits (629), Expect = 7e-64
 Identities = 139/244 (56%), Positives = 141/244 (57%), Gaps = 50/244 (20%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPPPVYK------YNSPPPPYKYPSPPPPPYK------YPSPPP 145
            YKSPPPP    Y Y SPPPP Y       Y SPPPPY Y SPPPP Y       Y SPPP
Sbjct: 710  YKSPPPP----YVYSSPPPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPP 765

Query: 146  PVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKKP 280
            P Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP   P   
Sbjct: 766  PYYAPTPKVHYKSPPPP-YVYSSPPPPYYSPSPKVHYKSPPPP-YVYSSPPPPYYSPSPK 823

Query: 281  YKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPP 424
             +Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP
Sbjct: 824  VEYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 882

Query: 425  VYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPP 571
             Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y YKSPPP
Sbjct: 883  -YVYSSPPPPYYSPSPVVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPPYVYKSPPP 940

Query: 572  PVYS 583
            P YS
Sbjct: 941  PSYS 944

 Score =  242 bits (617), Expect = 2e-62
 Identities = 144/289 (49%), Positives = 146/289 (50%), Gaps = 95/289 (32%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------------- 109
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP             
Sbjct: 634  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVC 693

Query: 110  -------------------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPVY 214
                               PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP Y
Sbjct: 694  VCPPPPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPSPKVYYKSPPPP-YVYSSPPPPYY 752

Query: 215  K------YKSPPPPVYK------YKSPPPP-----PKKPYKYPSP------PPPVYKYNS 325
                   YKSPPPP Y       YKSPPPP     P  PY  PSP      PPP Y Y+S
Sbjct: 753  SPSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSS 812

Query: 326  PPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKP- 466
            PPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP   P 
Sbjct: 813  PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPS 871

Query: 467  --YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
                Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 872  PKVDYKSPPPP-YVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPPPPYYS 919

 Score =  241 bits (616), Expect = 2e-62
 Identities = 145/288 (50%), Positives = 146/288 (50%), Gaps = 94/288 (32%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 559  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSPKVQYKSPPPPYVY 618

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 619  SSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYY 676

Query: 269  ---PKKPYKYPS--------PPPPVYK------YNSPPPPYKYPSPPPP----------- 364
               PK  YK P         PPPP Y       Y SPPPPY Y SPPPP           
Sbjct: 677  SPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPSPKVYYK 736

Query: 365  ----PYKYPSPPPPVYK------YKSPPPPVYK------YKSPPPP-----AKKPYKYPS 481
                PY Y SPPPP Y       YKSPPPP Y       YKSPPPP        PY  PS
Sbjct: 737  SPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPS 796

Query: 482  P------PPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
            P      PPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 797  PKVHYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYS 844

 Score =  241 bits (615), Expect = 3e-62
 Identities = 132/232 (56%), Positives = 138/232 (59%), Gaps = 38/232 (16%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYK 163
           YKSPPPP    Y Y SPPPP Y      +Y SPPPPY Y SPPPP Y     P P  +YK
Sbjct: 68  YKSPPPP----YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYS----PSPKVEYK 119

Query: 164 SPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYK 316
           SPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPPPP   P    +Y SPPPP Y 
Sbjct: 120 SPPPP-YVYSSPPPPTYSPSPKVEYKSPPPP-YVYSSPPPPTYSPSPKVEYKSPPPP-YV 176

Query: 317 YNSPPPPYKYPSP------PPPPYKYPSPPPPVY------KYKSPPPPVYKYKSPPPPAK 460
           Y+SPPPP   PSP      PPPPY Y SPPPP Y      +YKSPPPP Y Y SPPPP  
Sbjct: 177 YSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPTY 235

Query: 461 KP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
            P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 236 SPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYS 286

 Score =  241 bits (615), Expect = 3e-62
 Identities = 138/264 (52%), Positives = 141/264 (53%), Gaps = 70/264 (26%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 609  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVY 668

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPP P      PPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 669  SSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP-YVYSSPPPPHY 727

Query: 269  ----------PKKPYKYPSPPPPVYK------YNSPPPPYKYPSP------PPPPYKYPS 382
                      P  PY Y SPPPP Y       Y SPPPPY  P+P      PPPPY Y S
Sbjct: 728  SPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSS 787

Query: 383  PPPPVYK------YKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP 535
            PPPP Y       YKSPPPP Y Y SPPPP   P    +Y SPPPP Y Y SPPPP YSP
Sbjct: 788  PPPPYYSPSPKVHYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPYYSP 845

Query: 536  --------PPPVYKYKSPPPPVYS 583
                    PPP Y Y SPPPP YS
Sbjct: 846  SPKVDYKSPPPPYVYSSPPPPYYS 869

 Score =  241 bits (614), Expect = 4e-62
 Identities = 142/260 (54%), Positives = 146/260 (56%), Gaps = 66/260 (25%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPP--------------- 118
            YKSPPPP    Y Y SPPPP Y      +Y SPPPPY Y SPPPP               
Sbjct: 343  YKSPPPP----YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPP 398

Query: 119  PYKYPSPPPPVY------KYKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPP 262
            PY Y SPPPP Y      +YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPP
Sbjct: 399  PYVYSSPPPPTYSPSPKVEYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPP-YVYSSPP 456

Query: 263  PP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK---- 403
            PP   P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y     
Sbjct: 457  PPTYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPK 515

Query: 404  --YKSPPPPVYKYKSPPPPAKKPYK---YPSPPPPVYK------YKSPPPP-VYSPPPPV 547
              YKSPPPP Y Y SPPPP   P     Y SPPPP Y       YKSPPPP VYS PPP 
Sbjct: 516  VYYKSPPPP-YVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 574

Query: 548  Y-------KYKSPPPP-VYS 583
            Y        YKSPPPP VYS
Sbjct: 575  YYSPSPKVYYKSPPPPYVYS 594

 Score =  240 bits (612), Expect = 7e-62
 Identities = 137/262 (52%), Positives = 143/262 (54%), Gaps = 70/262 (26%)
 Frame = +2

Query: 8   SPPPP--PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVY--- 154
           SPPP   P    +Y SPPPP Y Y+SPPPP   PSP      PPPPY Y SPPPP Y   
Sbjct: 55  SPPPTYSPAPEVEYKSPPPP-YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPS 113

Query: 155 ---KYKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPP------------P 271
              +YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPPPP            P
Sbjct: 114 PKVEYKSPPPP-YVYSSPPPPTYSPSPKVEYKSPPPP-YVYSSPPPPTYSPSPKVEYKSP 171

Query: 272 KKPYKYPSPPPPVY------KYNSPPPPYKYPSP---------------PPPPYKYPSPP 388
             PY Y SPPPP Y      +Y SPPPPY Y SP               PPPPY Y SPP
Sbjct: 172 PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 231

Query: 389 PPVYK------YKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP-- 535
           PP Y       YKSPPPP Y Y SPPPP   P    +Y SPPPP Y Y SPPPP YSP  
Sbjct: 232 PPTYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPTYSPSP 289

Query: 536 ------PPPVYKYKSPPPPVYS 583
                 PPP Y Y SPPPP YS
Sbjct: 290 KVDYKSPPPPYVYSSPPPPYYS 311

 Score =  236 bits (602), Expect = 1e-60
 Identities = 140/281 (49%), Positives = 146/281 (51%), Gaps = 87/281 (30%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY  
Sbjct: 493  YKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYS 552

Query: 131  PSP------PPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPPVY------KYKS 256
            PSP      PPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP +      +YKS
Sbjct: 553  PSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPYHSPSPKVQYKS 611

Query: 257  PPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKYPSP 385
            PPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y SP
Sbjct: 612  PPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSP 671

Query: 386  PPPVYK--------------------------------YKSPPPPVYKYKSPPPPAKKPY 469
            PPP Y                                 YKSPPPP Y Y SPPPP   P 
Sbjct: 672  PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPP-YVYSSPPPPHYSPS 730

Query: 470  K---YPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
                Y SPPPP Y Y SPPPP YSP P V+ YKSPPPP Y+
Sbjct: 731  PKVYYKSPPPP-YVYSSPPPPYYSPSPKVH-YKSPPPPYYA 769

 Score =  231 bits (589), Expect = 3e-59
 Identities = 128/222 (57%), Positives = 132/222 (59%), Gaps = 42/222 (18%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPPPVYK------YNSPPPPYKYPSP------PPPPYKYPSPPP 145
            YKSPPPP    Y Y SPPPP Y       Y SPPPPY  P+P      PPPPY Y SPPP
Sbjct: 735  YKSPPPP----YVYSSPPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSPPP 790

Query: 146  PVYK------YKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPP---PKKP 280
            P Y       YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPPPP   P   
Sbjct: 791  PYYSPSPKVHYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPYYSPSPK 848

Query: 281  YKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPP 424
              Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP
Sbjct: 849  VDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPVVDYKSPPPP 907

Query: 425  VYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSPPP 541
             Y Y SPPPP   P    +Y SPPPP Y YKSPPPP YSP P
Sbjct: 908  -YVYSSPPPPYYSPSPKVEYKSPPPP-YVYKSPPPPSYSPSP 947

 Score =  222 bits (565), Expect = 2e-56
 Identities = 127/242 (52%), Positives = 135/242 (55%), Gaps = 58/242 (23%)
 Frame = +2

Query: 32  PYKYPSPPP------PVYKYNSPPPPYKYPSP--------------PPPPYKYPSPPPPV 151
           PY   SPPP      P  +Y +PP PY   SP              PPPPY Y SPPPP 
Sbjct: 25  PYTDSSPPPLYSSPLPKIEYKTPPLPYIDSSPPPTYSPAPEVEYKSPPPPYVYSSPPPPT 84

Query: 152 Y------KYKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPP---PKKPYK 286
           Y      +YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPPPP   P    +
Sbjct: 85  YSPSPKVEYKSPPPP-YVYSSPPPPTYSPSPKVEYKSPPPP-YVYSSPPPPTYSPSPKVE 142

Query: 287 YPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVY------KYKSPPPPVY 430
           Y SPPPP Y Y+SPPPP   PSP      PPPPY Y SPPPP Y      +YKSPPPP Y
Sbjct: 143 YKSPPPP-YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP-Y 200

Query: 431 KYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPV 577
            Y SPPPP   P    +Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP 
Sbjct: 201 VYSSPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPY 259

Query: 578 YS 583
           YS
Sbjct: 260 YS 261

[23][TOP]
>UniRef100_Q9STM7 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STM7_ARATH
          Length = 707

 Score =  247 bits (631), Expect = 4e-64
 Identities = 138/241 (57%), Positives = 140/241 (58%), Gaps = 47/241 (19%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVY 154
           Y SPPPP   P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y
Sbjct: 132 YSSPPPPYYSPSPKVNYKSPPPP-YVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYY 190

Query: 155 K------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKKPYKY 289
                  YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP   P     Y
Sbjct: 191 SPSPKVDYKSPPPP-YVYSSPPPPYYSPTPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDY 248

Query: 290 PSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYK 433
            SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YKSPPPP Y 
Sbjct: 249 KSPPPP-YVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPP-YV 306

Query: 434 YKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVY 580
           Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP Y
Sbjct: 307 YSSPPPPYYSPSPKVNYKSPPPP-YVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYY 365

Query: 581 S 583
           S
Sbjct: 366 S 366

 Score =  245 bits (625), Expect = 2e-63
 Identities = 139/249 (55%), Positives = 141/249 (56%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP        PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 423  YKSPPPPYIYSSTPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKPPPPPYVY 482

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y  PPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 483  SSPPPPYYSPSPKVDYKSPPPP-YVYSFPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYY 540

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 541  SPSPKVNYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYK 599

Query: 410  SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
            SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y
Sbjct: 600  SPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVNYKSPPPPYVY 657

Query: 557  KSPPPPVYS 583
             SPPPP YS
Sbjct: 658  SSPPPPYYS 666

 Score =  243 bits (621), Expect = 6e-63
 Identities = 138/249 (55%), Positives = 141/249 (56%), Gaps = 55/249 (22%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 448  YKSPPPPYVYSSPPPPYYSPSPKVDYKPPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVY 507

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-- 268
              PPPP Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP  
Sbjct: 508  SFPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVNYKSPPPP-YVYSSPPPPYY 565

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P    +Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 566  SPSPKVEYKSPPPP-YIYSSPPPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYK 624

Query: 410  SPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKY 556
            SPPPP Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP         PP Y Y
Sbjct: 625  SPPPP-YVYSSPPPPYYSPSPKVNYKSPPPP-YVYSSPPPPYYSPSPKVDYKSSPPQYVY 682

Query: 557  KSPPPPVYS 583
             SPP P YS
Sbjct: 683  SSPPTPYYS 691

 Score =  241 bits (615), Expect = 3e-62
 Identities = 143/272 (52%), Positives = 144/272 (52%), Gaps = 78/272 (28%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y SPPPPY  PSP      PPPPY Y
Sbjct: 298  YKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVY 357

Query: 131  PSPPPPVYK------YKSPPPP-VYK--------------YKSPPPPVYKYKSPPPPVYK 247
             SPPPP Y       YKSPPPP VY               YKSPPPP Y Y SPPPP Y 
Sbjct: 358  SSPPPPYYSPSPKVDYKSPPPPYVYSSTPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYS 416

Query: 248  ------YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------P 358
                  YKSPPPP        PY  PSP      PPP Y Y+SPPPPY  PSP      P
Sbjct: 417  PSPKVDYKSPPPPYIYSSTPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKPP 476

Query: 359  PPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKS 511
            PPPY Y SPPPP Y       YKSPPPP Y Y  PPPP   P     Y SPPPP Y Y S
Sbjct: 477  PPPYVYSSPPPPYYSPSPKVDYKSPPPP-YVYSFPPPPYYSPSPKVDYKSPPPP-YVYSS 534

Query: 512  PPPPVYSP--------PPPVYKYKSPPPPVYS 583
            PPPP YSP        PPP Y Y SPPPP YS
Sbjct: 535  PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYS 566

 Score =  239 bits (611), Expect = 9e-62
 Identities = 142/272 (52%), Positives = 145/272 (53%), Gaps = 78/272 (28%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP        PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 373  YKSPPPPYVYSSTPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYIY 432

Query: 131  ---------PSP------PPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPPVYK 247
                     PSP      PPP Y Y SPPPP Y       YK PPPP Y Y SPPPP Y 
Sbjct: 433  SSTPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKPPPPP-YVYSSPPPPYYS 491

Query: 248  ------YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------P 358
                  YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      P
Sbjct: 492  PSPKVDYKSPPPPYVYSFPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSP 551

Query: 359  PPPYKYPSPPPPVY------KYKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKS 511
            PPPY Y SPPPP Y      +YKSPPPP Y Y SPPPP   P     Y SPPPP Y Y S
Sbjct: 552  PPPYVYSSPPPPYYSPSPKVEYKSPPPP-YIYSSPPPPYYAPSPKVDYKSPPPP-YVYSS 609

Query: 512  PPPPVYSP--------PPPVYKYKSPPPPVYS 583
            PPPP YSP        PPP Y Y SPPPP YS
Sbjct: 610  PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 641

 Score =  237 bits (605), Expect = 4e-61
 Identities = 135/244 (55%), Positives = 138/244 (56%), Gaps = 50/244 (20%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSP------PPPVYKYNSPPPPYKYPSPP------PPPYKYPSPPP 145
           Y S PPP    Y  PSP      PPP Y Y+SPPPPY  PSP       PPPY Y SPPP
Sbjct: 81  YSSSPPPS---YYSPSPKVDYKSPPPSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPPP 137

Query: 146 PVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP---PKKP 280
           P Y       YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP   P   
Sbjct: 138 PYYSPSPKVNYKSPPPP-YVYSSPPPPYYSPSPKGDYKSPPPP-YVYSSPPPPYYSPSPK 195

Query: 281 YKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPPP 424
             Y SPPPP Y Y+SPPPPY  P+P      PPPPY Y SPPPP Y       YKSPPPP
Sbjct: 196 VDYKSPPPP-YVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 254

Query: 425 VYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPP 571
            Y Y SPPPP   P     Y SPPPP Y Y SPPPP YSP        PPP Y Y SPPP
Sbjct: 255 -YVYSSPPPPYYSPSPKVNYKSPPPP-YVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPP 312

Query: 572 PVYS 583
           P YS
Sbjct: 313 PYYS 316

 Score =  233 bits (595), Expect = 6e-60
 Identities = 134/241 (55%), Positives = 137/241 (56%), Gaps = 50/241 (20%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YK PPPP     P  PY  PSP      PPP Y Y+ PPPPY  PSP      PPPPY Y
Sbjct: 473  YKPPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSPSPKVDYKSPPPPYVY 532

Query: 131  PSPPPPVYK------YKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPP-- 268
             SPPPP Y       YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPPPP  
Sbjct: 533  SSPPPPYYSPSPKVNYKSPPPP-YVYSSPPPPYYSPSPKVEYKSPPPP-YIYSSPPPPYY 590

Query: 269  -PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YK 409
             P     Y SPPPP Y Y+SPPPPY  PSP      PPPPY Y SPPPP Y       YK
Sbjct: 591  APSPKVDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYK 649

Query: 410  SPPPPVYKYKSPPPPAKKPYKYPSP------PPPVYKYKSPPPPVYSPPPPVYKYKSPPP 571
            SPPPP Y Y SPPP    PY  PSP       PP Y Y SPP P YSP P V  YKSPPP
Sbjct: 650  SPPPP-YVYSSPPP----PYYSPSPKVDYKSSPPQYVYSSPPTPYYSPSPKV-TYKSPPP 703

Query: 572  P 574
            P
Sbjct: 704  P 704

 Score =  206 bits (525), Expect = 8e-52
 Identities = 120/223 (53%), Positives = 123/223 (55%), Gaps = 29/223 (13%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYKYK 163
           Y SP    K P   P P P +Y  +SPPP Y  PSP      PPP Y Y SPPPP Y   
Sbjct: 60  YNSPSHEHKIPKYTPHPKPSIYS-SSPPPSYYSPSPKVDYKSPPPSYVYSSPPPPYYS-- 116

Query: 164 SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYK 343
             P P   YKS PPP Y Y SPPPP Y      P PK  YK  SPPPP Y Y+SPPPPY 
Sbjct: 117 --PSPKVDYKSLPPP-YVYSSPPPPYYS-----PSPKVNYK--SPPPP-YVYSSPPPPYY 165

Query: 344 YPSP------PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKP---YKYP 478
            PSP      PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP   P     Y 
Sbjct: 166 SPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPYYSPTPKVDYK 224

Query: 479 SPPPPVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
           SPPPP Y Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 225 SPPPP-YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYS 266

 Score =  166 bits (420), Expect = 1e-39
 Identities = 106/216 (49%), Positives = 108/216 (50%), Gaps = 33/216 (15%)
 Frame = +2

Query: 35  YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKY-PSPPPPVYKYKSPPPPVYKYKSPPPPV 211
           Y Y SP  P   YNSP   +K P       KY P P P +Y   SPPP  Y     P P 
Sbjct: 50  YPYTSPQTP--HYNSPSHEHKIP-------KYTPHPKPSIYS-SSPPPSYYS----PSPK 95

Query: 212 YKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP------------ 355
             YKSPPP  Y Y SPPPP      Y SP P V  Y S PPPY Y SP            
Sbjct: 96  VDYKSPPPS-YVYSSPPPP------YYSPSPKV-DYKSLPPPYVYSSPPPPYYSPSPKVN 147

Query: 356 ---PPPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVY 499
              PPPPY Y SPPPP Y       YKSPPPP Y Y SPPPP   P     Y SPPPP Y
Sbjct: 148 YKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPP-YVYSSPPPPYYSPSPKVDYKSPPPP-Y 205

Query: 500 KYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
            Y SPPPP YSP        PPP Y Y SPPPP YS
Sbjct: 206 VYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYS 241

 Score =  143 bits (360), Expect = 1e-32
 Identities = 84/169 (49%), Positives = 86/169 (50%), Gaps = 44/169 (26%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
            YKSPPPP     P  PY  PSP      PPP Y Y+SPPPPY  PSP      PPPPY Y
Sbjct: 548  YKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSPPPPYVY 607

Query: 131  PSPPPPVYK---------------YKSPPPPVYK------YKSPPPPVYKYKSPPPPVYK 247
             SPPPP Y                Y SPPPP Y       YKSPPPP Y Y SPPPP Y 
Sbjct: 608  SSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPP-YVYSSPPPPYYS 666

Query: 248  YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKY 376
                 P PK  YK     PP Y Y+SPP PY  PSP      PPPPY Y
Sbjct: 667  -----PSPKVDYK---SSPPQYVYSSPPTPYYSPSPKVTYKSPPPPYVY 707

[24][TOP]
>UniRef100_Q9M564 CRANTZ hydroxyproline-rich glycoprotein n=1 Tax=Manihot esculenta
           RepID=Q9M564_MANES
          Length = 232

 Score =  246 bits (628), Expect = 9e-64
 Identities = 140/221 (63%), Positives = 140/221 (63%), Gaps = 27/221 (12%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVY 154
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPPV 
Sbjct: 20  YKSPPPPSPSPPPPYYYKSPPPPS---PSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV- 75

Query: 155 KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNS 325
             KSPPPP Y Y SPPPPV   KSPPPP Y Y SPPPP   P  PY Y SPPPPV    S
Sbjct: 76  --KSPPPPYY-YHSPPPPV---KSPPPPYY-YHSPPPPVKSPPPPYYYHSPPPPV---KS 125

Query: 326 PPPPYKYPSPPPP------PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP---YKYP 478
           PPPPY Y SPPPP      PY Y SPPPPV   KSPPPP Y Y SPPPP K P   Y Y 
Sbjct: 126 PPPPYYYHSPPPPVKSPPPPYYYHSPPPPV---KSPPPPYY-YHSPPPPVKSPPPPYYYH 181

Query: 479 SPPPPV------YKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           SPPPPV      Y Y SPPPPV SPPPP Y Y SPPPPV S
Sbjct: 182 SPPPPVKSPPPPYYYHSPPPPVKSPPPPYY-YHSPPPPVKS 221

 Score =  244 bits (623), Expect = 4e-63
 Identities = 140/216 (64%), Positives = 140/216 (64%), Gaps = 23/216 (10%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVY 154
           YKSPPPP   P  PY Y SPPPPV    SPPPPY Y SPPPP      PY Y SPPPPV 
Sbjct: 36  YKSPPPPSPSPPPPYYYHSPPPPV---KSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV- 91

Query: 155 KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNS 325
             KSPPPP Y Y SPPPPV   KSPPPP Y Y SPPPP   P  PY Y SPPPPV    S
Sbjct: 92  --KSPPPPYY-YHSPPPPV---KSPPPPYY-YHSPPPPVKSPPPPYYYHSPPPPV---KS 141

Query: 326 PPPPYKYPSPPPP------PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKK---PYKYP 478
           PPPPY Y SPPPP      PY Y SPPPPV   KSPPPP Y Y SPPPP K    PY Y 
Sbjct: 142 PPPPYYYHSPPPPVKSPPPPYYYHSPPPPV---KSPPPPYY-YHSPPPPVKSPPPPYYYH 197

Query: 479 SPPPPVYKYKSPPPPVY--SPPPPVYKYKSPPPPVY 580
           SPPPPV   KSPPPP Y  SPPPPV   KSPPPPVY
Sbjct: 198 SPPPPV---KSPPPPYYYHSPPPPV---KSPPPPVY 227

 Score =  240 bits (612), Expect = 7e-62
 Identities = 137/216 (63%), Positives = 137/216 (63%), Gaps = 24/216 (11%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVYKYKSP 169
           SP PPP  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPPV   KSP
Sbjct: 11  SPSPPP--PYYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPV---KSP 62

Query: 170 PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPY 340
           PPP Y Y SPPPPV   KSPPPP Y Y SPPPP   P  PY Y SPPPPV    SPPPPY
Sbjct: 63  PPPYY-YHSPPPPV---KSPPPPYY-YHSPPPPVKSPPPPYYYHSPPPPV---KSPPPPY 114

Query: 341 KYPSPPPP------PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP---YKYPSPPPP 493
            Y SPPPP      PY Y SPPPPV   KSPPPP Y Y SPPPP K P   Y Y SPPPP
Sbjct: 115 YYHSPPPPVKSPPPPYYYHSPPPPV---KSPPPPYY-YHSPPPPVKSPPPPYYYHSPPPP 170

Query: 494 V------YKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           V      Y Y SPPPPV SPPPP Y Y SPPPPV S
Sbjct: 171 VKSPPPPYYYHSPPPPVKSPPPPYY-YHSPPPPVKS 205

 Score =  184 bits (468), Expect = 3e-45
 Identities = 105/168 (62%), Positives = 106/168 (63%)
 Frame = +2

Query: 80  PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSP 259
           P    K    PPPPY Y SPPPP     SPPPP Y YKSPPPP     SPPPP Y Y SP
Sbjct: 4   PAAKLKTSPSPPPPYYYKSPPPPS---PSPPPPYY-YKSPPPPS---PSPPPPYY-YHSP 55

Query: 260 PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 439
           PPP K      SPPPP Y Y+SPPPP K    PPPPY Y SPPPPV   KSPPPP Y Y 
Sbjct: 56  PPPVK------SPPPPYY-YHSPPPPVK---SPPPPYYYHSPPPPV---KSPPPPYY-YH 101

Query: 440 SPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           SPPPP K      SPPPP Y Y SPPPPV SPPPP Y Y SPPPPV S
Sbjct: 102 SPPPPVK------SPPPPYY-YHSPPPPVKSPPPPYY-YHSPPPPVKS 141

 Score =  161 bits (408), Expect = 3e-38
 Identities = 95/170 (55%), Positives = 96/170 (56%), Gaps = 42/170 (24%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV- 151
           Y SPPPP   P  PY Y SPPPPV    SPPPPY Y SPPPP      PY Y SPPPPV 
Sbjct: 68  YHSPPPPVKSPPPPYYYHSPPPPV---KSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK 124

Query: 152 -----YKYKSPPPPV------YKYKSPPPPV------YKYKSPPPPV------YKYKSPP 262
                Y Y SPPPPV      Y Y SPPPPV      Y Y SPPPPV      Y Y SPP
Sbjct: 125 SPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 184

Query: 263 PP---PKKPYKYPSPPPPV------YKYNSPPPPYKYPSPPPPPYKYPSP 385
           PP   P  PY Y SPPPPV      Y Y+SPPPP K  SPPPP Y Y SP
Sbjct: 185 PPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK--SPPPPVYIYASP 232

[25][TOP]
>UniRef100_Q09085 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q09085_PHAVU
          Length = 368

 Score =  244 bits (623), Expect = 4e-63
 Identities = 136/237 (57%), Positives = 139/237 (58%), Gaps = 43/237 (18%)
 Frame = +2

Query: 2   YKSPPPPPKKPYK----YPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP 169
           YKSPPPP K PY     Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSP
Sbjct: 143 YKSPPPPHKDPYYPPYYYKSPPPPS---PSPPPPYYYKSPPPPS---PSPPPPYY-YKSP 195

Query: 170 PPP------VYKYKSPPPPV------YKYKSPPPPV------YKYKSPPPPPKKPYKYPS 295
           PPP       Y YKSPPPP       Y YKSPPPP       Y YKSPPPP   P   PS
Sbjct: 196 PPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPSPS 255

Query: 296 PPPPVYKYN------SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV------YKYK 439
           PPPP Y  +      SPPPPY Y SPPPP    PSPPPP Y YKSPPPP       Y YK
Sbjct: 256 PPPPYYYKSPPPPDPSPPPPYYYKSPPPPS---PSPPPPYY-YKSPPPPSPSPPPPYYYK 311

Query: 440 SPPPPAKKP-----YKYPSPP----PPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           SPPPP+  P     YK P PP    PP Y Y SPPPP  SPPPP Y Y SPPPP Y+
Sbjct: 312 SPPPPSPDPPTPYYYKSPPPPSPSPPPPYYYVSPPPPTKSPPPPAYSYASPPPPTYN 368

 Score =  231 bits (590), Expect = 2e-59
 Identities = 132/221 (59%), Positives = 134/221 (60%), Gaps = 30/221 (13%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPV-----YKYNSPPPPYKYPSPPPPPYKYPSPP----P 145
           Y SPPPP      PY Y SPPPP      Y Y SPPPP+K P  PP  YK P PP    P
Sbjct: 112 YNSPPPPYYYKSPPYYYKSPPPPSPSPSPYYYKSPPPPHKDPYYPPYYYKSPPPPSPSPP 171

Query: 146 PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP------VYKYKSPPPP---PKKPYKYPSP 298
           P Y YKSPPPP     SPPPP Y YKSPPPP       Y YKSPPPP   P  PY Y SP
Sbjct: 172 PPYYYKSPPPPS---PSPPPPYY-YKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSP 227

Query: 299 PPPVYKYNSPPPPYKYPSPPPP---PYKYPSPPPPVYKYKSPPPP------VYKYKSPPP 451
           PPP     SPPPPY Y SPPPP   P   PSPPPP Y YKSPPPP       Y YKSPPP
Sbjct: 228 PPPS---PSPPPPYYYKSPPPPSPSPPPSPSPPPPYY-YKSPPPPDPSPPPPYYYKSPPP 283

Query: 452 PAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           P+      PSPPPP Y YKSPPPP  SPPPP Y YKSPPPP
Sbjct: 284 PS------PSPPPPYY-YKSPPPPSPSPPPPYY-YKSPPPP 316

 Score =  225 bits (574), Expect = 2e-57
 Identities = 128/211 (60%), Positives = 131/211 (62%), Gaps = 27/211 (12%)
 Frame = +2

Query: 23  PKKPY---KYPSPPPPVYK---YNSPPPPYKYPSPP-----PPPYKYPSPPPPVYKYKSP 169
           PKKPY   K+   P P +K   YNSPPPPY Y SPP     PPP   PSP P  Y YKSP
Sbjct: 90  PKKPYDCEKHKHSPTPYHKPYYYNSPPPPYYYKSPPYYYKSPPP---PSPSPSPYYYKSP 146

Query: 170 PP-------PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKY 319
           PP       P Y YKSPPPP     SPPPP Y YKSPPPP   P  PY Y SPPPP    
Sbjct: 147 PPPHKDPYYPPYYYKSPPPP---SPSPPPPYY-YKSPPPPSPSPPPPYYYKSPPPP---D 199

Query: 320 NSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP------PPPVYKYKSPPPPAKKPYKYPS 481
            SPPPPY Y SPPPP    PSPPPP Y YKSP      PPP Y YKSPPPP+  P   PS
Sbjct: 200 PSPPPPYYYKSPPPPS---PSPPPPYY-YKSPPPPSPSPPPPYYYKSPPPPSPSPPPSPS 255

Query: 482 PPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           PPPP Y YKSPPPP  SPPPP Y YKSPPPP
Sbjct: 256 PPPPYY-YKSPPPPDPSPPPPYY-YKSPPPP 284

 Score =  162 bits (411), Expect = 1e-38
 Identities = 95/175 (54%), Positives = 99/175 (56%), Gaps = 23/175 (13%)
 Frame = +2

Query: 119 PYKY-PSPPPPVYKYKSPPPPVYK---YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYK 286
           P+ Y P  P    K+K  P P +K   Y SPPPP Y YKSPP   Y YKSPPPP      
Sbjct: 85  PFAYAPKKPYDCEKHKHSPTPYHKPYYYNSPPPPYY-YKSPP---YYYKSPPPP------ 134

Query: 287 YPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSP----PPPVYKYKSP------PPPVYKY 436
             SP P  Y Y SPPPP+K P  PP  YK P P    PPP Y YKSP      PPP Y Y
Sbjct: 135 --SPSPSPYYYKSPPPPHKDPYYPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYY 192

Query: 437 KSPPPPAKKP-----YKYPSP----PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           KSPPPP   P     YK P P    PPP Y YKSPPPP  SPPPP Y YKSPPPP
Sbjct: 193 KSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYY-YKSPPPP 246

 Score = 90.5 bits (223), Expect = 9e-17
 Identities = 53/101 (52%), Positives = 56/101 (55%), Gaps = 1/101 (0%)
 Frame = +2

Query: 275 KPYKY-PSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 451
           KP+ Y P  P    K+   P PY        PY Y SPPPP Y YKSPP   Y YKSPPP
Sbjct: 84  KPFAYAPKKPYDCEKHKHSPTPYH------KPYYYNSPPPPYY-YKSPP---YYYKSPPP 133

Query: 452 PAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           P+      PSP P  Y YKSPPPP   P  P Y YKSPPPP
Sbjct: 134 PS------PSPSP--YYYKSPPPPHKDPYYPPYYYKSPPPP 166

[26][TOP]
>UniRef100_Q2A9D3 Extensin, putative n=1 Tax=Brassica oleracea RepID=Q2A9D3_BRAOL
          Length = 509

 Score =  243 bits (620), Expect = 8e-63
 Identities = 142/271 (52%), Positives = 147/271 (54%), Gaps = 77/271 (28%)
 Frame = +2

Query: 2    YKSPPPP---------------PKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPP 118
            YKSPPPP               P+  YK P PPPP Y      +YNSPPPPY Y SPPPP
Sbjct: 216  YKSPPPPYVYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEYNSPPPPYVYSSPPPP 275

Query: 119  PYKYPSP------PPPVYKYKSPPPPVYKYKSP------PPPVYKYKSPPPPVYK----- 247
            PY  PSP      PPP Y Y SPPPP Y + SP      PPP Y Y SPPPP Y      
Sbjct: 276  PYYSPSPKVEYKSPPPPYVYNSPPPPPYYFPSPKVDYKSPPPPYVYSSPPPPPYYSPSPK 335

Query: 248  --YKSPPPPPKKPYKYPSPPPPVYK-------YNSPPPPYKYPSPPPPPYKYPSP----- 385
              YKSPPPP    Y Y SPPPP Y        Y SPPPPY Y SPPPPPY  PSP     
Sbjct: 336  VYYKSPPPP----YVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPPPPPYYSPSPKVNYK 391

Query: 386  -PPPVYKYKSPPPPVY-------KYKSPPPPAKKPYKYPSPPPPVY-------KYKSPPP 520
             PPP Y Y SPPPP Y        YKSPPPP    Y Y SPPPP +       +YKSPPP
Sbjct: 392  YPPPPYVYSSPPPPPYYSPSPKVNYKSPPPP----YVYSSPPPPQFYSPSPKAEYKSPPP 447

Query: 521  P-VYS--PPPPVYK------YKSPPPP-VYS 583
            P VYS  PPPP Y       YKSPPPP VYS
Sbjct: 448  PYVYSSPPPPPYYSPSPKVDYKSPPPPYVYS 478

 Score =  243 bits (619), Expect = 1e-62
 Identities = 141/270 (52%), Positives = 145/270 (53%), Gaps = 77/270 (28%)
 Frame = +2

Query: 2    YKSPPPPPK--------------KPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPP 118
            YKSPPPPP                PY Y SPPPP Y       +Y SPPPPY Y SPPPP
Sbjct: 242  YKSPPPPPPYYSPSPKVEYNSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPP 301

Query: 119  PYKYPSP------PPPVYKYKSPPPPVYK-------YKSPPPPVYKYKSPPPPVYK---- 247
            PY +PSP      PPP Y Y SPPPP Y        YKSPPPP Y Y SPPPP Y     
Sbjct: 302  PYYFPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPPYYSPSP 360

Query: 248  ---YKSPPPPPKKPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSP---- 385
               YKSPPPP    Y Y SPPPP Y        Y  PPPPY Y SPPPPPY  PSP    
Sbjct: 361  KMVYKSPPPP----YVYSSPPPPPYYSPSPKVNYKYPPPPYVYSSPPPPPYYSPSPKVNY 416

Query: 386  --PPPVYKYKSPPPPVY-------KYKSPPPPAKKPYKYPSPPPPVY-------KYKSPP 517
              PPP Y Y SPPPP +       +YKSPPPP    Y Y SPPPP Y        YKSPP
Sbjct: 417  KSPPPPYVYSSPPPPQFYSPSPKAEYKSPPPP----YVYSSPPPPPYYSPSPKVDYKSPP 472

Query: 518  PP-VYS--PPPPVYK------YKSPPPPVY 580
            PP VYS  PPPP Y       YKSPPPP Y
Sbjct: 473  PPYVYSSPPPPPYYSPSPKVYYKSPPPPPY 502

 Score =  240 bits (612), Expect = 7e-62
 Identities = 142/266 (53%), Positives = 144/266 (54%), Gaps = 73/266 (27%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSP------PPPVYKYNSPPPP-YKYPSP------PPPPYKYPSPP 142
           YKSPPPPP  PY  PSP      PPP Y YNSPPPP Y  PSP      PPPPY Y SPP
Sbjct: 120 YKSPPPPP--PYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKVEYKSPPPPYVYSSPP 177

Query: 143 -PPVYK------YKSPPPPVYKYKSPPPPVY-------KYKSPPPPVYKYKSPPPPP--- 271
            PP Y       YKSPPPP Y Y SPPPP Y        YKSPPPP Y Y S PPPP   
Sbjct: 178 LPPYYSPSPKVDYKSPPPP-YVYSSPPPPPYYSPSPKVDYKSPPPP-YVYSSLPPPPYYS 235

Query: 272 ---KKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPPPYKYPSP------PPPVYKY 406
              +  YK P PPPP Y      +YNSPPPPY Y SPPPPPY  PSP      PPP Y Y
Sbjct: 236 PSPEVDYKSPPPPPPYYSPSPKVEYNSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVY 295

Query: 407 KSPPPPVY-------KYKSPPPP------AKKPYKYPSP------PPPVYKYKSPPPP-- 523
            SPPPP Y        YKSPPPP         PY  PSP      PPP Y Y SPPPP  
Sbjct: 296 NSPPPPPYYFPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPPPPPY 355

Query: 524 -------VYSPPPPVYKYKSPPPPVY 580
                  VY  PPP Y Y SPPPP Y
Sbjct: 356 YSPSPKMVYKSPPPPYVYSSPPPPPY 381

 Score =  224 bits (570), Expect = 5e-57
 Identities = 136/278 (48%), Positives = 141/278 (50%), Gaps = 84/278 (30%)
 Frame = +2

Query: 2   YKSPPPPPK-------------KPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPPP 121
           Y +PP PP              KPY Y SPPPP Y       +Y SPPPPY Y S PPPP
Sbjct: 51  YSAPPSPPPQYRRQGPKYTPHPKPYIYSSPPPPSYYSPSPKVEYKSPPPPYIYSSLPPPP 110

Query: 122 Y---------KYPSPPPPVY------KYKSPPPPVYKYKSPPPPVY-------KYKSPPP 235
           Y         K P PPPP Y      +YKSPPPP Y Y SPPPP Y       +YKSPPP
Sbjct: 111 YYSPSPEVDYKSPPPPPPYYSPSPKVEYKSPPPP-YVYNSPPPPPYYSPSPKVEYKSPPP 169

Query: 236 PVYKYKSPPPPP-------------KKPYKYPSPPPPVY-------KYNSPPPPYKYPSP 355
           P Y Y SPP PP               PY Y SPPPP Y        Y SPPPPY Y S 
Sbjct: 170 P-YVYSSPPLPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSL 228

Query: 356 PPPPY---------KYPSPPPPVY------KYKSPPPPVYKYKSPPPPAKKPYKYPSP-- 484
           PPPPY         K P PPPP Y      +Y SPPPP Y Y SPPPP   PY  PSP  
Sbjct: 229 PPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEYNSPPPP-YVYSSPPPP---PYYSPSPKV 284

Query: 485 ----PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP-VYS 583
               PPP Y Y SPPPP Y  P P   YKSPPPP VYS
Sbjct: 285 EYKSPPPPYVYNSPPPPPYYFPSPKVDYKSPPPPYVYS 322

 Score =  223 bits (569), Expect = 7e-57
 Identities = 141/267 (52%), Positives = 146/267 (54%), Gaps = 73/267 (27%)
 Frame = +2

Query: 2   YKSPPPP---------------PKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPP 118
           YKSPPPP               P+  YK P PPPP Y      +Y SPPPPY Y SPPPP
Sbjct: 94  YKSPPPPYIYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEYKSPPPPYVYNSPPPP 153

Query: 119 PYKYPSPPPPVYKYKSPPPPVYKYKSPP-PPVYK------YKSPPPPVYKYKSPPPPPKK 277
           PY  PSP     +YKSPPPP Y Y SPP PP Y       YKSPPPP Y Y SPPPPP  
Sbjct: 154 PYYSPSPK---VEYKSPPPP-YVYSSPPLPPYYSPSPKVDYKSPPPP-YVYSSPPPPP-- 206

Query: 278 PYKYPSP------PPPVYKYNS-PPPPYKYPSP--------PPPPYKYPSP------PPP 394
            Y  PSP      PPP Y Y+S PPPPY  PSP        PPPPY  PSP      PPP
Sbjct: 207 -YYSPSPKVDYKSPPPPYVYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEYNSPPP 265

Query: 395 VYKYKSPPPPVY-------KYKSPPPPAKKPYKYPSPPPPVY-------KYKSPPPP-VY 529
            Y Y SPPPP Y       +YKSPPPP    Y Y SPPPP Y        YKSPPPP VY
Sbjct: 266 PYVYSSPPPPPYYSPSPKVEYKSPPPP----YVYNSPPPPPYYFPSPKVDYKSPPPPYVY 321

Query: 530 S--PPPPVYK------YKSPPPP-VYS 583
           S  PPPP Y       YKSPPPP VYS
Sbjct: 322 SSPPPPPYYSPSPKVYYKSPPPPYVYS 348

 Score =  211 bits (537), Expect = 3e-53
 Identities = 131/280 (46%), Positives = 136/280 (48%), Gaps = 89/280 (31%)
 Frame = +2

Query: 2   YKSPPP-----------------------------------------PPKKPYKYPSPPP 58
           Y+SPP                                          P  KPY Y SPPP
Sbjct: 23  YESPPTTQKYPPVHKTKSPYQPKKNSPYYSAPPSPPPQYRRQGPKYTPHPKPYIYSSPPP 82

Query: 59  PVY-------KYNSPPPPYKYPSPPPPP---------YKYPSPPPPVY------KYKSPP 172
           P Y       +Y SPPPPY Y S PPPP         YK P PPPP Y      +YKSPP
Sbjct: 83  PSYYSPSPKVEYKSPPPPYIYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEYKSPP 142

Query: 173 PPVYKYKSPPPPVY-------KYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPP 331
           PP Y Y SPPPP Y       +YKSPPPP Y Y SPP PP     Y SP P V  Y SPP
Sbjct: 143 PP-YVYNSPPPPPYYSPSPKVEYKSPPPP-YVYSSPPLPP-----YYSPSPKV-DYKSPP 194

Query: 332 PPYKYPSPPPPPYKYPSP------PPPVYKYKS-PPPPVYK------YKSPPPPAKKPYK 472
           PPY Y SPPPPPY  PSP      PPP Y Y S PPPP Y       YKSPPPP   PY 
Sbjct: 195 PPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSLPPPPYYSPSPEVDYKSPPPP--PPYY 252

Query: 473 YPSP------PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            PSP      PPP Y Y SPPPP Y  P P  +YKSPPPP
Sbjct: 253 SPSPKVEYNSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPP 292

 Score =  188 bits (478), Expect = 2e-46
 Identities = 109/210 (51%), Positives = 111/210 (52%), Gaps = 49/210 (23%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYK-------YNSPPPPYKYPSPPPPPYKYPSP------P 142
           YKSPPPP    Y Y SPPPP Y        Y SPPPPY Y SPPPPPY  PSP      P
Sbjct: 312 YKSPPPP----YVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKSP 367

Query: 143 PPVYKYKSPPPPVYKYKSP------PPPVYKYKSPPPPVY-------KYKSPPPPPKKPY 283
           PP Y Y SPPPP Y   SP      PPP Y Y SPPPP Y        YKSPPPP    Y
Sbjct: 368 PPPYVYSSPPPPPYYSPSPKVNYKYPPPPYVYSSPPPPPYYSPSPKVNYKSPPPP----Y 423

Query: 284 KYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYK----------------YPSPPPP 394
            Y SPPPP +       +Y SPPPPY Y SPPPPPY                 Y SPPPP
Sbjct: 424 VYSSPPPPQFYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 483

Query: 395 VYKYKSPPPPVYKYKSPPPPAKKPYKYPSP 484
              Y SP P VY YKSPPPP   PY Y  P
Sbjct: 484 --PYYSPSPKVY-YKSPPPP---PYVYKMP 507

 Score =  144 bits (363), Expect = 5e-33
 Identities = 93/212 (43%), Positives = 98/212 (46%), Gaps = 40/212 (18%)
 Frame = +2

Query: 65  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 244
           Y Y SPP   KYP              PV+K KSP  P         P Y     PPP Y
Sbjct: 21  YPYESPPTTQKYP--------------PVHKTKSPYQP-----KKNSPYYSAPPSPPPQY 61

Query: 245 KYKSPP-PPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------------------P 367
           + + P   P  KPY Y SPPPP   Y SP P  +Y SPPPP                   
Sbjct: 62  RRQGPKYTPHPKPYIYSSPPPP--SYYSPSPKVEYKSPPPPYIYSSLPPPPYYSPSPEVD 119

Query: 368 YKYPSPPPPVY------KYKSPPPPVYKYKSPPPPAKKPYKYPSP------PPPVYKYKS 511
           YK P PPPP Y      +YKSPPPP Y Y SPPPP   PY  PSP      PPP Y Y S
Sbjct: 120 YKSPPPPPPYYSPSPKVEYKSPPPP-YVYNSPPPP---PYYSPSPKVEYKSPPPPYVYSS 175

Query: 512 PP-PPVYSP--------PPPVYKYKSPPPPVY 580
           PP PP YSP        PPP Y Y SPPPP Y
Sbjct: 176 PPLPPYYSPSPKVDYKSPPPPYVYSSPPPPPY 207

 Score =  115 bits (287), Expect = 3e-24
 Identities = 69/123 (56%), Positives = 70/123 (56%), Gaps = 29/123 (23%)
 Frame = +2

Query: 2   YKSPPPP------PKKPYKYPSP------PPPVYKYNSPPPPYKY-PSP------PPPPY 124
           YK PPPP      P  PY  PSP      PPP Y Y+SPPPP  Y PSP      PPPPY
Sbjct: 390 YKYPPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPQFYSPSPKAEYKSPPPPY 449

Query: 125 KYPSPPPPVY-------KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP---K 274
            Y SPPPP Y        YKSPPPP Y Y SPPPP   Y SP P VY YKSPPPPP   K
Sbjct: 450 VYSSPPPPPYYSPSPKVDYKSPPPP-YVYSSPPPP--PYYSPSPKVY-YKSPPPPPYVYK 505

Query: 275 KPY 283
            PY
Sbjct: 506 MPY 508

[27][TOP]
>UniRef100_Q41707 Extensin class 1 protein n=1 Tax=Vigna unguiculata
           RepID=Q41707_VIGUN
          Length = 489

 Score =  242 bits (618), Expect = 1e-62
 Identities = 142/254 (55%), Positives = 143/254 (56%), Gaps = 63/254 (24%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV- 151
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP  
Sbjct: 78  YKSPPPPSPSPPPPYVYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSP 134

Query: 152 -----YKYKSPPPPV------YKYKSPPPPV------YKYKSP------PPPVYKYKSPP 262
                Y YKSPPPP       Y YKSPPPP       Y YKSP      PPP Y YKSPP
Sbjct: 135 SPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPP 194

Query: 263 PP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSP------PPPV 397
           PP   P  PY Y SPPPP     SPPPPY Y SP      PPPPY Y SP      PPP 
Sbjct: 195 PPSPSPPPPYYYKSPPPP---SPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 251

Query: 398 YKYKSP------PPPVYKYKSPPPPAKKP-----YKYPSP----PPPVYKYKSPPPPVYS 532
           Y YKSP      PPP Y YKSPPPP+  P     YK P P    PPP Y YKSPPPP  S
Sbjct: 252 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 311

Query: 533 PPPPVYKYKSPPPP 574
           PPPP Y YKSPPPP
Sbjct: 312 PPPPYY-YKSPPPP 324

 Score =  242 bits (618), Expect = 1e-62
 Identities = 142/254 (55%), Positives = 143/254 (56%), Gaps = 63/254 (24%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV- 151
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP  
Sbjct: 206 YKSPPPPSPSPPPPYVYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSP 262

Query: 152 -----YKYKSPPPPV------YKYKSPPPPV------YKYKSP------PPPVYKYKSPP 262
                Y YKSPPPP       Y YKSPPPP       Y YKSP      PPP Y YKSPP
Sbjct: 263 SPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPP 322

Query: 263 PP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSP------PPPV 397
           PP   P  PY Y SPPPP     SPPPPY Y SP      PPPPY Y SP      PPP 
Sbjct: 323 PPSPSPPPPYYYKSPPPP---SPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 379

Query: 398 YKYKSP------PPPVYKYKSPPPPAKKP-----YKYPSP----PPPVYKYKSPPPPVYS 532
           Y YKSP      PPP Y YKSPPPP+  P     YK P P    PPP Y YKSPPPP  S
Sbjct: 380 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPS 439

Query: 533 PPPPVYKYKSPPPP 574
           PPPP Y YKSPPPP
Sbjct: 440 PPPPYY-YKSPPPP 452

 Score =  242 bits (618), Expect = 1e-62
 Identities = 142/258 (55%), Positives = 143/258 (55%), Gaps = 65/258 (25%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV- 151
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP  
Sbjct: 238 YKSPPPPSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSP 294

Query: 152 -----YKYKSPPPPV------YKYKSPPPPV------YKYKSPPPPV------YKYKSPP 262
                Y YKSPPPP       Y YKSPPPP       Y YKSPPPP       Y YKSPP
Sbjct: 295 SPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPP 354

Query: 263 PP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV------ 397
           PP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP       
Sbjct: 355 PPSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 411

Query: 398 YKYKSP------PPPVYKYKSPPPPAKKP-----YKYPSP----PPPVYKYKSPPPPVYS 532
           Y YKSP      PPP Y YKSPPPP+  P     YK P P    PPP Y YKSPPPP  S
Sbjct: 412 YYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 471

Query: 533 PPPPVYK--YKSPPPPVY 580
           PPPP Y   Y SPPPP Y
Sbjct: 472 PPPPYYPYLYNSPPPPAY 489

 Score =  231 bits (588), Expect = 4e-59
 Identities = 137/251 (54%), Positives = 139/251 (55%), Gaps = 60/251 (23%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSP------PP 145
           YKSPPPP       PSPPPP Y +  PP  Y Y SP      PPPPY Y SP      PP
Sbjct: 54  YKSPPPPS------PSPPPPPYVHKYPP--YYYKSPPPPSPSPPPPYVYKSPPPPSPSPP 105

Query: 146 PVYKYKSP------PPPVYKYKSP------PPPVYKYKSP------PPPVYKYKSPPPP- 268
           P Y YKSP      PPP Y YKSP      PPP Y YKSP      PPP Y YKSPPPP 
Sbjct: 106 PPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPS 165

Query: 269 --PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSP------PPPVYKY 406
             P  PY Y SPPPP     SPPPPY Y SP      PPPPY Y SP      PPP Y Y
Sbjct: 166 PSPPPPYYYKSPPPP---SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVY 222

Query: 407 KSP------PPPVYKYKSPPPPAKKP-----YKYPSP----PPPVYKYKSPPPPVYSPPP 541
           KSP      PPP Y YKSPPPP+  P     YK P P    PPP Y YKSPPPP  SPPP
Sbjct: 223 KSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPP 282

Query: 542 PVYKYKSPPPP 574
           P Y YKSPPPP
Sbjct: 283 PYY-YKSPPPP 292

 Score =  226 bits (576), Expect = 1e-57
 Identities = 132/217 (60%), Positives = 133/217 (61%), Gaps = 26/217 (11%)
 Frame = +2

Query: 8   SPPPPPK----KPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 175
           SPPPPP      PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPPP
Sbjct: 63  SPPPPPYVHKYPPYYYKSPPPPS---PSPPPPYVYKSPPPPS---PSPPPPYY-YKSPPP 115

Query: 176 PVYKYKSPPPPVYKYKSPPPPV------YKYKSPPPP---PKKPYKYPSPPPPVYKYNSP 328
           P     SPPPP Y YKSPPPP       Y YKSPPPP   P  PY Y SPPPP     SP
Sbjct: 116 PS---PSPPPPYY-YKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPS---PSP 168

Query: 329 PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV------YKYKSPPPPAKKPYKYPSPPP 490
           PPPY Y SPPPP    PSPPPP Y YKSPPPP       Y YKSPPPP+      PSPPP
Sbjct: 169 PPPYYYKSPPPPS---PSPPPPYY-YKSPPPPSPSPPPPYYYKSPPPPS------PSPPP 218

Query: 491 PVYKYKSPPPPVYSPPPPVYKYKSP-------PPPVY 580
           P Y YKSPPPP  SPPPP Y YKSP       PPP Y
Sbjct: 219 P-YVYKSPPPPSPSPPPPYY-YKSPPPPSPSPPPPYY 253

 Score =  220 bits (560), Expect = 7e-56
 Identities = 136/254 (53%), Positives = 138/254 (54%), Gaps = 72/254 (28%)
 Frame = +2

Query: 29  KPY------KYPSPPPPVYKYNSPP-----PPYKYPSPPPPPY--KYP-----SP----- 139
           KPY       YP   PP Y YN+PP     PP   PSPPPPPY  KYP     SP     
Sbjct: 28  KPYYGQPWNNYPKQTPPYY-YNAPPYYYKSPPPPSPSPPPPPYVHKYPPYYYKSPPPPSP 86

Query: 140 -PPPVYKYKSP------PPPVYKYKSP------PPPVYKYKSP------PPPVYKYKSPP 262
            PPP Y YKSP      PPP Y YKSP      PPP Y YKSP      PPP Y YKSPP
Sbjct: 87  SPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPP 146

Query: 263 PP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSP------PPPV 397
           PP   P  PY Y SPPPP     SPPPPY Y SP      PPPPY Y SP      PPP 
Sbjct: 147 PPSPSPPPPYVYKSPPPP---SPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPP 203

Query: 398 YKYKSP------PPPVYKYKSPPPPAKKP-----YKYPSP----PPPVYKYKSPPPPVYS 532
           Y YKSP      PPP Y YKSPPPP+  P     YK P P    PPP Y YKSPPPP  S
Sbjct: 204 YYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 263

Query: 533 PPPPVYKYKSPPPP 574
           PPPP Y YKSPPPP
Sbjct: 264 PPPPYY-YKSPPPP 276

 Score =  172 bits (435), Expect = 2e-41
 Identities = 102/170 (60%), Positives = 105/170 (61%)
 Frame = +2

Query: 65  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 244
           YK     P   YP   PP Y Y +PP   Y YKSPPPP     SPPPP Y +K PP   Y
Sbjct: 27  YKPYYGQPWNNYPKQTPP-YYYNAPP---YYYKSPPPPS---PSPPPPPYVHKYPP---Y 76

Query: 245 KYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 424
            YKSPPPP       PSPPPP Y Y SPPPP   PSPPPP Y Y SPPPP     SPPPP
Sbjct: 77  YYKSPPPPS------PSPPPP-YVYKSPPPPS--PSPPPP-YYYKSPPPPS---PSPPPP 123

Query: 425 VYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            Y YKSPPPP+      PSPPPP Y YKSPPPP  SPPPP Y YKSPPPP
Sbjct: 124 YY-YKSPPPPS------PSPPPPYY-YKSPPPPSPSPPPP-YVYKSPPPP 164

 Score =  125 bits (314), Expect = 2e-27
 Identities = 80/145 (55%), Positives = 83/145 (57%)
 Frame = +2

Query: 146 PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS 325
           P   Y    PP Y Y +PP   Y YKSPPPP     SP PPP  PY +  PP   Y Y S
Sbjct: 34  PWNNYPKQTPPYY-YNAPP---YYYKSPPPP-----SPSPPPP-PYVHKYPP---YYYKS 80

Query: 326 PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKY 505
           PPPP   PSPPPP Y Y SPPPP     SPPPP Y YKSPPPP+      PSPPPP Y Y
Sbjct: 81  PPPPS--PSPPPP-YVYKSPPPPS---PSPPPPYY-YKSPPPPS------PSPPPPYY-Y 126

Query: 506 KSPPPPVYSPPPPVYKYKSPPPPVY 580
           KSPPPP  SP        SPPPP Y
Sbjct: 127 KSPPPP--SP--------SPPPPYY 141

 Score =  110 bits (274), Expect = 1e-22
 Identities = 65/115 (56%), Positives = 68/115 (59%), Gaps = 13/115 (11%)
 Frame = +2

Query: 275 KPY------KYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 436
           KPY       YP   PP Y YN+PP  Y Y SPPPP    PSPPPP Y +K PP   Y Y
Sbjct: 28  KPYYGQPWNNYPKQTPPYY-YNAPP--YYYKSPPPPS---PSPPPPPYVHKYPP---YYY 78

Query: 437 KSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSP-------PPPVY 580
           KSPPPP+      PSPPPP Y YKSPPPP  SPPPP Y YKSP       PPP Y
Sbjct: 79  KSPPPPS------PSPPPP-YVYKSPPPPSPSPPPPYY-YKSPPPPSPSPPPPYY 125

[28][TOP]
>UniRef100_Q9ZW80 Putative extensin n=1 Tax=Arabidopsis thaliana RepID=Q9ZW80_ARATH
          Length = 212

 Score =  242 bits (617), Expect = 2e-62
 Identities = 133/208 (63%), Positives = 136/208 (65%), Gaps = 15/208 (7%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVYKYK 163
           Y SPPPP    Y+Y SPPPPV    SPPPPY+Y SPPPP      PY Y SPPPPV   K
Sbjct: 33  YSSPPPP----YEYKSPPPPV---KSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPV---K 82

Query: 164 SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNSPPP 334
           SPPPP Y Y SPPPPV   KSPPPP Y Y SPPPP   P  PY Y SPPPPV    SPPP
Sbjct: 83  SPPPP-YVYSSPPPPV---KSPPPPYY-YHSPPPPVKSPPPPYYYHSPPPPV---KSPPP 134

Query: 335 PYKYPSPPPP------PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPV 496
           PY Y SPPPP      PY Y SPPPPV   KSPPPP Y Y SPPPP K      SPPPP 
Sbjct: 135 PYYYHSPPPPVKSPPPPYYYHSPPPPV---KSPPPPYY-YHSPPPPVK------SPPPP- 183

Query: 497 YKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
           Y Y SPPPPV SPPPPVY Y SPPPP +
Sbjct: 184 YLYSSPPPPVKSPPPPVYIYASPPPPTH 211

 Score =  230 bits (586), Expect = 7e-59
 Identities = 127/194 (65%), Positives = 130/194 (67%), Gaps = 9/194 (4%)
 Frame = +2

Query: 29  KPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 208
           +PY Y SPPPP Y+Y SPPPP K    PPPPY+Y SPPPPV   KSPPPP Y Y SPPPP
Sbjct: 29  EPYYYSSPPPP-YEYKSPPPPVK---SPPPPYEYKSPPPPV---KSPPPPYY-YHSPPPP 80

Query: 209 VYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP----- 364
           V   KSPPPP Y Y SPPPP   P  PY Y SPPPPV    SPPPPY Y SPPPP     
Sbjct: 81  V---KSPPPP-YVYSSPPPPVKSPPPPYYYHSPPPPV---KSPPPPYYYHSPPPPVKSPP 133

Query: 365 -PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPP 541
            PY Y SPPPPV   KSPPPP Y Y SPPPP K      SPPPP Y Y SPPPPV SPPP
Sbjct: 134 PPYYYHSPPPPV---KSPPPPYY-YHSPPPPVK------SPPPPYY-YHSPPPPVKSPPP 182

Query: 542 PVYKYKSPPPPVYS 583
           P Y Y SPPPPV S
Sbjct: 183 P-YLYSSPPPPVKS 195

 Score =  148 bits (373), Expect = 3e-34
 Identities = 87/158 (55%), Positives = 87/158 (55%), Gaps = 43/158 (27%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV- 151
           YKSPPPP   P  PY Y SPPPPV    SPPPPY Y SPPPP      PY Y SPPPPV 
Sbjct: 58  YKSPPPPVKSPPPPYYYHSPPPPV---KSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVK 114

Query: 152 -----YKYKSPPPPV------YKYKSPPPPV------YKYKSPPPPV------YKYKSPP 262
                Y Y SPPPPV      Y Y SPPPPV      Y Y SPPPPV      Y Y SPP
Sbjct: 115 SPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPP 174

Query: 263 PP---PKKPYKYPSPPPPV-------YKYNSPPPPYKY 346
           PP   P  PY Y SPPPPV       Y Y SPPPP  Y
Sbjct: 175 PPVKSPPPPYLYSSPPPPVKSPPPPVYIYASPPPPTHY 212

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 33/43 (76%), Positives = 36/43 (83%)
 Frame = +2

Query: 455 AKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           A +PY Y SPPPP Y+YKSPPPPV SPPPP Y+YKSPPPPV S
Sbjct: 27  ATEPYYYSSPPPP-YEYKSPPPPVKSPPPP-YEYKSPPPPVKS 67

[29][TOP]
>UniRef100_Q39949 Hydroxyproline-rich protein n=1 Tax=Helianthus annuus
           RepID=Q39949_HELAN
          Length = 263

 Score =  242 bits (617), Expect = 2e-62
 Identities = 133/205 (64%), Positives = 141/205 (68%), Gaps = 16/205 (7%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPVYKYNSPPPP---YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           P P    Y Y SPPPP  K + PPPP   Y Y SPPPPP  Y SPPPPVYK  SPPPPV 
Sbjct: 23  PSPTTATYHYSSPPPPPPKKSPPPPPKQQYVYKSPPPPPV-YKSPPPPVYK--SPPPPV- 78

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
            +KSPPPPV  +KSPPPPVYK    PPPPKKPY Y SPPPP   + SPPPP  Y SPPPP
Sbjct: 79  -HKSPPPPV--HKSPPPPVYK---SPPPPKKPYVYKSPPPPPPVHKSPPPPV-YKSPPPP 131

Query: 365 PYKYPSPPPPVYK------YKSPPPPVYK------YKSPPPPAKKPYKYPSPPPPVYKYK 508
            Y+  SPPPPVYK      YKSPPPPV+K      YKSPPPP KKPY Y SPPPP   +K
Sbjct: 132 VYE--SPPPPVYKSPPPPVYKSPPPPVHKSPPPPVYKSPPPP-KKPYVYKSPPPPPPVHK 188

Query: 509 SPPPPVY-SPPPPVYKYKSPPPPVY 580
           SPPPPVY SP PPV  +KSPP PVY
Sbjct: 189 SPPPPVYKSPTPPV--HKSPPHPVY 211

 Score =  239 bits (610), Expect = 1e-61
 Identities = 127/223 (56%), Positives = 136/223 (60%), Gaps = 31/223 (13%)
 Frame = +2

Query: 5   KSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP----PPPYKYPSPPPPVYKYKSPP 172
           KSPPPPPK+ Y Y SPPPP    + PPP YK P PP    PPP  + SPPPPVYK   PP
Sbjct: 42  KSPPPPPKQQYVYKSPPPPPVYKSPPPPVYKSPPPPVHKSPPPPVHKSPPPPVYKSPPPP 101

Query: 173 PPVYKYKSPPPPVYKYKSPPPPVYK------YKSPPPPPKK---PYKYPSPPPPVYKYNS 325
              Y YKSPPPP   +KSPPPPVYK      Y+SPPPP  K   P  Y SPPPPV+K  S
Sbjct: 102 KKPYVYKSPPPPPPVHKSPPPPVYKSPPPPVYESPPPPVYKSPPPPVYKSPPPPVHK--S 159

Query: 326 PPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK------YKSPPPPA-KKPYKYPS 481
           PPPP YK P PP  PY Y SPPPP   +KSPPPPVYK      +KSPP P  K P     
Sbjct: 160 PPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPTPPVHKSPPHPVYKSPLPVHK 219

Query: 482 PPPPVYK----------YKSPPPPVYSPPPPVYKYKSPPPPVY 580
            PPPVYK          YKSPPPPV   PPP Y Y SPPPP +
Sbjct: 220 SPPPVYKSPPPPKKPYVYKSPPPPVKKHPPPHYIYSSPPPPYH 262

 Score =  194 bits (492), Expect = 6e-48
 Identities = 113/195 (57%), Positives = 119/195 (61%), Gaps = 44/195 (22%)
 Frame = +2

Query: 2   YKSPPPPPKK---PYKYPSPPPPVYKYNSPPPP---YKYPSPPPPPYKYPSPPPPVYK-- 157
           YKSPPPP  K   P  + SPPPPVYK  SPPPP   Y Y SPPPPP  + SPPPPVYK  
Sbjct: 71  YKSPPPPVHKSPPPPVHKSPPPPVYK--SPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSP 128

Query: 158 ----YKSPPPPVYK------YKSPPPPVYK------YKSPPPPV--YKYKSPPPPP---K 274
               Y+SPPPPVYK      YKSPPPPV+K      YKSPPPP   Y YKSPPPPP   K
Sbjct: 129 PPPVYESPPPPVYKSPPPPVYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHK 188

Query: 275 KP----YKYP------SPPPPVYK-----YNSPPPPYKYPSPPPPPYKYPSPPPPVYKYK 409
            P    YK P      SPP PVYK     + SPPP YK P PP  PY Y SPPPPV K+ 
Sbjct: 189 SPPPPVYKSPTPPVHKSPPHPVYKSPLPVHKSPPPVYKSPPPPKKPYVYKSPPPPVKKH- 247

Query: 410 SPPPPVYKYKSPPPP 454
             PPP Y Y SPPPP
Sbjct: 248 --PPPHYIYSSPPPP 260

 Score =  164 bits (416), Expect = 4e-39
 Identities = 95/173 (54%), Positives = 100/173 (57%), Gaps = 48/173 (27%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPP----PPPYKYPSPPPPVYK--- 157
           YKSPPPP KKPY Y SPPPP   + SPPPP YK P PP    PPP  Y SPPPPVYK   
Sbjct: 95  YKSPPPP-KKPYVYKSPPPPPPVHKSPPPPVYKSPPPPVYESPPPPVYKSPPPPVYKSPP 153

Query: 158 ---YKSPPPPVYK----------YKSPPPPVYKYKSPPPPVYK--------------YKS 256
              +KSPPPPVYK          YKSPPPP   +KSPPPPVYK              YKS
Sbjct: 154 PPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPTPPVHKSPPHPVYKS 213

Query: 257 P-------------PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKY 376
           P             PPPPKKPY Y SPPPPV K+  PPP Y Y SPP PPY +
Sbjct: 214 PLPVHKSPPPVYKSPPPPKKPYVYKSPPPPVKKH--PPPHYIYSSPP-PPYHH 263

[30][TOP]
>UniRef100_Q2A9D1 Extensin-like region containing protein n=1 Tax=Brassica oleracea
            RepID=Q2A9D1_BRAOL
          Length = 543

 Score =  241 bits (616), Expect = 2e-62
 Identities = 139/268 (51%), Positives = 141/268 (52%), Gaps = 74/268 (27%)
 Frame = +2

Query: 2    YKSPPPP---------------PKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPP 118
            YKSPPPP               PK  YK P PPPP Y      +Y SPPPPY Y SPPPP
Sbjct: 250  YKSPPPPYVCSSPPPPPYYSPSPKVDYKSPPPPPPYYSPSPKFEYKSPPPPYVYSSPPPP 309

Query: 119  PYKYPSP------PPPVYKYKSPPPPVY-------KYKSPPPPVYKYKSPPPPVYK---- 247
            PY  PSP      PPP Y Y SPPPP Y        YKSPPPP Y Y SPPPP Y     
Sbjct: 310  PYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPPYYSPSP 368

Query: 248  ---YKSPPPPPKKPYKYPSPPPPVYK-------YNSPPPPYKYPSPPPPPYKYPSP---- 385
               YKSPPPP    Y Y SPPPP Y        Y SPPPPY Y SPPPPPY  PSP    
Sbjct: 369  KVYYKSPPPP----YVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPPPPPYYSPSPKVNY 424

Query: 386  --PPPVYKYKSPPPPVY-------KYKSPPPP------AKKPYKYPSP------PPPVYK 502
              PPP Y Y SPPPP Y        YKSPPPP         P+  PSP      PPP Y 
Sbjct: 425  KSPPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYVHSSPPPPPFYSPSPKAEYKSPPPPYV 484

Query: 503  YKSPPPPVYSPPPPVYKYKSPPPP-VYS 583
            Y SPPPP Y  P P   YKSPPPP VYS
Sbjct: 485  YSSPPPPPYYSPSPKVDYKSPPPPYVYS 512

 Score =  241 bits (615), Expect = 3e-62
 Identities = 141/270 (52%), Positives = 145/270 (53%), Gaps = 77/270 (28%)
 Frame = +2

Query: 2    YKSPPPPPK--------------KPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPP 118
            YKSPPPPP                PY Y SPPPP Y       +Y SPPPPY Y SPPPP
Sbjct: 276  YKSPPPPPPYYSPSPKFEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPP 335

Query: 119  PYKYPSP------PPPVYKYKSPPPPVYK-------YKSPPPPVYKYKSPPPPVYK---- 247
            PY  PSP      PPP Y Y SPPPP Y        YKSPPPP Y Y SPPPP Y     
Sbjct: 336  PYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPP-YVYSSPPPPPYYSPSP 394

Query: 248  ---YKSPPPPPKKPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSP---- 385
               YKSPPPP    Y Y SPPPP Y        Y SPPPPY Y SPPPPPY  PSP    
Sbjct: 395  KMVYKSPPPP----YVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYYSPSPKVNY 450

Query: 386  --PPPVYKYKSPPPPVY-------KYKSPPPPAKKPYKYPSPPPPVY-------KYKSPP 517
              PPP Y + SPPPP +       +YKSPPPP    Y Y SPPPP Y        YKSPP
Sbjct: 451  KSPPPPYVHSSPPPPPFYSPSPKAEYKSPPPP----YVYSSPPPPPYYSPSPKVDYKSPP 506

Query: 518  PP-VYS--PPPPVYK------YKSPPPPVY 580
            PP VYS  PPPP Y       YKSPPPP Y
Sbjct: 507  PPYVYSSPPPPPYYSPSPKVYYKSPPPPPY 536

 Score =  241 bits (614), Expect = 4e-62
 Identities = 139/275 (50%), Positives = 141/275 (51%), Gaps = 82/275 (29%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSP------P 142
           YKSPPPP    Y Y SPPPP Y       +Y SPPPPY Y SPPPPPY  PSP      P
Sbjct: 146 YKSPPPP----YVYNSPPPPPYYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSP 201

Query: 143 PPVYKYKSPPPPVY-------KYKSPPPPVYKYKSPPPPVY-------KYKSPPPP---- 268
            P Y Y SPPPP Y        YKSPPPP Y Y SPPPP Y        YKSPPPP    
Sbjct: 202 QPPYVYSSPPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPPYYSPSPKVDYKSPPPPYVCS 260

Query: 269 -----------PKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPPPYKYPSP---- 385
                      PK  YK P PPPP Y      +Y SPPPPY Y SPPPPPY  PSP    
Sbjct: 261 SPPPPPYYSPSPKVDYKSPPPPPPYYSPSPKFEYKSPPPPYVYSSPPPPPYYSPSPKVEY 320

Query: 386 --PPPVYKYKSPPPPVY-------KYKSPPPP------AKKPYKYPSP------PPPVYK 502
             PPP Y Y SPPPP Y        YKSPPPP         PY  PSP      PPP Y 
Sbjct: 321 KSPPPPYVYNSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPYV 380

Query: 503 YKSPPPP---------VYSPPPPVYKYKSPPPPVY 580
           Y SPPPP         VY  PPP Y Y SPPPP Y
Sbjct: 381 YSSPPPPPYYSPSPKMVYKSPPPPYVYSSPPPPPY 415

 Score =  237 bits (605), Expect = 4e-61
 Identities = 136/277 (49%), Positives = 139/277 (50%), Gaps = 86/277 (31%)
 Frame = +2

Query: 2    YKSPPPPP-------------KKPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPPP 121
            Y SPPPPP             + PY Y SPPPP Y        Y SPPPPY Y SPPPPP
Sbjct: 181  YSSPPPPPYYSPSPKVEYKSPQPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPP 240

Query: 122  YKYPSP------PPPVYKYKSPPPPVY-------KYKSPPPPV--------YKYKSPPPP 238
            Y  PSP      PPP Y   SPPPP Y        YKSPPPP         ++YKSPPPP
Sbjct: 241  YYSPSPKVDYKSPPPPYVCSSPPPPPYYSPSPKVDYKSPPPPPPYYSPSPKFEYKSPPPP 300

Query: 239  VYKYKSPPPPP-------------KKPYKYPSPPPPVY-------KYNSPPPPYKYPSPP 358
             Y Y SPPPPP               PY Y SPPPP Y        Y SPPPPY Y SPP
Sbjct: 301  -YVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKVDYKSPPPPYVYSSPP 359

Query: 359  PPPYKYPSP------PPPVYKYKSPPPPVYK-------YKSPPPP------AKKPYKYPS 481
            PPPY  PSP      PPP Y Y SPPPP Y        YKSPPPP         PY  PS
Sbjct: 360  PPPYYSPSPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPPPPPYYSPS 419

Query: 482  P------PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            P      PPP Y Y SPPPP Y  P P   YKSPPPP
Sbjct: 420  PKVNYKSPPPPYVYSSPPPPPYYSPSPKVNYKSPPPP 456

 Score =  236 bits (603), Expect = 7e-61
 Identities = 136/250 (54%), Positives = 139/250 (55%), Gaps = 56/250 (22%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSP------P 142
           YKSPPPP    Y Y SPPPP Y       +Y SPPPPY Y SPPPPPY  PSP      P
Sbjct: 120 YKSPPPP----YVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKAEYKSP 175

Query: 143 PPVYKYKSPPPPVY-------KYKSPPPPVYKYKSPPPPVY-------KYKSPPPPPKKP 280
           PP Y Y SPPPP Y       +YKSP PP Y Y SPPPP Y        YKSPPPP    
Sbjct: 176 PPPYVYSSPPPPPYYSPSPKVEYKSPQPP-YVYSSPPPPPYYSPSPKVDYKSPPPP---- 230

Query: 281 YKYPSPPPPVY-------KYNSPPPPYKYPSPPPPPY---------KYPSPPPPVY---- 400
           Y Y SPPPP Y        Y SPPPPY   SPPPPPY         K P PPPP Y    
Sbjct: 231 YVYSSPPPPPYYSPSPKVDYKSPPPPYVCSSPPPPPYYSPSPKVDYKSPPPPPPYYSPSP 290

Query: 401 --KYKSPPPPVYKYKSPPPPAKKPYKYPSP------PPPVYKYKSPPPPVYSPPPPVYKY 556
             +YKSPPPP Y Y SPPPP   PY  PSP      PPP Y Y SPPPP Y  P P   Y
Sbjct: 291 KFEYKSPPPP-YVYSSPPPP---PYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKVDY 346

Query: 557 KSPPPP-VYS 583
           KSPPPP VYS
Sbjct: 347 KSPPPPYVYS 356

 Score =  221 bits (564), Expect = 2e-56
 Identities = 126/237 (53%), Positives = 128/237 (54%), Gaps = 54/237 (22%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSP------P 142
           YKSPPPP    Y Y SPPPP Y        Y SPPPPY Y SPPPPPY  PSP      P
Sbjct: 320 YKSPPPP----YVYNSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSP 375

Query: 143 PPVYKYKSPPPPVYK-------YKSPPPPVYKYKSPPPPVY-------KYKSPPPPPKKP 280
           PP Y Y SPPPP Y        YKSPPPP Y Y SPPPP Y        YKSPPPP    
Sbjct: 376 PPPYVYSSPPPPPYYSPSPKMVYKSPPPP-YVYSSPPPPPYYSPSPKVNYKSPPPP---- 430

Query: 281 YKYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSP------PPPVYKYKSPPP 421
           Y Y SPPPP Y        Y SPPPPY + SPPPPP+  PSP      PPP Y Y SPPP
Sbjct: 431 YVYSSPPPPPYYSPSPKVNYKSPPPPYVHSSPPPPPFYSPSPKAEYKSPPPPYVYSSPPP 490

Query: 422 PVY-------KYKSPPPPAKKPYKYPSPPPPVYK-------YKSPPPPVYSPPPPVY 550
           P Y        YKSPPPP    Y Y SPPPP Y        YKSPPPP Y    P Y
Sbjct: 491 PPYYSPSPKVDYKSPPPP----YVYSSPPPPPYYSPSPKVYYKSPPPPPYVYKMPYY 543

 Score =  218 bits (555), Expect = 3e-55
 Identities = 122/224 (54%), Positives = 127/224 (56%), Gaps = 33/224 (14%)
 Frame = +2

Query: 2   YKSPPPPPK-------------KPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPPP 121
           Y +PP PP              KPY Y SPPP  Y       +Y SPPPPY Y SPPPPP
Sbjct: 51  YSAPPSPPPQYRRQGPKYTPHPKPYIYSSPPPSSYYSPSPKVEYKSPPPPYVYSSPPPPP 110

Query: 122 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPVY-------KYKSPPPPVYKYKSPPPPPKKP 280
           Y  PSP      YKSPPPP Y Y SPPPP Y       +YKSPPPP Y Y SPPPPP   
Sbjct: 111 YYSPSPK---VDYKSPPPP-YVYSSPPPPPYYSPSPKVEYKSPPPP-YVYNSPPPPP--- 162

Query: 281 YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK 460
             Y SP P   +Y SPPPPY Y SPPPPPY  PSP     +YKSP PP Y Y SPPPP  
Sbjct: 163 --YYSPSPKA-EYKSPPPPYVYSSPPPPPYYSPSPK---VEYKSPQPP-YVYSSPPPP-- 213

Query: 461 KPYKYPSP------PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            PY  PSP      PPP Y Y SPPPP Y  P P   YKSPPPP
Sbjct: 214 -PYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPP 256

 Score =  205 bits (521), Expect = 2e-51
 Identities = 138/308 (44%), Positives = 145/308 (47%), Gaps = 117/308 (37%)
 Frame = +2

Query: 2   YKSPPPPPKKP--YKYPSPPPPVYKYNSP--------PPPYK--------------YPSP 109
           Y+SPP   K P  +K  SP PP  K NSP        PP Y+              Y SP
Sbjct: 23  YESPPTTQKYPPVHKTKSPYPP--KMNSPYYSAPPSPPPQYRRQGPKYTPHPKPYIYSSP 80

Query: 110 ----------------PPPPYKYPSPPPPVY-------KYKSPPPPVYKYKSPPPPVY-- 214
                           PPPPY Y SPPPP Y        YKSPPPP Y Y SPPPP Y  
Sbjct: 81  PPSSYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPPYYS 139

Query: 215 -----KYKSPPPPVYKYKSPPPP-------------PKKPYKYPSPPPPVY-------KY 319
                +YKSPPPP Y Y SPPPP             P  PY Y SPPPP Y       +Y
Sbjct: 140 PSPKVEYKSPPPP-YVYNSPPPPPYYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVEY 198

Query: 320 NSPPPPYKYPSPPPPPYKYPSP------PPPVYKYKSPPPPVY-------KYKSPPPP-- 454
            SP PPY Y SPPPPPY  PSP      PPP Y Y SPPPP Y        YKSPPPP  
Sbjct: 199 KSPQPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYV 258

Query: 455 -------------AKKPYKYPSPPPPVY------KYKSPPPP-VYS--PPPPVY------ 550
                         K  YK P PPPP Y      +YKSPPPP VYS  PPPP Y      
Sbjct: 259 CSSPPPPPYYSPSPKVDYKSPPPPPPYYSPSPKFEYKSPPPPYVYSSPPPPPYYSPSPKV 318

Query: 551 KYKSPPPP 574
           +YKSPPPP
Sbjct: 319 EYKSPPPP 326

 Score =  203 bits (516), Expect = 9e-51
 Identities = 128/268 (47%), Positives = 131/268 (48%), Gaps = 88/268 (32%)
 Frame = +2

Query: 35  YKYPSPP-----PPVYKYNSPPPP------YKYPSPPPP--------------PYKYPSP 139
           Y Y SPP     PPV+K  SP PP      Y  P  PPP              PY Y SP
Sbjct: 21  YPYESPPTTQKYPPVHKTKSPYPPKMNSPYYSAPPSPPPQYRRQGPKYTPHPKPYIYSSP 80

Query: 140 PP-------PVYKYKSPPPPVYKYKSPPPPVY-------KYKSPPPPVYKYKSPPPP--- 268
           PP       P  +YKSPPPP Y Y SPPPP Y        YKSPPPP Y Y SPPPP   
Sbjct: 81  PPSSYYSPSPKVEYKSPPPP-YVYSSPPPPPYYSPSPKVDYKSPPPP-YVYSSPPPPPYY 138

Query: 269 ----------PKKPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSP---- 385
                     P  PY Y SPPPP Y       +Y SPPPPY Y SPPPPPY  PSP    
Sbjct: 139 SPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVEY 198

Query: 386 --PPPVYKYKSPPPPVY-------KYKSPPPPAKKPYKYPSPPPPVY-------KYKSPP 517
             P P Y Y SPPPP Y        YKSPPP    PY Y SPPPP Y        YKSPP
Sbjct: 199 KSPQPPYVYSSPPPPPYYSPSPKVDYKSPPP----PYVYSSPPPPPYYSPSPKVDYKSPP 254

Query: 518 PPVY--SPPPPVY-------KYKSPPPP 574
           PP    SPPPP Y        YKSPPPP
Sbjct: 255 PPYVCSSPPPPPYYSPSPKVDYKSPPPP 282

 Score = 74.7 bits (182), Expect = 5e-12
 Identities = 57/119 (47%), Positives = 59/119 (49%), Gaps = 28/119 (23%)
 Frame = +2

Query: 311 YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK-SPPP----------PA 457
           Y Y SPP   KYP    P +K  SP PP  K  SP    Y    SPPP          P 
Sbjct: 21  YPYESPPTTQKYP----PVHKTKSPYPP--KMNSP---YYSAPPSPPPQYRRQGPKYTPH 71

Query: 458 KKPYKYPSPPP-------PVYKYKSPPPP-VYS--PPPPVYK------YKSPPPP-VYS 583
            KPY Y SPPP       P  +YKSPPPP VYS  PPPP Y       YKSPPPP VYS
Sbjct: 72  PKPYIYSSPPPSSYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYS 130

[31][TOP]
>UniRef100_Q43682 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q43682_VIGUN
          Length = 280

 Score =  241 bits (614), Expect = 4e-62
 Identities = 140/240 (58%), Positives = 141/240 (58%), Gaps = 49/240 (20%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV- 151
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP  
Sbjct: 44  YKSPPPPSPSPPPPYVYKSPPPPS---PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSP 100

Query: 152 -----YKYKSPPPPV------YKYKSPPPPV-YKYKSPPPPV------YKYKSPPPP--- 268
                Y YKSPPPP       Y YKSPPPP  Y YKSPPPP       Y YKSPPPP   
Sbjct: 101 SPPPPYVYKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPS 160

Query: 269 PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV------YKYKS 412
           P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP       Y YKS
Sbjct: 161 PPPPYVYKSPPPPS---PSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKS 217

Query: 413 P------PPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           P      PPP Y YKSPPPP+      PSPPPP Y YKSPPPP  SPPPP Y YKSPPPP
Sbjct: 218 PPPPSPSPPPPYVYKSPPPPS------PSPPPP-YVYKSPPPPSPSPPPP-YVYKSPPPP 269

 Score =  237 bits (604), Expect = 6e-61
 Identities = 137/232 (59%), Positives = 138/232 (59%), Gaps = 43/232 (18%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP------ 169
           SP PPP  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSP      
Sbjct: 3   SPSPPP--PYVYKSPPPPS---PSPPPPYVYKSPPPPS---PSPPPP-YVYKSPPPPSPS 53

Query: 170 PPPVYKYKSP------PPPVYKYKSP------PPPVYKYKSPPPP---PKKPYKYPSPPP 304
           PPP Y YKSP      PPP Y YKSP      PPP Y YKSPPPP   P  PY Y SPPP
Sbjct: 54  PPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPP 113

Query: 305 PVYKYNSPPPPYKYPSPPPPP---YKYPSP----PPPVYKYKSP------PPPVYKYKSP 445
           P     SPPPPY Y SPPPPP   YK P P    PPP Y YKSP      PPP Y YKSP
Sbjct: 114 P---SPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSP 170

Query: 446 PPPAKKP-----YKYPSP----PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           PPP+  P     YK P P    PPP Y YKSPPPP  SPPPP Y YKSPPPP
Sbjct: 171 PPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPP-YVYKSPPPP 221

 Score =  236 bits (603), Expect = 7e-61
 Identities = 142/256 (55%), Positives = 143/256 (55%), Gaps = 65/256 (25%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV- 151
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP  
Sbjct: 28  YKSPPPPSPSPPPPYVYKSPPPPS---PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSP 84

Query: 152 -----YKYKSPPPPV------YKYKSPPPPV------YKYKSPPPPV-YKYKSPPPP--- 268
                Y YKSPPPP       Y YKSPPPP       Y YKSPPPP  Y YKSPPPP   
Sbjct: 85  SPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPS 144

Query: 269 PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV------YKYKS 412
           P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP       Y YKS
Sbjct: 145 PPPPYVYKSPPPPS---PSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKS 201

Query: 413 PPPPV------YKYKSPPPPAKKP-----YKYPSPP----PPVYKYKSPPPPVYSPPPPV 547
           PPPP       Y YKSPPPP+  P     YK P PP    PP Y YKSPPPP  SPPPP 
Sbjct: 202 PPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPP- 260

Query: 548 YKYK-------SPPPP 574
           Y YK       SPPPP
Sbjct: 261 YVYKSPPPPSPSPPPP 276

 Score =  236 bits (601), Expect = 1e-60
 Identities = 142/254 (55%), Positives = 143/254 (56%), Gaps = 63/254 (24%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPP-VYK-----YNSPPPPYKYPSP------PPPPYKYPSP-- 139
           YKSPPPP       PSPPPP VYK       SPPPPY Y SP      PPPPY Y SP  
Sbjct: 12  YKSPPPPS------PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPP 65

Query: 140 ----PPPVYKYKSP------PPPVYKYKSP------PPPVYKYKSP------PPPVYKYK 253
               PPP Y YKSP      PPP Y YKSP      PPP Y YKSP      PPP Y YK
Sbjct: 66  PSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYK 125

Query: 254 SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSP------PPPV 397
           SPPPPP  PY Y SPPPP     SPPPPY Y SP      PPPPY Y SP      PPP 
Sbjct: 126 SPPPPP--PYVYKSPPPP---SPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPP 180

Query: 398 YKYKSP------PPPVYKYKSPPPPAKKP-----YKYPSP----PPPVYKYKSPPPPVYS 532
           Y YKSP      PPP Y YKSPPPP+  P     YK P P    PPP Y YKSPPPP  S
Sbjct: 181 YIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPS 240

Query: 533 PPPPVYKYKSPPPP 574
           PPPP Y YKSPPPP
Sbjct: 241 PPPP-YVYKSPPPP 253

 Score =  213 bits (541), Expect = 1e-53
 Identities = 123/205 (60%), Positives = 124/205 (60%), Gaps = 30/205 (14%)
 Frame = +2

Query: 50  PPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP-VYKYKS 226
           PP P     SPPPPY Y SPPPP    PSPPPP Y YKSPPPP     SPPPP VYK   
Sbjct: 1   PPSP-----SPPPPYVYKSPPPPS---PSPPPP-YVYKSPPPPS---PSPPPPYVYKSPP 48

Query: 227 P----PPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPP 367
           P    PPP Y YKSPPPP   P  PY Y SPPPP     SPPPPY Y SP      PPPP
Sbjct: 49  PPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPP---SPSPPPPYVYKSPPPPSPSPPPP 105

Query: 368 YKYPSP------PPPVYKYKS-PPPPVYKYKSPPPPAKKP-----YKYPSP----PPPVY 499
           Y Y SP      PPP Y YKS PPPP Y YKSPPPP+  P     YK P P    PPP Y
Sbjct: 106 YVYKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPY 165

Query: 500 KYKSPPPPVYSPPPPVYKYKSPPPP 574
            YKSPPPP  SPPPP Y YKSPPPP
Sbjct: 166 VYKSPPPPSPSPPPP-YIYKSPPPP 189

 Score =  128 bits (322), Expect = 3e-28
 Identities = 79/142 (55%), Positives = 79/142 (55%), Gaps = 27/142 (19%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV- 151
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP  
Sbjct: 151 YKSPPPPSPSPPPPYVYKSPPPPS---PSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSP 207

Query: 152 -----YKYKSPPPPV------YKYKSPPPPV------YKYKSPPPPVYKYKSPPPPPKKP 280
                Y YKSPPPP       Y YKSPPPP       Y YKSPPPP     SPPP    P
Sbjct: 208 SPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPS-P--SPPP----P 260

Query: 281 YKYPSPPPPVYKYNSPPPPYKY 346
           Y Y SPPPP     SPPPPY Y
Sbjct: 261 YVYKSPPPP---SPSPPPPYVY 279

[32][TOP]
>UniRef100_B9IAD8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IAD8_POPTR
          Length = 379

 Score =  241 bits (614), Expect = 4e-62
 Identities = 138/242 (57%), Positives = 143/242 (59%), Gaps = 51/242 (21%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           YKSPPPP   P  PY+Y SPPPP    +SPPPPY Y SPPPP    PSPPPP Y YKSPP
Sbjct: 97  YKSPPPPSPSPPPPYEYKSPPPPS---SSPPPPYIYKSPPPPS---PSPPPP-YVYKSPP 149

Query: 173 PPV------YKYKSPPPPV------YKYKSPPPPV------YKYKSPPPP---PKKPYKY 289
           PP       Y YKSPPPP       Y YKSPPPP       Y YKSPPPP   P  PY Y
Sbjct: 150 PPSPSPPPPYIYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSSSPPPPYYY 209

Query: 290 PSPPPPVYKYNSPPPPYKYPSPPP------PPYKYPSPPPP------VYKYKSPPPPV-- 427
            SP PP    +SPPPPY Y SPPP      PPY Y SPPPP       Y YKSPPPP   
Sbjct: 210 KSPSPPS---SSPPPPYYYKSPPPLSPSPPPPYYYKSPPPPDPSPPPPYHYKSPPPPSPS 266

Query: 428 ----YKYKSPPPPAKKP---YKYPSPPPPV------YKYKSPPPPVYSPPPPVYKYKSPP 568
               Y Y+SPPPP+  P   Y Y SPPPP       Y YKSPPPP  SPPPP Y YKSPP
Sbjct: 267 PPPPYYYRSPPPPSSSPPPPYHYSSPPPPSPSPPPPYYYKSPPPPSPSPPPPYY-YKSPP 325

Query: 569 PP 574
           PP
Sbjct: 326 PP 327

 Score =  238 bits (608), Expect = 2e-61
 Identities = 144/266 (54%), Positives = 147/266 (55%), Gaps = 75/266 (28%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPP------VYKYNSPPPPYKYPSPPPPP-YKYPSP---- 139
           YKSPPPP   P  PY+Y SPPPP       Y Y SPPPP   PSPPPP  YK P P    
Sbjct: 49  YKSPPPPSPSPPPPYEYKSPPPPSPHPPPTYVYKSPPPPS--PSPPPPYIYKSPPPPSPS 106

Query: 140 PPPVYKYKSP------PPPVYKYKSP------PPPVYKYKSP------PPPVYKYKSPPP 265
           PPP Y+YKSP      PPP Y YKSP      PPP Y YKSP      PPP Y YKSPPP
Sbjct: 107 PPPPYEYKSPPPPSSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPP 166

Query: 266 P---PKKPYKYPSP------PPPVYKYNSPPPP---------YKYPSP----PPPPYKYP 379
           P   P  PY Y SP      PPP Y Y SPPPP         YK PSP    PPPPY Y 
Sbjct: 167 PSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSSSPPPPYYYKSPSPPSSSPPPPYYYK 226

Query: 380 SP------PPPVYKYKSP------PPPVYKYKSPPPPAKK---PYKYPSP------PPPV 496
           SP      PPP Y YKSP      PPP Y YKSPPPP+     PY Y SP      PPP 
Sbjct: 227 SPPPLSPSPPPPYYYKSPPPPDPSPPPPYHYKSPPPPSPSPPPPYYYRSPPPPSSSPPPP 286

Query: 497 YKYKSPPPPVYSPPPPVYKYKSPPPP 574
           Y Y SPPPP  SPPPP Y YKSPPPP
Sbjct: 287 YHYSSPPPPSPSPPPPYY-YKSPPPP 311

 Score =  237 bits (605), Expect = 4e-61
 Identities = 136/244 (55%), Positives = 141/244 (57%), Gaps = 51/244 (20%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV- 151
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP  
Sbjct: 145 YKSPPPPSPSPPPPYIYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSS 201

Query: 152 -----YKYKSP------PPPVYKYKSPPP------PVYKYKSP------PPPVYKYKSPP 262
                Y YKSP      PPP Y YKSPPP      P Y YKSP      PPP Y YKSPP
Sbjct: 202 SPPPPYYYKSPSPPSSSPPPPYYYKSPPPLSPSPPPPYYYKSPPPPDPSPPPPYHYKSPP 261

Query: 263 PP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP------ 415
           PP   P  PY Y SPPPP    +SPPPPY Y SPPPP    PSPPPP Y YKSP      
Sbjct: 262 PPSPSPPPPYYYRSPPPP---SSSPPPPYHYSSPPPPS---PSPPPPYY-YKSPPPPSPS 314

Query: 416 PPPVYKYKSPPPPAKKP-----YKYPSP----PPPVYKYKSPPPPVYSPPPPVYKYKSPP 568
           PPP Y YKSPPPP+  P     YK P P    PPP Y Y SPPP + SPP  VY Y SPP
Sbjct: 315 PPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYHSPPPAMKSPPLSVYIYASPP 374

Query: 569 PPVY 580
           PP++
Sbjct: 375 PPIH 378

 Score =  225 bits (573), Expect = 2e-57
 Identities = 131/222 (59%), Positives = 134/222 (60%), Gaps = 42/222 (18%)
 Frame = +2

Query: 35  YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSP------PPPVYKYKSP------PPP 178
           Y Y SPPPP Y Y SPPPP   PS PPPPY+Y SP      PPP Y YKSP      PPP
Sbjct: 38  YVYSSPPPP-YVYKSPPPP--SPS-PPPPYEYKSPPPPSPHPPPTYVYKSPPPPSPSPPP 93

Query: 179 VYKYKSP------PPPVYKYKSP------PPPVYKYKSPPPP---PKKPYKYPSPPPPVY 313
            Y YKSP      PPP Y+YKSP      PPP Y YKSPPPP   P  PY Y SPPPP  
Sbjct: 94  PYIYKSPPPPSPSPPPPYEYKSPPPPSSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPP-- 151

Query: 314 KYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP------PPPVYKYKSPPPPAKKP--- 466
              SPPPPY Y SPPPP    PSPPPP Y YKSP      PPP Y YKSPPPP+  P   
Sbjct: 152 -SPSPPPPYIYKSPPPPS---PSPPPPYY-YKSPPPPSPSPPPPYVYKSPPPPSSSPPPP 206

Query: 467 --YKYPSP----PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
             YK PSP    PPP Y YKSPPP   SPPPP Y YKSPPPP
Sbjct: 207 YYYKSPSPPSSSPPPPYYYKSPPPLSPSPPPPYY-YKSPPPP 247

[33][TOP]
>UniRef100_Q2A9D2 Extensin-like region containing protein n=1 Tax=Brassica oleracea
           RepID=Q2A9D2_BRAOL
          Length = 347

 Score =  240 bits (612), Expect = 7e-62
 Identities = 139/256 (54%), Positives = 143/256 (55%), Gaps = 63/256 (24%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSP------P 142
           YKSPPPP    Y Y SPPPP Y       +Y SPPPPY Y SPPPPPY  PSP      P
Sbjct: 98  YKSPPPP----YVYSSPPPPPYYSPSLKVEYKSPPPPYLYNSPPPPPYYSPSPKAEYKSP 153

Query: 143 PPVYKYKSPPPPVY-------KYKSPPPPVYKYKSPPPPVY-------KYKSPPPPPKKP 280
           PP Y Y  PPPP Y       +YKSPPPP Y Y SPPPP Y       +YKS PPP    
Sbjct: 154 PPPYVYSYPPPPPYYSPSPKVEYKSPPPP-YVYSSPPPPPYYSPSPKVEYKSQPPP---- 208

Query: 281 YKYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSP------PPPVYKYKSPPP 421
           Y Y SPPPP Y       +Y SPPPPY Y SPPPPPY  PSP      PPP Y Y SPPP
Sbjct: 209 YVYNSPPPPPYYSPLPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPP 268

Query: 422 PVY-------KYKSPPPPAKKPYKYPSPPPPVY-------KYKSPPPP-VYS--PPPPVY 550
           P Y        YKSPPPP    Y Y SPPPP Y        YKSPPPP VYS  PPPP Y
Sbjct: 269 PPYYSPSPKVDYKSPPPP----YVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYY 324

Query: 551 K------YKSPPPPVY 580
                  YKSPPPP Y
Sbjct: 325 SPSPKVYYKSPPPPPY 340

 Score =  222 bits (565), Expect = 2e-56
 Identities = 126/237 (53%), Positives = 129/237 (54%), Gaps = 54/237 (22%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSP------P 142
           YKSPPPP    Y Y SPPPP Y       +Y SPPPPY Y  PPPPPY  PSP      P
Sbjct: 124 YKSPPPP----YLYNSPPPPPYYSPSPKAEYKSPPPPYVYSYPPPPPYYSPSPKVEYKSP 179

Query: 143 PPVYKYKSPPPPVY-------KYKSPPPPVYKYKSPPPPVY-------KYKSPPPPPKKP 280
           PP Y Y SPPPP Y       +YKS PPP Y Y SPPPP Y       +YKSPPPP    
Sbjct: 180 PPPYVYSSPPPPPYYSPSPKVEYKSQPPP-YVYNSPPPPPYYSPLPKVEYKSPPPP---- 234

Query: 281 YKYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSP------PPPVYKYKSPPP 421
           Y Y SPPPP Y        Y SPPPPY Y SPPPPPY  PSP      PPP Y Y SPPP
Sbjct: 235 YVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPP 294

Query: 422 PVY-------KYKSPPPPAKKPYKYPSPPPPVYK-------YKSPPPPVYSPPPPVY 550
           P Y        YKSPPPP    Y Y SPPPP Y        YKSPPPP Y    P Y
Sbjct: 295 PPYYSPSPKVDYKSPPPP----YVYSSPPPPPYYSPSPKVYYKSPPPPPYVYKKPYY 347

 Score =  214 bits (546), Expect = 3e-54
 Identities = 130/231 (56%), Positives = 134/231 (58%), Gaps = 37/231 (16%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           Y SPP PP     Y SP P V  Y SPPPPY Y SPPPPPY  PS      +YKSPPPP 
Sbjct: 81  YSSPPLPP-----YYSPSPKV-DYKSPPPPYVYSSPPPPPYYSPSLK---VEYKSPPPP- 130

Query: 182 YKYKSPPPPVY-------KYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY 340
           Y Y SPPPP Y       +YKSPPPP Y Y  PPPPP     Y SP P V +Y SPPPPY
Sbjct: 131 YLYNSPPPPPYYSPSPKAEYKSPPPP-YVYSYPPPPP-----YYSPSPKV-EYKSPPPPY 183

Query: 341 KYPSPPPPPYKYPSPP------PPVYKYKSPPPPVY-------KYKSPPPPAKKPYKYPS 481
            Y SPPPPPY  PSP       PP Y Y SPPPP Y       +YKSPPPP    Y Y S
Sbjct: 184 VYSSPPPPPYYSPSPKVEYKSQPPPYVYNSPPPPPYYSPLPKVEYKSPPPP----YVYSS 239

Query: 482 PPPPVY-------KYKSPPPP-VYS--PPPPVYK------YKSPPPP-VYS 583
           PPPP Y        YKSPPPP VYS  PPPP Y       YKSPPPP VYS
Sbjct: 240 PPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYS 290

[34][TOP]
>UniRef100_Q9STN1 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STN1_ARATH
          Length = 350

 Score =  239 bits (610), Expect = 1e-61
 Identities = 125/226 (55%), Positives = 133/226 (58%), Gaps = 33/226 (14%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP--YKYPSPPPPPYKYPSPPPPVYKYKSPPP 175
           YKSPPP    PY Y SPPPP Y YNSPPPP  Y Y SPP PPY Y SPPPP + Y SPPP
Sbjct: 52  YKSPPP---SPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPP 108

Query: 176 PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP-------PKKPYKYPSPPPPVYKYNS--- 325
           P Y Y SPPPP Y YKS P   + Y SPPPP       P+ P+ Y SPPPP Y YNS   
Sbjct: 109 PTYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPR 168

Query: 326 --------PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPS 481
                   PPPPY Y SPPPPPY Y S P   + Y SPPPP Y Y S P   + P+ Y S
Sbjct: 169 VLFIYSSPPPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAP---RIPFIYSS 225

Query: 482 PPPPVYKYKSPP--PPVYSPPPP---VYK--------YKSPPPPVY 580
           PPPP Y Y S P  P +YS PPP   VYK        Y SPPPP Y
Sbjct: 226 PPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPPPY 271

 Score =  234 bits (598), Expect = 3e-60
 Identities = 121/221 (54%), Positives = 131/221 (59%), Gaps = 30/221 (13%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPP-PYKYPSPPPPPYKYPSPPPPV-YKYKSPPPPV 181
           SP  PP +PY Y  P P  Y Y SPPP PY Y SPPPPPY Y SPPPP  Y Y SPP P 
Sbjct: 31  SPQSPPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPP 90

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPP-------PKKPYKYPSPPPPVYKYNSPPP-P 337
           Y YKSPPPP + Y SPPPP Y Y SPPPP       P+  + Y SPPPP Y YNS P  P
Sbjct: 91  YVYKSPPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYNSAPRIP 150

Query: 338 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP-------AKKPYKYPSPPPPV 496
           + Y SPPPPPY Y S P  ++ Y SPPPP Y Y SPPPP        + P+ Y SPPPP 
Sbjct: 151 FIYSSPPPPPYVYNSAPRVLFIYSSPPPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPP 210

Query: 497 YKYKSPP--PPVY-SPPPPVYK----------YKSPPPPVY 580
           Y Y S P  P +Y SPPPP Y           Y SPPPP Y
Sbjct: 211 YVYNSAPRIPFIYSSPPPPPYVYNSAPRVPFIYSSPPPPPY 251

 Score =  209 bits (532), Expect = 1e-52
 Identities = 114/215 (53%), Positives = 122/215 (56%), Gaps = 26/215 (12%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPVYKYNSP-PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV-YK 187
           P   +  Y   SPPP  Y Y+ P P PY Y SPPP PY Y SPPPP Y Y SPPPP  Y 
Sbjct: 23  PTSAQCKYSPQSPPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYI 82

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPP-PYKYPSPPPP 364
           Y SPP P Y YKSPPPP + Y SPPPP    Y Y SPPPP Y Y S P   + Y SPPPP
Sbjct: 83  YNSPPRPPYVYKSPPPPPFVYSSPPPPT---YIYNSPPPPPYVYKSVPRITFIYSSPPPP 139

Query: 365 PYK----------YPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSP 514
           PY           Y SPPPP Y Y S P  ++ Y SPPPP   PY Y SPPPP Y Y+S 
Sbjct: 140 PYVYNSAPRIPFIYSSPPPPPYVYNSAPRVLFIYSSPPPP---PYVYNSPPPPPYVYESV 196

Query: 515 P--PPVY-SPPPPVYK----------YKSPPPPVY 580
           P  P +Y SPPPP Y           Y SPPPP Y
Sbjct: 197 PRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPY 231

 Score =  202 bits (515), Expect = 1e-50
 Identities = 117/241 (48%), Positives = 128/241 (53%), Gaps = 47/241 (19%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP---YK------------------------- 97
           YKSPPPPP   + Y SPPPP Y YNSPPPP   YK                         
Sbjct: 93  YKSPPPPP---FVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYNSAPRI 149

Query: 98  ---YPSPPPPPYKY----------PSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 238
              Y SPPPPPY Y           SPPPP Y Y SPPPP Y Y+S P   + Y SPPPP
Sbjct: 150 PFIYSSPPPPPYVYNSAPRVLFIYSSPPPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPP 209

Query: 239 VYKYKSPPPPPKKPYKYPSPPPPVYKYNSPP-PPYKYPSPPPPPYKYPSPPPPVYKYKSP 415
            Y Y S    P+ P+ Y SPPPP Y YNS P  P+ Y SPPPPPY Y S P   + Y SP
Sbjct: 210 PYVYNS---APRIPFIYSSPPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVPRIPFIYSSP 266

Query: 416 PPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPP--PPVY-SPPPPVYKYKSPP--PPVY 580
           PPP Y Y S P   + P+ Y S PPP Y Y S P  P +Y SPPPP Y Y S P  P +Y
Sbjct: 267 PPPPYVYNSAP---RIPFIYSSLPPPPYVYNSAPRVPFIYSSPPPPPYVYNSAPRIPFIY 323

Query: 581 S 583
           S
Sbjct: 324 S 324

 Score =  161 bits (408), Expect = 3e-38
 Identities = 93/199 (46%), Positives = 100/199 (50%), Gaps = 49/199 (24%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNS-----------PPPPYKYPSPPPPPYK 127
           Y SPPPPP       + P+ Y SPPPP Y YNS           PPPPY Y SPPPPPY 
Sbjct: 133 YSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVLFIYSSPPPPPYVYNSPPPPPYV 192

Query: 128 Y------------PSPPPPVYK--------YKSPPPPVYKYKS----------PPPPVYK 217
           Y            P PPP VY         Y SPPPP Y Y S          PPPP Y 
Sbjct: 193 YESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVPFIYSSPPPPPYV 252

Query: 218 YKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS-PPPPYKYPSPPPPPYKYPSPPPP 394
           YKS P   + Y SPPPP   PY Y S P   + Y+S PPPPY Y S P  P+ Y SPPPP
Sbjct: 253 YKSVPRIPFIYSSPPPP---PYVYNSAPRIPFIYSSLPPPPYVYNSAPRVPFIYSSPPPP 309

Query: 395 VYKYKSPPPPVYKYKSPPP 451
            Y Y S P   + Y SPPP
Sbjct: 310 PYVYNSAPRIPFIYSSPPP 328

 Score =  129 bits (325), Expect = 1e-28
 Identities = 71/152 (46%), Positives = 80/152 (52%), Gaps = 35/152 (23%)
 Frame = +2

Query: 2   YKSPPPPP-------KKPYKYPSPPPPVYKYNSPPP-PYKYPSPPPPPYKYPSPPPPVYK 157
           Y SPPPPP       + P+ Y SPPPP Y YNS P  P+ Y SPPPPPY Y S P   + 
Sbjct: 183 YNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVPFI 242

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKS-----------PPPP------PKKPYK 286
           Y SPPPP Y YKS P   + Y SPPPP Y Y S           PPPP      P+ P+ 
Sbjct: 243 YSSPPPPPYVYKSVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSLPPPPYVYNSAPRVPFI 302

Query: 287 YPSPPPPVYKYNS----------PPPPYKYPS 352
           Y SPPPP Y YNS          PPP + + S
Sbjct: 303 YSSPPPPPYVYNSAPRIPFIYSSPPPHHMFTS 334

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 48/85 (56%), Positives = 50/85 (58%), Gaps = 6/85 (7%)
 Frame = +2

Query: 347 PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPP- 523
           P+     Y   SPPP  Y Y  P P  Y YKSPPP    PY Y SPPPP Y Y SPPPP 
Sbjct: 23  PTSAQCKYSPQSPPPQPYVYSPPLPSPYVYKSPPP---SPYLYSSPPPPPYVYNSPPPPP 79

Query: 524 --VY-SPPPPVYKYKSPPPP--VYS 583
             +Y SPP P Y YKSPPPP  VYS
Sbjct: 80  PYIYNSPPRPPYVYKSPPPPPFVYS 104

[35][TOP]
>UniRef100_Q39600 Extensin n=1 Tax=Catharanthus roseus RepID=Q39600_CATRO
          Length = 217

 Score =  237 bits (605), Expect = 4e-61
 Identities = 124/202 (61%), Positives = 129/202 (63%), Gaps = 25/202 (12%)
 Frame = +2

Query: 44  PSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYK 223
           PS     YKY+SPPPPY Y SPPPP +    PPPPVYKYKSPPPP   +KSPPPP Y YK
Sbjct: 18  PSQTTADYKYSSPPPPYHYSSPPPPVHS--PPPPPVYKYKSPPPPPPIHKSPPPPPYVYK 75

Query: 224 SPPPP--VYKYKSPPPPPK----KPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKY-- 376
           SPPPP  VYKYKSPPPPP      PY Y SPPPP   Y SPPPP YK P PP  PY Y  
Sbjct: 76  SPPPPPPVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIYKSPPPPVYKSPPPPKNPYVYKS 135

Query: 377 PSPPPPVYK------------YKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP 520
           P PPPPVYK            YKSPPPP + +KSPPPP    YK P PP   Y YKSPPP
Sbjct: 136 PPPPPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSPPPPV---YKSPPPPKKPYVYKSPPP 192

Query: 521 PV---YSPPPPV-YKYKSPPPP 574
           P     SPPPP  Y Y SPPPP
Sbjct: 193 PPPIHKSPPPPYHYYYSSPPPP 214

 Score =  223 bits (569), Expect = 7e-57
 Identities = 113/188 (60%), Positives = 120/188 (63%), Gaps = 25/188 (13%)
 Frame = +2

Query: 92  YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP 271
           YKY SPPPP Y Y SPPPPV+    PPPPVYKYKSPPPP   +KSPPPP Y YKSPPPPP
Sbjct: 25  YKYSSPPPP-YHYSSPPPPVHS--PPPPPVYKYKSPPPPPPIHKSPPPPPYVYKSPPPPP 81

Query: 272 KK-PYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPP 448
               YK P PPPPV+KY    PPY Y SPPPPP  Y SPPPPVYK   PP   Y YKSPP
Sbjct: 82  PVYKYKSPPPPPPVHKY----PPYIYKSPPPPPPIYKSPPPPVYKSPPPPKNPYVYKSPP 137

Query: 449 PPA-----------KKPYKYPSPPPPVYKYKSPPPPVY-------------SPPPPVYKY 556
           PP            KKPY Y SPPPP + +KSPPPPVY             SPPPP   +
Sbjct: 138 PPPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPIH 197

Query: 557 KSPPPPVY 580
           KSPPPP +
Sbjct: 198 KSPPPPYH 205

 Score =  206 bits (523), Expect = 1e-51
 Identities = 108/167 (64%), Positives = 113/167 (67%), Gaps = 7/167 (4%)
 Frame = +2

Query: 101 PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKP 280
           PS     YKY SPPPP Y Y SPPPPV+    PPPPVYKYKSPPPP   +KSPPPPP   
Sbjct: 18  PSQTTADYKYSSPPPP-YHYSSPPPPVHS--PPPPPVYKYKSPPPPPPIHKSPPPPPYV- 73

Query: 281 YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK 460
           YK P PPPPVYKY SPPPP      PP  YK P PPPP+YK  SPPPPVYK  SPPPP K
Sbjct: 74  YKSPPPPPPVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIYK--SPPPPVYK--SPPPP-K 128

Query: 461 KPYKY--PSPPPPVYKY----KSPPPPVY-SPPPPVYKYKSPPPPVY 580
            PY Y  P PPPPVYKY        P VY SPPPP + +KSPPPPVY
Sbjct: 129 NPYVYKSPPPPPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSPPPPVY 175

 Score =  176 bits (446), Expect = 1e-42
 Identities = 96/167 (57%), Positives = 100/167 (59%), Gaps = 42/167 (25%)
 Frame = +2

Query: 2   YKSPPPPP---KKP------YKYPSPPPPVYKYNSPPPP--------YKYPSPPPPPYKY 130
           YKSPPPPP   K P      YK P PPPPVYKY SPPPP        Y Y SPPPPP  Y
Sbjct: 54  YKSPPPPPPIHKSPPPPPYVYKSPPPPPPVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIY 113

Query: 131 PSPPPPVYK----------YKSPPPP--VYKY------------KSPPPPVYKYKSPPPP 238
            SPPPPVYK          YKSPPPP  VYKY            KSPPPP + +KSPPPP
Sbjct: 114 KSPPPPVYKSPPPPKNPYVYKSPPPPPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSPPPP 173

Query: 239 VYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYK-YPSPPPPPYKY 376
           VYK    PPPPKKPY Y SPPPP   + SPPPPY  Y S PPPP+ Y
Sbjct: 174 VYK---SPPPPKKPYVYKSPPPPPPIHKSPPPPYHYYYSSPPPPHHY 217

[36][TOP]
>UniRef100_Q76KW2 Hydroxyproline-rich glycoprotein-3 (Fragment) n=1 Tax=Pisum sativum
           RepID=Q76KW2_PEA
          Length = 137

 Score =  236 bits (602), Expect = 1e-60
 Identities = 108/138 (78%), Positives = 108/138 (78%), Gaps = 1/138 (0%)
 Frame = +2

Query: 35  YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVY 214
           YKY SPPPPVYKY SPPPP K       PYKY SPPPPVYKY SPPPPVYKYKSPPPPVY
Sbjct: 1   YKYKSPPPPVYKYKSPPPPVK------KPYKYSSPPPPVYKYNSPPPPVYKYKSPPPPVY 54

Query: 215 KYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPP 391
           KYKSPPPPVYKYKSPPPP KKPYKY SPPPPVYKYNSPPPP YKY SP  P YKY SPPP
Sbjct: 55  KYKSPPPPVYKYKSPPPPVKKPYKYTSPPPPVYKYNSPPPPVYKYKSPXTPIYKYKSPPP 114

Query: 392 PVYKYKSPPPPVYKYKSP 445
            VYKY S    V  Y  P
Sbjct: 115 XVYKYNSLLNSVQVYSPP 132

 Score =  223 bits (568), Expect = 9e-57
 Identities = 102/127 (80%), Positives = 103/127 (81%), Gaps = 4/127 (3%)
 Frame = +2

Query: 212 YKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPP 388
           YKYKSPPPPVYKYKSPPPP KKPYKY SPPPPVYKYNSPPPP YKY SPPPP YKY SPP
Sbjct: 1   YKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPP 60

Query: 389 PPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY---SPPPPVYKYK 559
           PPVYKYKSPPPPV          KKPYKY SPPPPVYKY SPPPPVY   SP  P+YKYK
Sbjct: 61  PPVYKYKSPPPPV----------KKPYKYTSPPPPVYKYNSPPPPVYKYKSPXTPIYKYK 110

Query: 560 SPPPPVY 580
           SPPP VY
Sbjct: 111 SPPPXVY 117

 Score =  214 bits (545), Expect = 4e-54
 Identities = 105/138 (76%), Positives = 105/138 (76%), Gaps = 9/138 (6%)
 Frame = +2

Query: 152 YKYKSPPPPVYKYKSPPPPV---YKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYN 322
           YKYKSPPPPVYKYKSPPPPV   YKY SPPPPVYKY SPPPP    YKY SPPPPVYKY 
Sbjct: 1   YKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYNSPPPP---VYKYKSPPPPVYKYK 57

Query: 323 SPPPP-YKYPSPPPP---PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPP 490
           SPPPP YKY SPPPP   PYKY SPPPPVYKY SPPPPVYKYKSP  P    YKY SPPP
Sbjct: 58  SPPPPVYKYKSPPPPVKKPYKYTSPPPPVYKYNSPPPPVYKYKSPXTPI---YKYKSPPP 114

Query: 491 PVYKYKS--PPPPVYSPP 538
            VYKY S      VYSPP
Sbjct: 115 XVYKYNSLLNSVQVYSPP 132

 Score =  194 bits (493), Expect = 4e-48
 Identities = 95/125 (76%), Positives = 97/125 (77%), Gaps = 8/125 (6%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPV---YKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSP 169
           YKSPPPP    YKY SPPPPV   YKY+SPPPP YKY SPPPP YKY SPPPPVYKYKSP
Sbjct: 3   YKSPPPPV---YKYKSPPPPVKKPYKYSSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSP 59

Query: 170 PPPVYKYKSPPPPV---YKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP- 337
           PPPVYKYKSPPPPV   YKY SPPPPVYKY SPPPP    YKY SP  P+YKY SPPP  
Sbjct: 60  PPPVYKYKSPPPPVKKPYKYTSPPPPVYKYNSPPPP---VYKYKSPXTPIYKYKSPPPXV 116

Query: 338 YKYPS 352
           YKY S
Sbjct: 117 YKYNS 121

 Score =  190 bits (482), Expect = 8e-47
 Identities = 94/135 (69%), Positives = 95/135 (70%), Gaps = 16/135 (11%)
 Frame = +2

Query: 2   YKSPPPPP------------KKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPP 142
           YK   PPP            KKPYKY SPPPPVYKYNSPPPP YKY SPPPP YKY SPP
Sbjct: 1   YKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPP 60

Query: 143 PPVYKYKSPPPPV---YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVY 313
           PPVYKYKSPPPPV   YKY SPPPPVYKY SPPPPVYKYKSP  P    YKY SPPP VY
Sbjct: 61  PPVYKYKSPPPPVKKPYKYTSPPPPVYKYNSPPPPVYKYKSPXTP---IYKYKSPPPXVY 117

Query: 314 KYNSPPPPYKYPSPP 358
           KYNS     +  SPP
Sbjct: 118 KYNSLLNSVQVYSPP 132

[37][TOP]
>UniRef100_Q43687 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q43687_VIGUN
          Length = 242

 Score =  236 bits (602), Expect = 1e-60
 Identities = 133/212 (62%), Positives = 134/212 (63%), Gaps = 21/212 (9%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYKYKSP 169
           SPPPPP  PY Y SPPPP     SPPPPYKY  P      PPPP   PSPPPP Y YKSP
Sbjct: 41  SPPPPP--PYVYSSPPPPSL---SPPPPYKYKDPHYEYKSPPPPS--PSPPPPYY-YKSP 92

Query: 170 PPPVYKYKSPPPPVYKYKSPPPPV------YKYKSPPPP---PKKPYKYPSPPPPVYKYN 322
           PPP     SPPPP Y YKSPPPP       Y YKSPPPP   P  PY Y SPPPP     
Sbjct: 93  PPPS---PSPPPPYY-YKSPPPPSPSPPPPYYYKSPPPPRPSPPPPYYYKSPPPPS---P 145

Query: 323 SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP------PPPVYKYKSPPPPAKKPYKYPSP 484
           SPPPPY Y SPPPP    PSPPPP Y YKSP      PPP Y YKSPPPP+      PSP
Sbjct: 146 SPPPPYYYKSPPPPS---PSPPPPSYYYKSPPPPSPSPPPPYYYKSPPPPS------PSP 196

Query: 485 PPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
           PPP Y YKSPPPP  SPPPP Y YKSPPPP Y
Sbjct: 197 PPPYY-YKSPPPPSPSPPPPYY-YKSPPPPPY 226

 Score =  195 bits (496), Expect = 2e-48
 Identities = 109/187 (58%), Positives = 112/187 (59%), Gaps = 24/187 (12%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPP-- 148
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP  
Sbjct: 73  YKSPPPPSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPRP 129

Query: 149 ----VYKYKSPPPPV------YKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKY 289
                Y YKSPPPP       Y YKSPPPP     SPPPP Y YKSPPPP   P  PY Y
Sbjct: 130 SPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS---PSPPPPSYYYKSPPPPSPSPPPPYYY 186

Query: 290 PSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPY 469
            SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPPPP Y++K P       Y
Sbjct: 187 KSPPPPS---PSPPPPYYYKSPPPPS---PSPPPPYY-YKSPPPPPYEHKDP------YY 233

Query: 470 KYPSPPP 490
           +Y SPPP
Sbjct: 234 QYKSPPP 240

 Score =  131 bits (329), Expect = 4e-29
 Identities = 73/128 (57%), Positives = 74/128 (57%), Gaps = 24/128 (18%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPP
Sbjct: 121 YKSPPPPRPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPS---PSPPPPSYYYKSPP 174

Query: 173 PPV------YKYKSPPPPV------YKYKSPPPPV------YKYKSPPPPP---KKPYKY 289
           PP       Y YKSPPPP       Y YKSPPPP       Y YKSPPPPP   K PY  
Sbjct: 175 PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPPYEHKDPYYQ 234

Query: 290 PSPPPPVY 313
              PPP +
Sbjct: 235 YKSPPPQF 242

 Score = 58.5 bits (140), Expect = 4e-07
 Identities = 26/46 (56%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 455 AKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV------YKYKSPPPP 574
           A   Y +  PPPP Y Y SPPPP  SPPPP       Y+YKSPPPP
Sbjct: 34  AADAYTHSPPPPPPYVYSSPPPPSLSPPPPYKYKDPHYEYKSPPPP 79

[38][TOP]
>UniRef100_O65760 Extensin (Fragment) n=1 Tax=Cicer arietinum RepID=O65760_CICAR
          Length = 192

 Score =  235 bits (600), Expect = 2e-60
 Identities = 129/211 (61%), Positives = 130/211 (61%), Gaps = 18/211 (8%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           Y SPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y Y SPP
Sbjct: 6   YHSPPPPSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPS---PSPPPPYY-YHSPP 58

Query: 173 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPS 352
           PP     SPPPP Y YKSPPPP     SP PPP  PY Y SPPPP     SPPPPY Y S
Sbjct: 59  PPS---PSPPPPYY-YKSPPPP-----SPSPPP--PYYYKSPPPPS---PSPPPPYHYQS 104

Query: 353 PPPP------PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP---YKYPSPPPP---- 493
           PPPP      PY Y SPPPP     S PPP Y Y SPPPP K P   Y Y SPPPP    
Sbjct: 105 PPPPSPTPRTPYYYKSPPPPT----SSPPPPYHYVSPPPPIKSPPPPYHYTSPPPPSPSP 160

Query: 494 --VYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
              Y YKSPPPPV SPPPPVY Y SPPPP+Y
Sbjct: 161 APTYIYKSPPPPVKSPPPPVYIYASPPPPIY 191

 Score =  201 bits (511), Expect = 3e-50
 Identities = 114/191 (59%), Positives = 117/191 (61%), Gaps = 24/191 (12%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPP
Sbjct: 22  YKSPPPPSPSPPPPYYYKSPPPPS---PSPPPPYYYHSPPPPS---PSPPPPYY-YKSPP 74

Query: 173 PPV------YKYKSPPPPV------YKYKSPPPPV------YKYKSPPPP---PKKPYKY 289
           PP       Y YKSPPPP       Y Y+SPPPP       Y YKSPPPP   P  PY Y
Sbjct: 75  PPSPSPPPPYYYKSPPPPSPSPPPPYHYQSPPPPSPTPRTPYYYKSPPPPTSSPPPPYHY 134

Query: 290 PSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPY 469
            SPPPP+    SPPPPY Y SPPPP    PS P P Y YKSPPPPV   KSPPPP    Y
Sbjct: 135 VSPPPPI---KSPPPPYHYTSPPPPS---PS-PAPTYIYKSPPPPV---KSPPPPV---Y 181

Query: 470 KYPSPPPPVYK 502
            Y SPPPP+YK
Sbjct: 182 IYASPPPPIYK 192

 Score =  192 bits (489), Expect = 1e-47
 Identities = 109/173 (63%), Positives = 110/173 (63%), Gaps = 6/173 (3%)
 Frame = +2

Query: 83  PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP 262
           PPPY Y SPPPP    PSPPPP Y YKSPPPP     SPPPP Y YKSPPPP     SP 
Sbjct: 1   PPPYYYHSPPPPS---PSPPPPYY-YKSPPPPS---PSPPPPYY-YKSPPPP-----SPS 47

Query: 263 PPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKS 442
           PPP  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPPPP     S
Sbjct: 48  PPP--PYYYHSPPPPS---PSPPPPYYYKSPPPPS---PSPPPPYY-YKSPPPP-----S 93

Query: 443 PPPPAKKPYKYPSPPPPV------YKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           P PP   PY Y SPPPP       Y YKSPPPP  SPPPP Y Y SPPPP+ S
Sbjct: 94  PSPPP--PYHYQSPPPPSPTPRTPYYYKSPPPPTSSPPPP-YHYVSPPPPIKS 143

[39][TOP]
>UniRef100_B9NAX9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NAX9_POPTR
          Length = 312

 Score =  235 bits (599), Expect = 2e-60
 Identities = 132/230 (57%), Positives = 132/230 (57%), Gaps = 39/230 (16%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVY 154
           Y SPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP  
Sbjct: 82  YSSPPPPKKSPPPPYHYSSPPPPK---KSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPK- 137

Query: 155 KYKSPPPPVYKYKSPPPPV------YKYKSP------PPPVYKYKSPPPP---PKKPYKY 289
             KSPPPP Y Y SPPPP       Y Y SP      PPP Y Y SPPPP   P  PY Y
Sbjct: 138 --KSPPPP-YHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHY 194

Query: 290 PSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 451
            SPPPP     SPPPPY Y SP      PPPPY Y SPPPP    KSPPPP Y Y SPPP
Sbjct: 195 TSPPPP---KKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPP---KKSPPPP-YHYSSPPP 247

Query: 452 PAKK---PYKYPSP------PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           P K    PY Y SP      PPP Y Y SPPPP  SPPPP Y Y SPPPP
Sbjct: 248 PKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPP-YHYSSPPPP 296

 Score =  233 bits (594), Expect = 8e-60
 Identities = 133/227 (58%), Positives = 134/227 (59%), Gaps = 34/227 (14%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVY 154
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP  
Sbjct: 34  YKSPPPPSQSPPPPYHYSSPPPPK---KSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPK- 89

Query: 155 KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNS 325
             KSPPPP Y Y SPPPP    KSPPPP Y Y SPPPP   P  PY Y SPPPP     S
Sbjct: 90  --KSPPPP-YHYSSPPPPK---KSPPPP-YHYSSPPPPKKSPPPPYHYSSPPPPK---KS 139

Query: 326 PPPPYKYPSPPPP------PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP---YKYP 478
           PPPPY Y SPPPP      PY Y SPPPP    KSPPPP Y Y SPPPP K P   Y Y 
Sbjct: 140 PPPPYHYSSPPPPKKSPPPPYHYSSPPPPK---KSPPPP-YHYSSPPPPKKSPPPPYHYT 195

Query: 479 SPPPPV------YKYKSPPPPVYSPPPPVYKY-------KSPPPPVY 580
           SPPPP       Y Y SPPPP  SPPPP Y Y       KSPPPP +
Sbjct: 196 SPPPPKKSPPPPYHYSSPPPPKKSPPPP-YHYTSPPPPKKSPPPPYH 241

 Score =  233 bits (594), Expect = 8e-60
 Identities = 132/231 (57%), Positives = 133/231 (57%), Gaps = 40/231 (17%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPV------YKYNSPPPPYKYPSP-------------PP 115
           Y SPPPP   P  PY Y SPPPP       Y Y+SPPPP K P P             PP
Sbjct: 66  YTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPP 125

Query: 116 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYK 286
           PPY Y SPPPP    KSPPPP Y Y SPPPP    KSPPPP Y Y SPPPP   P  PY 
Sbjct: 126 PPYHYSSPPPP---KKSPPPP-YHYSSPPPP---KKSPPPP-YHYSSPPPPKKSPPPPYH 177

Query: 287 YPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPP 448
           Y SPPPP     SPPPPY Y SP      PPPPY Y SPPPP    KSPPPP Y Y SPP
Sbjct: 178 YSSPPPP---KKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPP---KKSPPPP-YHYTSPP 230

Query: 449 PPAKK---PYKYPSP------PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           PP K    PY Y SP      PPP Y Y SPPPP  SPPPP Y Y SPPPP
Sbjct: 231 PPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPP-YHYSSPPPP 280

 Score =  231 bits (589), Expect = 3e-59
 Identities = 132/227 (58%), Positives = 133/227 (58%), Gaps = 34/227 (14%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVY 154
           Y SPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP  
Sbjct: 98  YSSPPPPKKSPPPPYHYSSPPPPK---KSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPK- 153

Query: 155 KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNS 325
             KSPPPP Y Y SPPPP    KSPPPP Y Y SPPPP   P  PY Y SPPPP     S
Sbjct: 154 --KSPPPP-YHYSSPPPPK---KSPPPP-YHYSSPPPPKKSPPPPYHYTSPPPPK---KS 203

Query: 326 PPPPYKYPSPPPP------PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP---YKYP 478
           PPPPY Y SPPPP      PY Y SPPPP    KSPPPP Y Y SPPPP K P   Y Y 
Sbjct: 204 PPPPYHYSSPPPPKKSPPPPYHYTSPPPPK---KSPPPP-YHYSSPPPPKKSPPPPYHYS 259

Query: 479 SPPPPV------YKYKSPPPPVYSPPPPVYKY-------KSPPPPVY 580
           SPPPP       Y Y SPPPP  SPPPP Y Y       KSPPPP +
Sbjct: 260 SPPPPKKSPPPPYHYSSPPPPKKSPPPP-YHYSSPPPPKKSPPPPYH 305

 Score =  228 bits (582), Expect = 2e-58
 Identities = 129/221 (58%), Positives = 129/221 (58%), Gaps = 30/221 (13%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVY 154
           Y SPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP  
Sbjct: 114 YSSPPPPKKSPPPPYHYSSPPPPK---KSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPK- 169

Query: 155 KYKSPPPPVYKYKSPPPPV------YKYKSP------PPPVYKYKSPPPP---PKKPYKY 289
             KSPPPP Y Y SPPPP       Y Y SP      PPP Y Y SPPPP   P  PY Y
Sbjct: 170 --KSPPPP-YHYSSPPPPKKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHY 226

Query: 290 PSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 451
            SPPPP     SPPPPY Y SP      PPPPY Y SPPPP    KSPPPP Y Y SPPP
Sbjct: 227 TSPPPP---KKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPP---KKSPPPP-YHYSSPPP 279

Query: 452 PAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           P K      SPPPP Y Y SPPPP  SPPPP Y Y SPPPP
Sbjct: 280 PKK------SPPPP-YHYSSPPPPKKSPPPP-YHYTSPPPP 312

 Score =  218 bits (556), Expect = 2e-55
 Identities = 122/206 (59%), Positives = 123/206 (59%), Gaps = 24/206 (11%)
 Frame = +2

Query: 29  KPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 208
           +PY Y SPPPP     SPPPPY Y SPPPP     SPPPP Y Y SPPPP    KSPPPP
Sbjct: 30  EPYYYKSPPPPS---QSPPPPYHYSSPPPPK---KSPPPP-YHYTSPPPPK---KSPPPP 79

Query: 209 VYKYKSP------PPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSP-- 355
            Y Y SP      PPP Y Y SPPPP   P  PY Y SPPPP     SPPPPY Y SP  
Sbjct: 80  -YHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPP---KKSPPPPYHYSSPPP 135

Query: 356 ----PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKK---PYKYPSP------PPPV 496
               PPPPY Y SPPPP    KSPPPP Y Y SPPPP K    PY Y SP      PPP 
Sbjct: 136 PKKSPPPPYHYSSPPPP---KKSPPPP-YHYSSPPPPKKSPPPPYHYSSPPPPKKSPPPP 191

Query: 497 YKYKSPPPPVYSPPPPVYKYKSPPPP 574
           Y Y SPPPP  SPPPP Y Y SPPPP
Sbjct: 192 YHYTSPPPPKKSPPPP-YHYSSPPPP 216

 Score =  146 bits (369), Expect = 1e-33
 Identities = 84/138 (60%), Positives = 87/138 (63%), Gaps = 5/138 (3%)
 Frame = +2

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
           Y YKSPPPP    +SPPPP Y Y SPPPP K      SPPPP Y Y SPPPP K    PP
Sbjct: 32  YYYKSPPPPS---QSPPPP-YHYSSPPPPKK------SPPPP-YHYTSPPPPKK---SPP 77

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVY- 529
           PPY Y SPPPP    KSPPPP Y Y SPPPP K P   Y Y SPPPP    KSPPPP + 
Sbjct: 78  PPYHYSSPPPPK---KSPPPP-YHYSSPPPPKKSPPPPYHYSSPPPPK---KSPPPPYHY 130

Query: 530 -SPPPPVYKYKSPPPPVY 580
            SPPPP    KSPPPP +
Sbjct: 131 SSPPPPK---KSPPPPYH 145

[40][TOP]
>UniRef100_Q9FS16 Extensin-3 n=1 Tax=Arabidopsis thaliana RepID=EXTN3_ARATH
          Length = 427

 Score =  233 bits (594), Expect = 8e-60
 Identities = 137/242 (56%), Positives = 142/242 (58%), Gaps = 54/242 (22%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPVYKYN------SPPPP---YKYPSPPPP------PYKYPSPPPP 148
           PPPPKK Y+Y SPPPPV  Y+      SPPPP   Y Y SPPPP      P  Y SPPPP
Sbjct: 53  PPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 112

Query: 149 V--YKYKSPPPPVYKYK------SPPPPV--YKYKSPPPPVYKYKSPP-----PPPKKPY 283
              Y YKSPPPPV  Y       SPPPP   Y YKSPPPPV  Y  PP     PPPKK Y
Sbjct: 113 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 172

Query: 284 KYPSPPPPVYKYN------SPPPP---YKYPSPPPP------PYKYPSPPPPV--YKYKS 412
            Y SPPPPV  Y+      SPPPP   Y Y SPPPP      P  Y SPPPP   Y YKS
Sbjct: 173 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 232

Query: 413 PPPPVYKYKSPP-----PPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV--YKYKSPPP 571
           PPPPV  Y  PP     PP KK Y Y SPPPPV K+ SPPP  +SPPPP   Y YKSPPP
Sbjct: 233 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPP 291

Query: 572 PV 577
           PV
Sbjct: 292 PV 293

 Score =  232 bits (591), Expect = 2e-59
 Identities = 137/242 (56%), Positives = 141/242 (58%), Gaps = 54/242 (22%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPVYKYN------SPPPP---YKYPSPPPP------PYKYPSPPPP 148
           PPPPKK Y Y SPPPPV  Y+      SPPPP   Y Y SPPPP      P  Y SPPPP
Sbjct: 81  PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 140

Query: 149 V--YKYKSPPPPVYKYK------SPPPPV--YKYKSPPPPVYKYKSPP-----PPPKKPY 283
              Y YKSPPPPV  Y       SPPPP   Y YKSPPPPV  Y  PP     PPPKK Y
Sbjct: 141 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 200

Query: 284 KYPSPPPPVYKYN------SPPPP---YKYPSPPPP------PYKYPSPPPPV--YKYKS 412
            Y SPPPPV  Y+      SPPPP   Y Y SPPPP      P  Y SPPPP   Y YKS
Sbjct: 201 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 260

Query: 413 PPPPVYKYKSPP-----PPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV--YKYKSPPP 571
           PPPPV  Y  PP     PP KK Y Y SPPPPV K+ SPPP  +SPPPP   Y YKSPPP
Sbjct: 261 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPP 319

Query: 572 PV 577
           PV
Sbjct: 320 PV 321

 Score =  232 bits (591), Expect = 2e-59
 Identities = 137/242 (56%), Positives = 141/242 (58%), Gaps = 54/242 (22%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPVYKYN------SPPPP---YKYPSPPPP------PYKYPSPPPP 148
           PPPPKK Y Y SPPPPV  Y+      SPPPP   Y Y SPPPP      P  Y SPPPP
Sbjct: 109 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 168

Query: 149 V--YKYKSPPPPVYKYK------SPPPPV--YKYKSPPPPVYKYKSPP-----PPPKKPY 283
              Y YKSPPPPV  Y       SPPPP   Y YKSPPPPV  Y  PP     PPPKK Y
Sbjct: 169 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 228

Query: 284 KYPSPPPPVYKYN------SPPPP---YKYPSPPPP------PYKYPSPPPPV--YKYKS 412
            Y SPPPPV  Y+      SPPPP   Y Y SPPPP      P  Y SPPPP   Y YKS
Sbjct: 229 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 288

Query: 413 PPPPVYKYKSPP-----PPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV--YKYKSPPP 571
           PPPPV  Y  PP     PP KK Y Y SPPPPV K+ SPPP  +SPPPP   Y YKSPPP
Sbjct: 289 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPP 347

Query: 572 PV 577
           PV
Sbjct: 348 PV 349

 Score =  232 bits (591), Expect = 2e-59
 Identities = 137/242 (56%), Positives = 141/242 (58%), Gaps = 54/242 (22%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPVYKYN------SPPPP---YKYPSPPPP------PYKYPSPPPP 148
           PPPPKK Y Y SPPPPV  Y+      SPPPP   Y Y SPPPP      P  Y SPPPP
Sbjct: 137 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 196

Query: 149 V--YKYKSPPPPVYKYK------SPPPPV--YKYKSPPPPVYKYKSPP-----PPPKKPY 283
              Y YKSPPPPV  Y       SPPPP   Y YKSPPPPV  Y  PP     PPPKK Y
Sbjct: 197 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 256

Query: 284 KYPSPPPPVYKYN------SPPPP---YKYPSPPPP------PYKYPSPPPPV--YKYKS 412
            Y SPPPPV  Y+      SPPPP   Y Y SPPPP      P  Y SPPPP   Y YKS
Sbjct: 257 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 316

Query: 413 PPPPVYKYKSPP-----PPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV--YKYKSPPP 571
           PPPPV  Y  PP     PP KK Y Y SPPPPV K+ SPPP  +SPPPP   Y YKSPPP
Sbjct: 317 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPP 375

Query: 572 PV 577
           PV
Sbjct: 376 PV 377

 Score =  230 bits (587), Expect = 5e-59
 Identities = 136/241 (56%), Positives = 140/241 (58%), Gaps = 54/241 (22%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPVYKYN------SPPPP---YKYPSPPPP------PYKYPSPPPP 148
           PPPPKK Y Y SPPPPV  Y+      SPPPP   Y Y SPPPP      P  Y SPPPP
Sbjct: 165 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 224

Query: 149 V--YKYKSPPPPVYKYK------SPPPPV--YKYKSPPPPVYKYKSP-----PPPPKKPY 283
              Y YKSPPPPV  Y       SPPPP   Y YKSPPPPV  Y  P     PPPPKK Y
Sbjct: 225 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 284

Query: 284 KYPSPPPPVYK------YNSPPPP---YKYPSPPP------PPYKYPSPPPPV--YKYKS 412
            Y SPPPPV        Y+SPPPP   Y Y SPPP      PP  Y SPPPP   Y YKS
Sbjct: 285 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 344

Query: 413 PPPPVYKYKSP-----PPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPP--VYKYKSPPP 571
           PPPPV  Y  P     PPP KK Y Y SPPPPV K+ SPPP  +SPPPP   Y YKSPPP
Sbjct: 345 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKEKYVYKSPPP 403

Query: 572 P 574
           P
Sbjct: 404 P 404

 Score =  227 bits (578), Expect = 6e-58
 Identities = 133/235 (56%), Positives = 136/235 (57%), Gaps = 46/235 (19%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPVYKYN------SPPPP---YKYPSPPPP------PYKYPSPPPP 148
           PPPPKK Y Y SPPPPV  Y+      SPPPP   Y Y SPPPP      P  Y SPPPP
Sbjct: 193 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPP 252

Query: 149 V--YKYKSPPPPVYKYK------SPPPPV--YKYKSPPPPVYKYKSPP-----PPPKKPY 283
              Y YKSPPPPV  Y       SPPPP   Y YKSPPPPV  Y  PP     PPPKK Y
Sbjct: 253 KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 312

Query: 284 KYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYK------SPPPPV--YKYK 439
            Y SPPPPV K+ SPPP Y  P PP   Y Y SPPPPV  Y       SPPPP   Y YK
Sbjct: 313 VYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 371

Query: 440 SPPPPAKK---PYKYPSPPPPV--YKYKSPPPPV---YSPPPPVYKYKSPPPPVY 580
           SPPPP K    P  Y SPPPP   Y YKSPPPP    YSPP   Y YKSPPPP +
Sbjct: 372 SPPPPVKHYSPPPVYHSPPPPKEKYVYKSPPPPPVHHYSPPHHPYLYKSPPPPYH 426

 Score =  216 bits (550), Expect = 1e-54
 Identities = 131/242 (54%), Positives = 136/242 (56%), Gaps = 61/242 (25%)
 Frame = +2

Query: 35  YKYPSPPPPVYK-------------YNSPPPP---YKYPSPPP------PPYKYPSPPPP 148
           Y Y SPPPPV               Y+SPPPP   Y+Y SPPP      PP  Y SPPPP
Sbjct: 25  YFYSSPPPPVKHYTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPP 84

Query: 149 V--YKYKSPPPPVYKYK------SPPPPV--YKYKSPPPPVYKYKSP-----PPPPKKPY 283
              Y YKSPPPPV  Y       SPPPP   Y YKSPPPPV  Y  P     PPPPKK Y
Sbjct: 85  KKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHY 144

Query: 284 KYPSPPPPVYK------YNSPPPP---YKYPSPPP------PPYKYPSPPPPV--YKYKS 412
            Y SPPPPV        Y+SPPPP   Y Y SPPP      PP  Y SPPPP   Y YKS
Sbjct: 145 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKS 204

Query: 413 PPPPVYKYKSP-----PPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV--YKYKSPPP 571
           PPPPV  Y  P     PPP KK Y Y SPPPPV K+ SPPP  +SPPPP   Y YKSPPP
Sbjct: 205 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPP 263

Query: 572 PV 577
           PV
Sbjct: 264 PV 265

 Score =  216 bits (549), Expect = 1e-54
 Identities = 123/221 (55%), Positives = 129/221 (58%), Gaps = 29/221 (13%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           + S PPPP K Y      PPV K+ SPPP Y  P PP   Y+Y SPPPPV  Y   PPPV
Sbjct: 26  FYSSPPPPVKHYT-----PPV-KHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYS--PPPV 77

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSP-----PPPPKKPYKYPSPPPPVYK------YNSP 328
           Y    PP   Y YKSPPPPV  Y  P     PPPPKK Y Y SPPPPV        Y+SP
Sbjct: 78  YHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 137

Query: 329 PPP---YKYPSPPP------PPYKYPSPPPPV--YKYKSPPPPVYKYKSP-----PPPAK 460
           PPP   Y Y SPPP      PP  Y SPPPP   Y YKSPPPPV  Y  P     PPP K
Sbjct: 138 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 197

Query: 461 KPYKYPSPPPPVYKYKSPPPPVYSPPPPV--YKYKSPPPPV 577
           K Y Y SPPPPV K+ SPPP  +SPPPP   Y YKSPPPPV
Sbjct: 198 KHYVYKSPPPPV-KHYSPPPVYHSPPPPKKHYVYKSPPPPV 237

 Score =  118 bits (296), Expect = 3e-25
 Identities = 74/138 (53%), Positives = 80/138 (57%), Gaps = 4/138 (2%)
 Frame = +2

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPV--YKYNSPPPPYKYPSP 355
           Y Y SPPPPV  Y    PPV K+ SPPP       Y SPPPP   Y+Y SPPPP K+ SP
Sbjct: 25  YFYSSPPPPVKHYT---PPV-KHYSPPPV------YHSPPPPKKHYEYKSPPPPVKHYSP 74

Query: 356 PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPV--YKYKSPPPPVY 529
            PP Y  P PP   Y YKSPPPPV K+ SPPP       Y SPPPP   Y YKSPPPPV 
Sbjct: 75  -PPVYHSPPPPKKHYVYKSPPPPV-KHYSPPPV------YHSPPPPKKHYVYKSPPPPV- 125

Query: 530 SPPPPVYKYKSPPPPVYS 583
                  K+ SPPP  +S
Sbjct: 126 -------KHYSPPPVYHS 136

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 25/40 (62%), Positives = 28/40 (70%), Gaps = 1/40 (2%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPP-VYKYNSPPPPYKYPSPPPPPYKY 130
           PPPPK+ Y Y SPPPP V+ Y+ P  PY Y S PPPPY Y
Sbjct: 389 PPPPKEKYVYKSPPPPPVHHYSPPHHPYLYKS-PPPPYHY 427

[41][TOP]
>UniRef100_Q40768 Extensin n=1 Tax=Prunus dulcis RepID=Q40768_PRUDU
          Length = 278

 Score =  232 bits (591), Expect = 2e-59
 Identities = 133/241 (55%), Positives = 136/241 (56%), Gaps = 47/241 (19%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPV--------YK 157
           Y SPPPP   PY Y SPPPP     SP PP  Y SPP  PY Y SPPPPV        Y 
Sbjct: 35  YSSPPPPVSPPYHYKSPPPP-----SPTPPVHY-SPPKHPYHYKSPPPPVHYSPPKHPYH 88

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPV-------YKYKSPPPP----PKKPYKYPSPPP 304
           YKSPPPPVY   SPP   Y YKSPPPP        Y YKSPPPP    PK PY Y SPPP
Sbjct: 89  YKSPPPPVY---SPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPP 145

Query: 305 PV-------YKYNSPPPPYKYPSPPPPPYKYPSPPPPV-----YKYKSPPPPV------- 427
           P        Y Y SPPPP   PSPP  PY Y SPPPP      Y YKSPPPP        
Sbjct: 146 PSPSPPKHPYHYKSPPPPS--PSPPKHPYHYKSPPPPSPPKKPYHYKSPPPPPSPTPPVY 203

Query: 428 ------YKYKSPPPPA--KKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYK-YKSPPPPVY 580
                 Y YKSPPPP+  KKPY Y SPPPP   YK   PPVYSPPPP  K YK P PPV+
Sbjct: 204 SPPKHPYHYKSPPPPSPPKKPYHYKSPPPPTPVYK---PPVYSPPPPPKKPYKPPTPPVH 260

Query: 581 S 583
           +
Sbjct: 261 T 261

 Score =  210 bits (534), Expect = 7e-53
 Identities = 125/249 (50%), Positives = 130/249 (52%), Gaps = 58/249 (23%)
 Frame = +2

Query: 2   YKSPPPP----------PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP-------PYKY 130
           YKSPPPP          PK PY Y SPPPPV+ Y+ P  PY Y SPPPP       PY Y
Sbjct: 48  YKSPPPPSPTPPVHYSPPKHPYHYKSPPPPVH-YSPPKHPYHYKSPPPPVYSPPKHPYHY 106

Query: 131 PSPPPPV-------YKYKSPPPPV-------YKYKSPPPPV-------YKYKSPPPPV-- 241
            SPPPP        Y YKSPPPP        Y YKSPPPP        Y YKSPPPP   
Sbjct: 107 KSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPS 166

Query: 242 -----YKYKSPPPP--PKKPYKYPSPPPPVYK----YNSPPPPYKYPSPPPPP------- 367
                Y YKSPPPP  PKKPY Y SPPPP       Y+ P  PY Y SPPPP        
Sbjct: 167 PPKHPYHYKSPPPPSPPKKPYHYKSPPPPPSPTPPVYSPPKHPYHYKSPPPPSPPKKPYH 226

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
           YK P PP PVYK     PPVY   SPPPP KKP            YK P PPV++ PP  
Sbjct: 227 YKSPPPPTPVYK-----PPVY---SPPPPPKKP------------YKPPTPPVHTAPPHP 266

Query: 548 YKYKSPPPP 574
           Y Y SPPPP
Sbjct: 267 YIYSSPPPP 275

 Score =  185 bits (469), Expect = 3e-45
 Identities = 107/199 (53%), Positives = 108/199 (54%), Gaps = 51/199 (25%)
 Frame = +2

Query: 131 PSPPPPVYKYKSPPPPV---YKYKSPPPP-------------VYKYKSPPPPV------- 241
           PS     Y Y SPPPPV   Y YKSPPPP              Y YKSPPPPV       
Sbjct: 26  PSETSANYPYSSPPPPVSPPYHYKSPPPPSPTPPVHYSPPKHPYHYKSPPPPVHYSPPKH 85

Query: 242 -YKYKSPPP----PPKKPYKYPSPPPP-------VYKYNSPPPPYKYPSPPPPPYKYPSP 385
            Y YKSPPP    PPK PY Y SPPPP        Y Y SPPPP   PSPP  PY Y SP
Sbjct: 86  PYHYKSPPPPVYSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPP--SPSPPKHPYHYKSP 143

Query: 386 PPP-------VYKYKSPPPP-------VYKYKSPPPPA--KKPYKYPSPPPPVYKYKSPP 517
           PPP        Y YKSPPPP        Y YKSPPPP+  KKPY Y SPPPP     SP 
Sbjct: 144 PPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPPKKPYHYKSPPPP----PSPT 199

Query: 518 PPVYSPPPPVYKYKSPPPP 574
           PPVYSPP   Y YKSPPPP
Sbjct: 200 PPVYSPPKHPYHYKSPPPP 218

 Score =  133 bits (335), Expect = 9e-30
 Identities = 75/140 (53%), Positives = 76/140 (54%), Gaps = 33/140 (23%)
 Frame = +2

Query: 254 SPPPPPKKPYKYPSPPPPV---YKYNSPPPPYKYP----SPPPPPYKYPSPPPPV----- 397
           S P      Y Y SPPPPV   Y Y SPPPP   P    SPP  PY Y SPPPPV     
Sbjct: 24  SLPSETSANYPYSSPPPPVSPPYHYKSPPPPSPTPPVHYSPPKHPYHYKSPPPPVHYSPP 83

Query: 398 ---YKYKSPPPPVYK-------YKSPPPPA----KKPYKYPSPPPP-------VYKYKSP 514
              Y YKSPPPPVY        YKSPPPP+    K PY Y SPPPP        Y YKSP
Sbjct: 84  KHPYHYKSPPPPVYSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSP 143

Query: 515 PPPVYSPPPPVYKYKSPPPP 574
           PPP  SPP   Y YKSPPPP
Sbjct: 144 PPPSPSPPKHPYHYKSPPPP 163

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 39/66 (59%), Positives = 39/66 (59%), Gaps = 14/66 (21%)
 Frame = +2

Query: 428 YKYKSPPPPAKKPYKYPSPPPP-------------VYKYKSPPPPV-YSPPPPVYKYKSP 565
           Y Y SPPPP   PY Y SPPPP              Y YKSPPPPV YSPP   Y YKSP
Sbjct: 33  YPYSSPPPPVSPPYHYKSPPPPSPTPPVHYSPPKHPYHYKSPPPPVHYSPPKHPYHYKSP 92

Query: 566 PPPVYS 583
           PPPVYS
Sbjct: 93  PPPVYS 98

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 9/56 (16%)
 Frame = +2

Query: 440 SPPPPAKKPYKYPSPPPPV---YKYKSPPPPV------YSPPPPVYKYKSPPPPVY 580
           S P      Y Y SPPPPV   Y YKSPPPP       YSPP   Y YKSPPPPV+
Sbjct: 24  SLPSETSANYPYSSPPPPVSPPYHYKSPPPPSPTPPVHYSPPKHPYHYKSPPPPVH 79

[42][TOP]
>UniRef100_Q9T0L0 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0L0_ARATH
          Length = 429

 Score =  231 bits (590), Expect = 2e-59
 Identities = 132/241 (54%), Positives = 134/241 (55%), Gaps = 48/241 (19%)
 Frame = +2

Query: 2   YKSPPPP----PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSP------PPPV 151
           YKSPPPP       P  Y SP P V  YNSPPPPY Y SPPPPPY  PSP      PPP 
Sbjct: 121 YKSPPPPYVYSSLPPLTYYSPSPKVI-YNSPPPPYIYSSPPPPPYYSPSPKVDYKSPPPP 179

Query: 152 YKYKSPPPPVY-------KYKSPPPPVYKYKSPPPPVYKYKSPP---PPPKKPYKYPSPP 301
           Y Y SPPPP Y       +YKSPPPP Y Y  PPPP Y   SP      P  PY Y SPP
Sbjct: 180 YVYSSPPPPPYYSPSPKVEYKSPPPP-YVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPP 238

Query: 302 PPVY-------KYNSPPPPYKYPSPPPPPYKYPSP------PPPVYKYKSPPPPVY---- 430
           PP Y        Y SPPPPY Y SPPPPPY  PSP      PPP Y Y SPPPP Y    
Sbjct: 239 PPPYYSPSPKVNYKSPPPPYVYSSPPPPPYS-PSPKVEFKSPPPPYIYNSPPPPSYYSPS 297

Query: 431 ---KYKSPPPPAKKPYKYPSPPPPVY-------KYKSPPPP-VYSPPPPVYKYKSPPPPV 577
               YKSPPPP    Y Y SPPPP Y        YKSPPPP VY+  PP Y Y SPPPP 
Sbjct: 298 PKIDYKSPPPP----YVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPPPYVYNSPPPPP 353

Query: 578 Y 580
           Y
Sbjct: 354 Y 354

 Score =  231 bits (590), Expect = 2e-59
 Identities = 129/236 (54%), Positives = 133/236 (56%), Gaps = 45/236 (19%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSP------P 142
           YKSPPPP    Y Y SPPPP Y       +Y SPPPPY Y  PPPPPY  PSP      P
Sbjct: 173 YKSPPPP----YVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPSPKVGYKSP 228

Query: 143 PPVYKYKSPPPPVY-------KYKSPPPPVYKYKSPPPPVY------KYKSPPPPPKKPY 283
           P  Y Y SPPPP Y        YKSPPPP Y Y SPPPP Y      ++KSPPPP    Y
Sbjct: 229 PAPYVYSSPPPPPYYSPSPKVNYKSPPPP-YVYSSPPPPPYSPSPKVEFKSPPPP----Y 283

Query: 284 KYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSP------PPPVYKYKSPPPP 424
            Y SPPPP Y        Y SPPPPY Y SPPPP Y  PSP      PPP Y Y S PPP
Sbjct: 284 IYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPPP 343

Query: 425 VYKYKSPPPPAKKPYKYPSP------PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            Y Y SPPPP   PY  PSP      PPP Y Y SPPPP Y  P P  +YKSPPPP
Sbjct: 344 -YVYNSPPPP---PYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPP 395

 Score =  227 bits (578), Expect = 6e-58
 Identities = 128/235 (54%), Positives = 130/235 (55%), Gaps = 44/235 (18%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYK-------YNSPPPPYKYPSPPPPPYKYPSP------P 142
           YKSPPPP    Y Y  PPPP Y        Y SPP PY Y SPPPPPY  PSP      P
Sbjct: 199 YKSPPPP----YVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSP 254

Query: 143 PPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPPVY-------KYKSPPPP----- 268
           PP Y Y SPPPP Y      ++KSPPPP Y Y SPPPP Y        YKSPPPP     
Sbjct: 255 PPPYVYSSPPPPPYSPSPKVEFKSPPPP-YIYNSPPPPSYYSPSPKIDYKSPPPPYVYSS 313

Query: 269 -PKKPYKYPSP------PPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 427
            P   Y  PSP      PPP Y YNS PPPY Y SPPPPPY  PSP      YKSPPPP 
Sbjct: 314 PPPPTYYSPSPRVDYKSPPPPYVYNSLPPPYVYNSPPPPPYYSPSP---TVNYKSPPPP- 369

Query: 428 YKYKSPPPPAKKPYKYPSP------PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           Y Y SPPPP   PY  P P      PPP Y Y SPPPP Y  P P   YKSPPPP
Sbjct: 370 YVYNSPPPP---PYYSPFPKVEYKSPPPPYIYNSPPPPPYYSPSPKITYKSPPPP 421

 Score =  191 bits (484), Expect = 5e-47
 Identities = 121/242 (50%), Positives = 126/242 (52%), Gaps = 48/242 (19%)
 Frame = +2

Query: 2   YKSPPPPPK-KPY--KYPSPPPPVY-----KYNSPPPPYKYPSPPPPPYKYP-------S 136
           Y SP PP    PY  + P PPPP Y     KY   P P  Y SP P PY +P       S
Sbjct: 38  YTSPYPPKNYSPYLSESPPPPPPQYRRQEPKYTPHPEPNVYDSPTPLPYYFPFPKLDIKS 97

Query: 137 PPPP-VYKYKSP-----PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP-----PPPKKPY 283
           PPPP VY +  P     P P  +YKSPPPP Y Y S PP  Y   SP      PPP  PY
Sbjct: 98  PPPPSVYTFSPPQLYYSPSPKVEYKSPPPP-YVYSSLPPLTYYSPSPKVIYNSPPP--PY 154

Query: 284 KYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKS 442
            Y SPPPP Y        Y SPPPPY Y SPPPPPY  PSP     +YKSPPPP Y Y  
Sbjct: 155 IYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPK---VEYKSPPPP-YVYSF 210

Query: 443 PPPPAKKPYKYPSP------PPPVYKYKSPPPP-VYSP--------PPPVYKYKSPPPPV 577
           PPPP   PY  PSP      PP  Y Y SPPPP  YSP        PPP Y Y SPPPP 
Sbjct: 211 PPPP---PYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPP 267

Query: 578 YS 583
           YS
Sbjct: 268 YS 269

 Score =  176 bits (447), Expect = 9e-43
 Identities = 101/187 (54%), Positives = 106/187 (56%), Gaps = 39/187 (20%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPPPYKYPSP------PP 145
           YKSPPPP    Y Y SPPPP Y      ++ SPPPPY Y SPPPP Y  PSP      PP
Sbjct: 251 YKSPPPP----YVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSPKIDYKSPP 306

Query: 146 PVYKYKSPPPPVY-------KYKSPPPPVYKYKSPPPPVYKYKSPPPPP----------- 271
           P Y Y SPPPP Y        YKSPPPP Y Y S PPP Y Y SPPPPP           
Sbjct: 307 PPYVYSSPPPPTYYSPSPRVDYKSPPPP-YVYNSLPPP-YVYNSPPPPPYYSPSPTVNYK 364

Query: 272 --KKPYKYPSPPPPVY-------KYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 424
               PY Y SPPPP Y       +Y SPPPPY Y SPPPPPY   SP P +  YKSPPPP
Sbjct: 365 SPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPPY--YSPSPKI-TYKSPPPP 421

Query: 425 VYKYKSP 445
            Y YK+P
Sbjct: 422 -YIYKTP 427

[43][TOP]
>UniRef100_Q7DMV8 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q7DMV8_PHAVU
          Length = 230

 Score =  231 bits (588), Expect = 4e-59
 Identities = 129/218 (59%), Positives = 136/218 (62%), Gaps = 24/218 (11%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVYKYK 163
           Y SPPPPPK PY Y SPPPP +   SPPPPY Y SPPPP      PY Y SPPPP +   
Sbjct: 33  YSSPPPPPK-PYYYQSPPPPKH---SPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKH--- 85

Query: 164 SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNSPPP 334
           SPPPP Y Y SPPPP +   SPPPP Y Y SPPPP   P  PY Y SPPPP +   SPPP
Sbjct: 86  SPPPPYY-YHSPPPPKH---SPPPPYY-YHSPPPPKHSPPPPYYYHSPPPPKH---SPPP 137

Query: 335 PYKYPSPPPP------PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP---YKYPSPP 487
           PY Y SPPPP      PY Y SPPPP +   SPPPP Y Y SPPPP   P   Y Y SPP
Sbjct: 138 PYYYHSPPPPKHSPPPPYYYHSPPPPKH---SPPPPYY-YHSPPPPKHSPPPPYYYHSPP 193

Query: 488 PPV------YKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           PP       Y Y SPPPP +SPPPP Y Y SPPPP +S
Sbjct: 194 PPKHSPPPPYYYHSPPPPKHSPPPPYY-YHSPPPPKHS 230

 Score =  189 bits (481), Expect = 1e-46
 Identities = 109/189 (57%), Positives = 116/189 (61%), Gaps = 6/189 (3%)
 Frame = +2

Query: 35  YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVY 214
           Y Y SPPPP       P PY Y SPPPP +   SPPPP Y Y SPPPP +   SPPPP Y
Sbjct: 31  YIYSSPPPP-------PKPYYYQSPPPPKH---SPPPPYY-YHSPPPPKH---SPPPPYY 76

Query: 215 KYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKY 376
            Y SPPPP +   SPPPP    Y Y SPPPP +   SPPPPY Y SPPPP      PY Y
Sbjct: 77  -YHSPPPPKH---SPPPP----YYYHSPPPPKH---SPPPPYYYHSPPPPKHSPPPPYYY 125

Query: 377 PSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKY 556
            SPPPP +   SPPPP Y Y SPPPP        SPPPP Y Y SPPPP +SPPPP Y Y
Sbjct: 126 HSPPPPKH---SPPPPYY-YHSPPPPKH------SPPPPYY-YHSPPPPKHSPPPPYY-Y 173

Query: 557 KSPPPPVYS 583
            SPPPP +S
Sbjct: 174 HSPPPPKHS 182

[44][TOP]
>UniRef100_Q8H9E1 Extensin (Fragment) n=1 Tax=Solanum tuberosum RepID=Q8H9E1_SOLTU
          Length = 152

 Score =  226 bits (577), Expect = 8e-58
 Identities = 117/171 (68%), Positives = 119/171 (69%), Gaps = 3/171 (1%)
 Frame = +2

Query: 71  YNSPPPPYKYPSPP-PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYK 247
           Y SPPPP    SP  PPPY Y SPPPP     SPPPP Y YKSPPPP     SPPPP Y 
Sbjct: 1   YKSPPPP----SPSLPPPYVYKSPPPPS---PSPPPPYY-YKSPPPPS---PSPPPPYY- 48

Query: 248 YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS--PPP 421
           YKSPPPP       PSPPPP Y  + PPPP  Y SPPPP YKY SPPPPVYKYKS  PPP
Sbjct: 49  YKSPPPPS------PSPPPPYYYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPP 102

Query: 422 PVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           PVYKYKSPPPP    YKY SPPPPVYKYKSPPPPV+  P P Y Y SPPPP
Sbjct: 103 PVYKYKSPPPPV---YKYKSPPPPVYKYKSPPPPVHKSPAPYY-YTSPPPP 149

 Score =  219 bits (559), Expect = 9e-56
 Identities = 116/170 (68%), Positives = 116/170 (68%), Gaps = 6/170 (3%)
 Frame = +2

Query: 2   YKSPPPPPKK---PYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           YKSPPPP      PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPP
Sbjct: 1   YKSPPPPSPSLPPPYVYKSPPPPS---PSPPPPYYYKSPPPPS---PSPPPPYY-YKSPP 53

Query: 173 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPS 352
           PP     SPPPP Y YKSPPPP   YKSPPPP    YKY SPPPPVYKY SPPPP     
Sbjct: 54  PPS---PSPPPPYY-YKSPPPPPPVYKSPPPPV---YKYKSPPPPVYKYKSPPPP----- 101

Query: 353 PPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKK---PYKYPSPPPP 493
           PP    KY SPPPPVYKYKSPPPPVYKYKSPPPP  K   PY Y SPPPP
Sbjct: 102 PPVY--KYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSPAPYYYTSPPPP 149

 Score =  219 bits (558), Expect = 1e-55
 Identities = 114/164 (69%), Positives = 115/164 (70%), Gaps = 3/164 (1%)
 Frame = +2

Query: 98  YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKK 277
           Y SPPPP    PS PPP Y YKSPPPP     SPPPP Y YKSPPPP     SP PPP  
Sbjct: 1   YKSPPPPS---PSLPPP-YVYKSPPPPS---PSPPPPYY-YKSPPPP-----SPSPPP-- 45

Query: 278 PYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPA 457
           PY Y SPPPP     SPPPPY Y SPPPPP  Y SPPPPVYKYKSPPPPVYKYKSPPPP 
Sbjct: 46  PYYYKSPPPPS---PSPPPPYYYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPP- 101

Query: 458 KKPYKYPSPPPPVYKYKSPPPPVY---SPPPPVYKYKSPPPPVY 580
                     PPVYKYKSPPPPVY   SPPPPVYKYKSPPPPV+
Sbjct: 102 ----------PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVH 135

 Score =  171 bits (434), Expect = 3e-41
 Identities = 85/121 (70%), Positives = 86/121 (71%), Gaps = 15/121 (12%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKY-------PSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPV 151
           YKSPPPP   P  PY Y       PSPPPP Y  + PPPP  Y SPPPP YKY SPPPPV
Sbjct: 33  YKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPPPVYKSPPPPVYKYKSPPPPV 92

Query: 152 YKYKSPPPP--VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKK---PYKYPSPPPPVYK 316
           YKYKSPPPP  VYKYKSPPPPVYKYKSPPPPVYKYKSPPPP  K   PY Y SPP P   
Sbjct: 93  YKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSPAPYYYTSPP-PPSH 151

Query: 317 Y 319
           Y
Sbjct: 152 Y 152

[45][TOP]
>UniRef100_Q9LHS1 Genomic DNA, chromosome 5, TAC clone:K3D20 n=2 Tax=Arabidopsis
           thaliana RepID=Q9LHS1_ARATH
          Length = 334

 Score =  225 bits (573), Expect = 2e-57
 Identities = 138/257 (53%), Positives = 144/257 (56%), Gaps = 63/257 (24%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPP 148
           + SPPPP     PK+ YK  SPPPP Y YNSPPPPY  PSP      PPPPY Y SPPPP
Sbjct: 85  FNSPPPPYYSPSPKEDYK--SPPPP-YVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPPPP 141

Query: 149 VY------KYKSPPPPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPP-----PKK 277
            Y      +YKSPPPP Y Y SPPPP Y       YKSPPPP Y Y SPPPP     PK 
Sbjct: 142 YYSPSPKVEYKSPPPP-YVYNSPPPPYYSLSPKVDYKSPPPP-YVYNSPPPPYYSPSPKV 199

Query: 278 PYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYK------YKSPPP 421
            YK+ SPPP  Y YNSP PPY  PSP      PPPPY Y SPPPP +       YKSPPP
Sbjct: 200 DYKF-SPPP--YVYNSPSPPYYSPSPKVDYKSPPPPYVYNSPPPPYFSPSPKVDYKSPPP 256

Query: 422 PVYKYKSPPPPAKKPY-------KYPSPPPPVY-------KYKSPPPPV---YSPPPPVY 550
           P Y Y SPPPP   PY        Y SPPPP Y        YKSPPP     + PPPP Y
Sbjct: 257 P-YVYSSPPPP---PYYSPSPEVSYKSPPPPPYYSPSLEVSYKSPPPLFVYNFPPPPPFY 312

Query: 551 ------KYKSPPPPVYS 583
                  YKSPP P  S
Sbjct: 313 SPSPKVSYKSPPAPYVS 329

 Score =  224 bits (571), Expect = 4e-57
 Identities = 130/235 (55%), Positives = 136/235 (57%), Gaps = 42/235 (17%)
 Frame = +2

Query: 2   YKSPPPPP----KKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPV 151
           Y + P PP    ++  KY +P P  Y +NSPPPPY  PSP      PPPPY Y SPPPP 
Sbjct: 59  YSASPLPPLQYRRQGPKY-TPHPKPYLFNSPPPPYYSPSPKEDYKSPPPPYVYNSPPPPY 117

Query: 152 YK------YKSPPPPVYKYKSPPPPVY------KYKSPPPPVYKYKSPPPP-----PKKP 280
           Y       YKSPPPP Y Y SPPPP Y      +YKSPPPP Y Y SPPPP     PK  
Sbjct: 118 YSPSPKVDYKSPPPP-YVYNSPPPPYYSPSPKVEYKSPPPP-YVYNSPPPPYYSLSPKVD 175

Query: 281 YKYPSPPPPVYKYNSPPPPYKYPSPP------PPPYKYPSPPPPVYK------YKSPPPP 424
           YK  SPPPP Y YNSPPPPY  PSP       PPPY Y SP PP Y       YKSPPPP
Sbjct: 176 YK--SPPPP-YVYNSPPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYSPSPKVDYKSPPPP 232

Query: 425 VYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
            Y Y SPPPP   P     Y SPPPP Y Y SPPPP Y  P P   YKSPPPP Y
Sbjct: 233 -YVYNSPPPPYFSPSPKVDYKSPPPP-YVYSSPPPPPYYSPSPEVSYKSPPPPPY 285

 Score =  188 bits (477), Expect = 3e-46
 Identities = 114/214 (53%), Positives = 120/214 (56%), Gaps = 27/214 (12%)
 Frame = +2

Query: 23  PKK--PYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKS 196
           PKK  PY   SP PP+ +Y    P Y   +P P PY + SPPPP Y     P P   YKS
Sbjct: 52  PKKYSPYYSASPLPPL-QYRRQGPKY---TPHPKPYLFNSPPPPYYS----PSPKEDYKS 103

Query: 197 PPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP------P 358
           PPPP Y Y SPPPP Y      P PK  YK  SPPPP Y YNSPPPPY  PSP      P
Sbjct: 104 PPPP-YVYNSPPPPYYS-----PSPKVDYK--SPPPP-YVYNSPPPPYYSPSPKVEYKSP 154

Query: 359 PPPYKYPSPPPPVYK------YKSPPPPVYKYKSPPPPAKKP-----YKYPSPPPPVYKY 505
           PPPY Y SPPPP Y       YKSPPPP Y Y SPPPP   P     YK+ SPPP  Y Y
Sbjct: 155 PPPYVYNSPPPPYYSLSPKVDYKSPPPP-YVYNSPPPPYYSPSPKVDYKF-SPPP--YVY 210

Query: 506 KSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
            SP PP YSP        PPP Y Y SPPPP +S
Sbjct: 211 NSPSPPYYSPSPKVDYKSPPPPYVYNSPPPPYFS 244

 Score =  187 bits (476), Expect = 4e-46
 Identities = 117/243 (48%), Positives = 121/243 (49%), Gaps = 63/243 (25%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPPYKYPSP------PPPPYKY 130
           YKSPPPP     P  PY  PSP      PPP Y YNSPPPPY  PSP      PPPPY Y
Sbjct: 101 YKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVY 160

Query: 131 PSPPPPVYK------YKSPPPPVYKYKSPPPPVYK---------------YKSPPPPVYK 247
            SPPPP Y       YKSPPPP Y Y SPPPP Y                Y SP PP Y 
Sbjct: 161 NSPPPPYYSLSPKVDYKSPPPP-YVYNSPPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYS 219

Query: 248 ------YKSPPPP-----PKKPYKYPSP------PPPVYKYNSPPPP--------YKYPS 352
                 YKSPPPP     P  PY  PSP      PPP Y Y+SPPPP          Y S
Sbjct: 220 PSPKVDYKSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKS 279

Query: 353 PPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYS 532
           PPPPPY  PS       YKS PPP++ Y  PPPP   P+  PSP      YKSPP P  S
Sbjct: 280 PPPPPYYSPSLE---VSYKS-PPPLFVYNFPPPP---PFYSPSPK---VSYKSPPAPYVS 329

Query: 533 PPP 541
             P
Sbjct: 330 KTP 332

 Score =  134 bits (338), Expect = 4e-30
 Identities = 93/219 (42%), Positives = 103/219 (47%), Gaps = 32/219 (14%)
 Frame = +2

Query: 23  PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPP 202
           P   ++ P    PV+K+ S   P KY      PY   SP PP+   +  P    KY +P 
Sbjct: 30  PYSSHQTPQYNSPVHKHESSYSPKKYS-----PYYSASPLPPLQYRRQGP----KY-TPH 79

Query: 203 PPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYK---------YPSP 355
           P  Y + SPPPP Y      P PK+ YK            SPPPPY           PSP
Sbjct: 80  PKPYLFNSPPPPYYS-----PSPKEDYK------------SPPPPYVYNSPPPPYYSPSP 122

Query: 356 ------PPPPYKYPSPPPPVY------KYKSPPPPVYKYKSPPPP---AKKPYKYPSPPP 490
                 PPPPY Y SPPPP Y      +YKSPPPP Y Y SPPPP         Y SPPP
Sbjct: 123 KVDYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPP-YVYNSPPPPYYSLSPKVDYKSPPP 181

Query: 491 PVYKYKSPPPPVYSP--------PPPVYKYKSPPPPVYS 583
           P Y Y SPPPP YSP         PP Y Y SP PP YS
Sbjct: 182 P-YVYNSPPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYS 219

[46][TOP]
>UniRef100_Q01943 Extensin (Class I) (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q01943_SOLLC
          Length = 181

 Score =  223 bits (568), Expect = 9e-57
 Identities = 127/200 (63%), Positives = 128/200 (64%), Gaps = 9/200 (4%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPP
Sbjct: 9   YKSPPPPSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPS---PSPPPPYY-YKSPP 61

Query: 173 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPS 352
           PP     SPPPP Y YKSPPPP     SP PPP  PY Y SPPPP     SPPPPY Y S
Sbjct: 62  PPS---PSPPPPYY-YKSPPPP-----SPSPPP--PYYYKSPPPPS---PSPPPPYYYSS 107

Query: 353 PPPPPYKYPSPPPPVYKYKSP------PPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSP 514
           PPPP     SPPPP Y YKSP      PPP Y YKSPPPP+      PSPPPP Y YKS 
Sbjct: 108 PPPPK---KSPPPPYY-YKSPPPPSPSPPPPYYYKSPPPPS------PSPPPPYY-YKSS 156

Query: 515 PPPVYSPPPPVYKYKSPPPP 574
           PPP  SPPPP Y YKSPPPP
Sbjct: 157 PPPSPSPPPPYY-YKSPPPP 175

 Score =  218 bits (556), Expect = 2e-55
 Identities = 125/196 (63%), Positives = 126/196 (64%), Gaps = 6/196 (3%)
 Frame = +2

Query: 5   KSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           KSPPPP    Y Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPPPP  
Sbjct: 1   KSPPPP----YYYKSPPPPS---PSPPPPYYYKSPPPPS---PSPPPPYY-YKSPPPPS- 48

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
              SPPPP Y YKSPPPP     SP PPP  PY Y SPPPP     SPPPPY Y SPPPP
Sbjct: 49  --PSPPPPYY-YKSPPPP-----SPSPPP--PYYYKSPPPPS---PSPPPPYYYKSPPPP 95

Query: 365 ------PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV 526
                 PY Y SPPPP    KSPPPP Y YKSPPPP+      PSPPPP Y YKSPPPP 
Sbjct: 96  SPSPPPPYYYSSPPPPK---KSPPPPYY-YKSPPPPS------PSPPPPYY-YKSPPPPS 144

Query: 527 YSPPPPVYKYKSPPPP 574
            SPPPP Y YKS PPP
Sbjct: 145 PSPPPPYY-YKSSPPP 159

 Score =  195 bits (496), Expect = 2e-48
 Identities = 113/181 (62%), Positives = 113/181 (62%), Gaps = 13/181 (7%)
 Frame = +2

Query: 77  SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKS 256
           SPPPPY Y SPPPP    PSPPPP Y YKSPPPP     SPPPP Y YKSPPPP     S
Sbjct: 2   SPPPPYYYKSPPPPS---PSPPPPYY-YKSPPPPS---PSPPPPYY-YKSPPPP-----S 48

Query: 257 PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV--- 427
           P PPP  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPPPP    
Sbjct: 49  PSPPP--PYYYKSPPPPS---PSPPPPYYYKSPPPPS---PSPPPPYY-YKSPPPPSPSP 99

Query: 428 ---YKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSP-------PPPV 577
              Y Y SPPPP K      SPPPP Y YKSPPPP  SPPPP Y YKSP       PPP 
Sbjct: 100 PPPYYYSSPPPPKK------SPPPPYY-YKSPPPPSPSPPPPYY-YKSPPPPSPSPPPPY 151

Query: 578 Y 580
           Y
Sbjct: 152 Y 152

 Score =  161 bits (407), Expect = 4e-38
 Identities = 93/146 (63%), Positives = 94/146 (64%), Gaps = 6/146 (4%)
 Frame = +2

Query: 161 KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY 340
           KSPPPP Y YKSPPPP     SPPPP Y YKSPPPP       PSPPPP Y Y SPPPP 
Sbjct: 1   KSPPPPYY-YKSPPPPS---PSPPPPYY-YKSPPPPS------PSPPPPYY-YKSPPPPS 48

Query: 341 KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP 520
             PSPPPP Y Y SPPPP     SPPPP Y YKSPPPP+      PSPPPP Y YKSPPP
Sbjct: 49  --PSPPPP-YYYKSPPPPS---PSPPPPYY-YKSPPPPS------PSPPPPYY-YKSPPP 94

Query: 521 PVYSPPPPVY------KYKSPPPPVY 580
           P  SPPPP Y        KSPPPP Y
Sbjct: 95  PSPSPPPPYYYSSPPPPKKSPPPPYY 120

[47][TOP]
>UniRef100_Q06802 Extensin n=1 Tax=Nicotiana tabacum RepID=Q06802_TOBAC
          Length = 318

 Score =  222 bits (566), Expect = 1e-56
 Identities = 131/243 (53%), Positives = 132/243 (54%), Gaps = 54/243 (22%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPP--PPYKYPSPPPPPYK------YPSPPPPVYKYK 163
           S PPPPKK Y Y SPPPPV+ Y SPP  P YK P PP  PY       Y SPPPP   YK
Sbjct: 31  SSPPPPKKSYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYK 90

Query: 164 SPPPPVYKYKSPPPPVYK----------------YKSPPPPVYKYKSPPPPPKKPY---- 283
           SPPPP   Y  P  PVYK                YKSPPPP   YKS PPPPKKPY    
Sbjct: 91  SPPPPKKPYYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKS-PPPPKKPYYPPH 149

Query: 284 --KYPSPPPPVYKYNSPPP---PYKYPSPP----PPPYKYPSPPPPVYKYKSPPPPVYKY 436
              Y SPPPP   Y SPPP   PY  P  P    PPP K P  PP    YKSPPPP   Y
Sbjct: 150 TPVYKSPPPPTPVYKSPPPHKKPYYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVY 209

Query: 437 KSPPPPAKKPY------KYPSPPPPVYKYKSPPP----------PVY-SPPPPVYKYKSP 565
           KSPPPP KKPY       Y SPPPP   YKSPPP          PVY SPPPP   YKSP
Sbjct: 210 KSPPPP-KKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPYTPVYKSPPPPTPVYKSP 268

Query: 566 PPP 574
           PPP
Sbjct: 269 PPP 271

 Score =  217 bits (552), Expect = 6e-55
 Identities = 136/263 (51%), Positives = 137/263 (52%), Gaps = 70/263 (26%)
 Frame = +2

Query: 2   YKSPPPPPKKPYK------YPSPPPPVYKYNSPPPPYK---------YPSPPPP--PYK- 127
           YKSPPPP KKPY       Y SPPPP   Y SPPPP K         Y SPPPP  PY  
Sbjct: 61  YKSPPPP-KKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPKKPYYP 119

Query: 128 -----YPSPPPPVYKYKSPPPP--------VYKYKSPPPPVYKYKSPPP----------P 238
                Y SPPPP   YKSPPPP           YKSPPPP   YKSPPP          P
Sbjct: 120 PHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPHKKPYYPPHTP 179

Query: 239 VYKYKSPPPPPKKPY------KYPSPPPPVYKYNSPPPPYK---------YPSPPPPPYK 373
           VYK    PPPPKKPY       Y SPPPP   Y SPPPP K         Y SPPPP   
Sbjct: 180 VYK---SPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPV 236

Query: 374 YPSPPPP--------VYKYKSPPPPVYKYKSPPPPAKKPYKYPSP----PPPVYKYKSPP 517
           Y SPPPP           YKSPPPP   YKSPPPP KKPY YPSP    P PVYK   PP
Sbjct: 237 YKSPPPPKKPYYPPYTPVYKSPPPPTPVYKSPPPP-KKPY-YPSPTPYHPAPVYKSPPPP 294

Query: 518 PPVYSPPPP--VYKYKSPPPPVY 580
            PVY  PPP   Y Y SPP P +
Sbjct: 295 TPVYKSPPPHHPYVYASPPSPYH 317

 Score =  169 bits (427), Expect = 2e-40
 Identities = 108/219 (49%), Positives = 110/219 (50%), Gaps = 61/219 (27%)
 Frame = +2

Query: 2   YKSPPPPPKKPYK------YPSPPPPVYKYNSPPPPYK---------YPSPPPPPYKYPS 136
           YKSPPPP KKPY       Y SPPPP   Y SPPPP K         Y SPPPP   Y S
Sbjct: 107 YKSPPPP-KKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKS 165

Query: 137 PPP----------PVYK----------------YKSPPPPVYKYKSPPPPVYKY------ 220
           PPP          PVYK                YKSPPPP   YKSPPPP   Y      
Sbjct: 166 PPPHKKPYYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTP 225

Query: 221 --KSPPPPVYKYKSPPPPPKKPYK------YPSPPPPVYKYNSPPPPYK--YPSPPP--- 361
             KSPPPP   YKSPPPP KKPY       Y SPPPP   Y SPPPP K  YPSP P   
Sbjct: 226 VYKSPPPPTPVYKSPPPP-KKPYYPPYTPVYKSPPPPTPVYKSPPPPKKPYYPSPTPYHP 284

Query: 362 -PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKY 475
            P YK P PP PVYK    PPP + Y    PP+  PY Y
Sbjct: 285 APVYKSPPPPTPVYK---SPPPHHPYVYASPPS--PYHY 318

 Score =  113 bits (283), Expect = 1e-23
 Identities = 64/115 (55%), Positives = 67/115 (58%), Gaps = 27/115 (23%)
 Frame = +2

Query: 311 YKYNSPPPP---YKYPSPPPPPYKYPSPP-PPVYK----------------YKSPPPPVY 430
           Y+Y+SPPPP   Y Y SPPPP + YPSPP  PVYK                YKSPPPP  
Sbjct: 28  YQYSSPPPPKKSYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYYPPHTPVYKSPPPPTP 87

Query: 431 KYKSPPPPAKKPY------KYPSPPPPVYKYKSPPPPVY-SPPPPVYKYKSPPPP 574
            YKSPPPP KKPY       Y SPPPP   Y  P  PVY SPPPP   YKSPPPP
Sbjct: 88  VYKSPPPP-KKPYYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPP 141

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 54/85 (63%), Positives = 56/85 (65%), Gaps = 4/85 (4%)
 Frame = +2

Query: 338 YKYPSPPPPP--YKYPSPPPPVYKYKSPPP-PVYKYKSPPPPAKKPYKYPSPPPPVYKYK 508
           Y+Y SPPPP   Y Y SPPPPV+ Y SPP  PVYK  SPPPP KKPY YP P  PVYK  
Sbjct: 28  YQYSSPPPPKKSYLYKSPPPPVHVYPSPPHHPVYK--SPPPP-KKPY-YP-PHTPVYKSP 82

Query: 509 SPPPPVY-SPPPPVYKYKSPPPPVY 580
            PP PVY SPPPP   Y  P  PVY
Sbjct: 83  PPPTPVYKSPPPPKKPYYPPHTPVY 107

[48][TOP]
>UniRef100_Q7DLZ6 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata
           RepID=Q7DLZ6_VIGUN
          Length = 164

 Score =  221 bits (562), Expect = 4e-56
 Identities = 125/198 (63%), Positives = 126/198 (63%), Gaps = 8/198 (4%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           P PPP  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPPPP    
Sbjct: 1   PSPPP--PYYYKSPPPPS---PSPPPPYVYKSPPPPS---PSPPPPYY-YKSPPPPS--- 48

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
            SPPPP Y YKSPPPP     SP PPP  PY Y SPPPP     SPPPPY Y SPPPP  
Sbjct: 49  PSPPPPYY-YKSPPPP-----SPSPPP--PYYYKSPPPP---SPSPPPPYYYKSPPPPS- 96

Query: 371 KYPSPPPPVYKYKSP------PPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYS 532
             PSPPPP Y YKSP      PPP Y YKSPPPP+      PSPPPP Y YKSPPPP  S
Sbjct: 97  --PSPPPP-YVYKSPPPPSPSPPPPYYYKSPPPPS------PSPPPPYY-YKSPPPPSPS 146

Query: 533 PPPPVYK--YKSPPPPVY 580
           PPPP Y   Y SPPPP Y
Sbjct: 147 PPPPYYPYLYNSPPPPAY 164

 Score =  133 bits (335), Expect = 9e-30
 Identities = 78/132 (59%), Positives = 78/132 (59%), Gaps = 9/132 (6%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPV------YKYNSPPPPYKYPSPPPPPYKYPSPPPPVY 154
           YKSPPPP   P  PY Y SPPPP       Y Y SPPPP   PS PPPPY Y SPPPP  
Sbjct: 57  YKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPS--PS-PPPPYVYKSPPPP-- 111

Query: 155 KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPP 334
              SPPPP Y YKSPPPP     SPPPP Y YKSPPPP       PSPPPP Y       
Sbjct: 112 -SPSPPPPYY-YKSPPPP---SPSPPPPYY-YKSPPPPS------PSPPPPYY------- 152

Query: 335 PYKYPSPPPPPY 370
           PY Y SPPPP Y
Sbjct: 153 PYLYNSPPPPAY 164

[49][TOP]
>UniRef100_Q38913-2 Isoform 2 of Extensin-1 n=1 Tax=Arabidopsis thaliana RepID=Q38913-2
          Length = 246

 Score =  221 bits (562), Expect = 4e-56
 Identities = 133/234 (56%), Positives = 140/234 (59%), Gaps = 41/234 (17%)
 Frame = +2

Query: 2   YKSPPPPPKKPYK----YPSPPPPVYKYNSPPPPYKYPSPP----PPPYKYPSPPPPVYK 157
           + S PPPP K Y     Y SPPPPV K+ SPPP YK P PP     PP  Y SPPPPV K
Sbjct: 22  FYSSPPPPVKHYSPPPVYKSPPPPV-KHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPV-K 79

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSP-----PPPPKKPYK----YPSPPPPV 310
           Y SPPP    YKSPPPPV  YKSPPPPV  Y  P     PPPP K Y     Y SPPPPV
Sbjct: 80  YYSPPP---VYKSPPPPV--YKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPV 134

Query: 311 YKYNSPPPPYKYPSPP-----PPPYKYPSPPPPVY------KYKSPPPPVY------KYK 439
            K+ SPPP YK P PP     PPP  Y SPPPPV+       Y SPPPPV+       Y 
Sbjct: 135 -KHYSPPPVYKSPPPPVKHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYH 193

Query: 440 SPPPPAKKPYKYPSPPPPVY-----KYKSPPPPV--YSPPPPVYKYKSPPPPVY 580
           SPPPP KK Y+Y SPPPPV+      Y SPPPPV  YSPP   Y YKSPPPP Y
Sbjct: 194 SPPPP-KKHYEYKSPPPPVHYSPPTVYHSPPPPVHHYSPPHQPYLYKSPPPPHY 246

 Score =  192 bits (488), Expect = 2e-47
 Identities = 118/192 (61%), Positives = 124/192 (64%), Gaps = 10/192 (5%)
 Frame = +2

Query: 35  YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVY 214
           Y Y SPPPPV K+ SPPP YK    PPPP K+ SPPP    YKSPPPPV  Y   PPPVY
Sbjct: 21  YFYSSPPPPV-KHYSPPPVYK---SPPPPVKHYSPPPV---YKSPPPPVKHYS--PPPVY 71

Query: 215 KYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPP 394
           K  SPPPPV KY SPPP       Y SPPPPVYK  SPPPP K+ SPPP    Y SPPPP
Sbjct: 72  K--SPPPPV-KYYSPPPV------YKSPPPPVYK--SPPPPVKHYSPPPV---YKSPPPP 117

Query: 395 VYKYKSPPPPVYKYKSPPPPAKK---PYKYPSPPPPVYKYKSPPPPVY-SPPPPVY---- 550
           V  Y   PPPVYK  SPPPP K    P  Y SPPPPV K+ SPPP VY SPPPPV+    
Sbjct: 118 VKHYS--PPPVYK--SPPPPVKHYSPPPVYKSPPPPV-KHYSPPPVVYHSPPPPVHYSPP 172

Query: 551 --KYKSPPPPVY 580
              Y SPPPPV+
Sbjct: 173 PVVYHSPPPPVH 184

[50][TOP]
>UniRef100_Q40502 Extensin n=1 Tax=Nicotiana tabacum RepID=Q40502_TOBAC
          Length = 280

 Score =  220 bits (560), Expect = 7e-56
 Identities = 130/251 (51%), Positives = 134/251 (53%), Gaps = 60/251 (23%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPP--PPYKYPSPPPPPYKYPSPPP--PVYKYKSPPP 175
           S PPPPKKPY Y SPPPPV+ Y SPP  P YK P PP  PY +PSP P  PV  YKSPPP
Sbjct: 31  SSPPPPKKPYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPY-HPSPTPYHPVPVYKSPPP 89

Query: 176 PVYKYKSPPPPVYK----------------YKSPPPPVYKYKSP---------------- 259
           P   Y  P PPVYK                YKSPPPP   YKSP                
Sbjct: 90  PKKPYYPPHPPVYKSPPPPKKPYSLPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPIYK 149

Query: 260 -PPPPKKPY------KYPSPPPPVYKYNSPPPPYKYPSPP-------PPPYKYPSPPPPV 397
            PPPP KPY       Y SPPPP   Y SPPPP K   PP       PPP K P  PP  
Sbjct: 150 SPPPPNKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHT 209

Query: 398 YKYKSPPPPVYKYKSPPPPAKKPY------KYPSPPPPVYKYKSPPP--PVYSPPPP--V 547
             YKSPPPP   YKS PPP+KKPY       Y SPPPP   YKSPPP  PVY  PPP   
Sbjct: 210 PVYKSPPPPTPVYKS-PPPSKKPYYPPHTPVYKSPPPPTPVYKSPPPPTPVYKSPPPHHP 268

Query: 548 YKYKSPPPPVY 580
           Y Y SPPPP +
Sbjct: 269 YVYASPPPPYH 279

 Score =  172 bits (435), Expect = 2e-41
 Identities = 110/184 (59%), Positives = 112/184 (60%), Gaps = 23/184 (12%)
 Frame = +2

Query: 92  YKYPSPPPP--PYKYPSPPPPVYKYKSPPP-PVYKYKSPPPPVYKYK-SPPP--PVYKYK 253
           Y+Y SPPPP  PY Y SPPPPV+ Y SPP  PVYK  SPPPP   Y  SP P  PV  YK
Sbjct: 28  YQYSSPPPPKKPYLYKSPPPPVHVYPSPPHHPVYK--SPPPPKKPYHPSPTPYHPVPVYK 85

Query: 254 SPPPPPKKPYKYPSPPPPVYKYNSPPPPYK-YPSPPPPPYKYPSPPPPVYKYKSPPPPVY 430
           SPPPP KKPY YP P PPVYK  SPPPP K Y  P  P YK P PP PV  YKSPPPP  
Sbjct: 86  SPPPP-KKPY-YP-PHPPVYK--SPPPPKKPYSLPHTPVYKSPPPPTPV--YKSPPPPKK 138

Query: 431 K--------YKSPPPPAKKPYK-----YPSPPPPVYKYKSPPPPV---YSPPPPVYKYKS 562
                    YKSPPPP K  Y      Y SPPPP   YKSPPPP    Y P  PV  YKS
Sbjct: 139 PHYPPHTPIYKSPPPPNKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPV--YKS 196

Query: 563 PPPP 574
           PPPP
Sbjct: 197 PPPP 200

 Score =  150 bits (380), Expect = 5e-35
 Identities = 94/180 (52%), Positives = 95/180 (52%), Gaps = 47/180 (26%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYP------SPPPPVYKYNSPPPPYK---------YPSPPPP--PYK- 127
           YKSPPPP KKPY  P      SPPPP   Y SPPPP K         Y SPPPP  PY  
Sbjct: 102 YKSPPPP-KKPYSLPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPIYKSPPPPNKPYYP 160

Query: 128 -----YPSPPPPVYKYKSPPPPVYK--------YKSPPPPVYKY--------KSPPPPVY 244
                Y SPPPP   YKSPPPP           YKSPPPP   Y        KSPPPP  
Sbjct: 161 PHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTP 220

Query: 245 KYKSPPPPPKKPYK------YPSPPPPVYKYNSPPPPYK-YPSPPP-PPYKYPSPPPPVY 400
            YKSPPP  KKPY       Y SPPPP   Y SPPPP   Y SPPP  PY Y SPPPP +
Sbjct: 221 VYKSPPPS-KKPYYPPHTPVYKSPPPPTPVYKSPPPPTPVYKSPPPHHPYVYASPPPPYH 279

 Score =  128 bits (321), Expect = 4e-28
 Identities = 74/135 (54%), Positives = 74/135 (54%), Gaps = 20/135 (14%)
 Frame = +2

Query: 2   YKSPPPPPKKPYK-----YPSPPPPVYKYNSPPPPYKYPSPP-------PPPYKYPSPPP 145
           YKSPPPP K  Y      Y SPPPP   Y SPPPP K   PP       PPP K P  PP
Sbjct: 148 YKSPPPPNKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPP 207

Query: 146 PVYKYKSPPPPVYKYKSPPP---PVYK-----YKSPPPPVYKYKSPPPPPKKPYKYPSPP 301
               YKSPPPP   YKSPPP   P Y      YKSPPPP   YKS PPPP   YK P P 
Sbjct: 208 HTPVYKSPPPPTPVYKSPPPSKKPYYPPHTPVYKSPPPPTPVYKS-PPPPTPVYKSPPPH 266

Query: 302 PPVYKYNSPPPPYKY 346
            P Y Y SPPPPY Y
Sbjct: 267 HP-YVYASPPPPYHY 280

[51][TOP]
>UniRef100_Q38913 Extensin-1 n=1 Tax=Arabidopsis thaliana RepID=EXTN1_ARATH
          Length = 373

 Score =  219 bits (558), Expect = 1e-55
 Identities = 135/234 (57%), Positives = 138/234 (58%), Gaps = 41/234 (17%)
 Frame = +2

Query: 2   YKSPPPPPKK---PYKYPSPPPPVYKYNSPPPPYKYPSPP----PPPYKYPSPPPPVYKY 160
           YKSPPPP K    P  Y SPPPPV K+ SPPP YK P PP     PP  Y SPPPPVYK 
Sbjct: 39  YKSPPPPVKHYSPPPVYKSPPPPV-KHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYK- 96

Query: 161 KSPPPPVYKY------KSPPPPVYKY------KSPPPPVYKYKSPP-----PPPKKPYK- 286
            SPPPPV  Y      KSPPPPV  Y      KSPPPPV  Y  PP     PPP K Y  
Sbjct: 97  -SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 155

Query: 287 ---YPSPPPPVYKYNSPPPPYKYPSPP----PPPYKYPSPPPPVYKYKSPPPPVYKYKSP 445
              Y SPPPPV KY SPPP YK P PP     PP  Y SPPPPV KY SPPP    YKSP
Sbjct: 156 PPVYKSPPPPV-KYYSPPPVYKSPPPPVKHYSPPPVYKSPPPPV-KYYSPPPV---YKSP 210

Query: 446 PPPAKK---PYKYPSPPPPVYKY------KSPPPPVYSPPPPVYKYKSPPPPVY 580
           PPP K    P  Y SPPPPV  Y      KSPPPPV+  PPPV  Y SPPPPV+
Sbjct: 211 PPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVHYSPPPVV-YHSPPPPVH 263

 Score =  216 bits (551), Expect = 8e-55
 Identities = 133/236 (56%), Positives = 139/236 (58%), Gaps = 43/236 (18%)
 Frame = +2

Query: 2   YKSPPPPPK---KPYKYPSPPPPVYKYNSPPPPYKYPSPPP------PPYKYPSPPPPVY 154
           YKSPPPP K    P  Y SPPPPVYK  SPPPP K+ SPPP      PP K+ SPPP   
Sbjct: 71  YKSPPPPVKYYSPPPVYKSPPPPVYK--SPPPPVKHYSPPPVYKSPPPPVKHYSPPPV-- 126

Query: 155 KYKSPPPPVYKY------KSPPPPVYKY------KSPPPPVYKYKSPP-----PPPKKPY 283
            YKSPPPPV  Y      KSPPPPV  Y      KSPPPPV  Y  PP     PPP K Y
Sbjct: 127 -YKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVKHY 185

Query: 284 K----YPSPPPPVYKYNSPPPPYKYPSPP----PPPYKYPSPPPPVYKYKSPPPPVYKYK 439
                Y SPPPPV KY SPPP YK P PP     PP  Y SPPPPV KY SPPP    YK
Sbjct: 186 SPPPVYKSPPPPV-KYYSPPPVYKSPPPPVKHYSPPPVYKSPPPPV-KYYSPPPV---YK 240

Query: 440 SPPPP---AKKPYKYPSPPPPVYK------YKSPPPPVYSPPPPVYKYKSPPPPVY 580
           SPPPP   +  P  Y SPPPPV+       Y SPPPPV+  PPPV  Y SPPPPV+
Sbjct: 241 SPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVV-YHSPPPPVH 295

 Score =  216 bits (550), Expect = 1e-54
 Identities = 134/255 (52%), Positives = 142/255 (55%), Gaps = 62/255 (24%)
 Frame = +2

Query: 2   YKSPPPPPKK---PYKYPSPPPPVYKYN------SPPPPYKYPSPPP------PPYKYPS 136
           YKSPPPP K    P  Y SPPPPV  Y+      SPPPP KY SPPP      PP K+ S
Sbjct: 127 YKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVKHYS 186

Query: 137 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP-----PPPKKPYK----Y 289
           PPP    YKSPPPPV KY SPPP    YKSPPPPV  Y  PP     PPP K Y     Y
Sbjct: 187 PPPV---YKSPPPPV-KYYSPPPV---YKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVY 239

Query: 290 PSPPPPVYK------YNSPPPPYKYPSPP-------------PPPYKYPSPPPPVYK--- 403
            SPPPPV+       Y+SPPPP  Y  PP             PPP  Y SPPPPV+    
Sbjct: 240 KSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPP 299

Query: 404 ---YKSPPPPVYK------YKSPPPPAKKPYKYPSPPPPVYK-----YKSPPPPV--YSP 535
              Y SPPPPV+       Y SPPPP KK Y+Y SPPPPV+      Y SPPPPV  YSP
Sbjct: 300 PVVYHSPPPPVHYSPPPVVYHSPPPP-KKHYEYKSPPPPVHYSPPTVYHSPPPPVHHYSP 358

Query: 536 PPPVYKYKSPPPPVY 580
           P   Y YKSPPPP Y
Sbjct: 359 PHQPYLYKSPPPPHY 373

 Score =  216 bits (549), Expect = 1e-54
 Identities = 135/237 (56%), Positives = 139/237 (58%), Gaps = 44/237 (18%)
 Frame = +2

Query: 2   YKSPPPPPKK---PYKYPSPPPPVYKYNSPPPPYKYPSPP----PPPYKYPSPPPPVYKY 160
           Y SPPPP K    P  Y SPPPPV K+ SPPP YK P PP     PP  Y SPPPPV KY
Sbjct: 23  YSSPPPPVKHYSPPPVYKSPPPPV-KHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPV-KY 80

Query: 161 KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP-----PPPKKPYK----YPSPPPPVY 313
            SPPP    YKSPPPPVYK  SPPPPV  Y  PP     PPP K Y     Y SPPPPV 
Sbjct: 81  YSPPPV---YKSPPPPVYK--SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVK 135

Query: 314 KYN------SPPPPYKYPSPPP------PPYKYPSPPPPVYKYKSPPPPVYK------YK 439
            Y+      SPPPP K+ SPPP      PP KY SPPP    YKSPPPPV        YK
Sbjct: 136 HYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPV---YKSPPPPVKHYSPPPVYK 192

Query: 440 SPPPPAK---KPYKYPSPPPPVYK------YKSPPPPV-YSPPPPVYKYKSPPPPVY 580
           SPPPP K    P  Y SPPPPV        YKSPPPPV Y  PPPV  YKSPPPPV+
Sbjct: 193 SPPPPVKYYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPV--YKSPPPPVH 247

 Score =  215 bits (548), Expect = 2e-54
 Identities = 133/239 (55%), Positives = 141/239 (58%), Gaps = 46/239 (19%)
 Frame = +2

Query: 2   YKSPPPPPKK---PYKYPSPPPPVYKYN------SPPPPYKYPSPPP------PPYKYPS 136
           YKSPPPP K    P  Y SPPPPV  Y+      SPPPP K+ SPPP      PP KY S
Sbjct: 111 YKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYS 170

Query: 137 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSP-----PPPPKKPYK----Y 289
           PPP    YKSPPPPV  Y   PPPVYK  SPPPPV  Y  P     PPPP K Y     Y
Sbjct: 171 PPPV---YKSPPPPVKHYS--PPPVYK--SPPPPVKYYSPPPVYKSPPPPVKHYSPPPVY 223

Query: 290 PSPPPPVYKYNSPPPPYKYPSPP----PPPYKYPSPPPPVY------KYKSPPPPVY--- 430
            SPPPPV KY SPPP YK P PP    PPP  Y SPPPPV+       Y SPPPPV+   
Sbjct: 224 KSPPPPV-KYYSPPPVYKSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSP 282

Query: 431 ---KYKSPPPP---AKKPYKYPSPPPPVYKYKSPPPPVY-SPPPPV--YKYKSPPPPVY 580
               Y SPPPP   +  P  Y SPPPPV  + SPPP VY SPPPP   Y+YKSPPPPV+
Sbjct: 283 PPVVYHSPPPPVHYSPPPVVYHSPPPPV--HYSPPPVVYHSPPPPKKHYEYKSPPPPVH 339

 Score =  197 bits (502), Expect = 4e-49
 Identities = 123/207 (59%), Positives = 127/207 (61%), Gaps = 15/207 (7%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           + S PPPP K Y     PPPVYK  SPPPP K+ SPPP    Y SPPPPV  Y   PPPV
Sbjct: 22  FYSSPPPPVKHYS----PPPVYK--SPPPPVKHYSPPPV---YKSPPPPVKHYS--PPPV 70

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
           YK  SPPPPV KY SPPP    YKSPPPP      Y SPPPPV K+ SPPP YK    PP
Sbjct: 71  YK--SPPPPV-KYYSPPPV---YKSPPPPV-----YKSPPPPV-KHYSPPPVYK---SPP 115

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYK------YKSPPPPAK---KPYKYPSPPPPVYKYKSP 514
           PP K+ SPPP    YKSPPPPV        YKSPPPP K    P  Y SPPPPV KY SP
Sbjct: 116 PPVKHYSPPPV---YKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPV-KYYSP 171

Query: 515 PPPVYSPPPPVYK------YKSPPPPV 577
           PP   SPPPPV        YKSPPPPV
Sbjct: 172 PPVYKSPPPPVKHYSPPPVYKSPPPPV 198

 Score =  169 bits (429), Expect = 1e-40
 Identities = 106/180 (58%), Positives = 110/180 (61%), Gaps = 9/180 (5%)
 Frame = +2

Query: 65  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 244
           Y Y+SPPPP K+ SPPP              YKSPPPPV  Y   PPPVYK  SPPPPV 
Sbjct: 21  YFYSSPPPPVKHYSPPPV-------------YKSPPPPVKHYS--PPPVYK--SPPPPV- 62

Query: 245 KYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 424
           K+ SPPP       Y SPPPPV KY SPPP YK  SPPPP YK  SPPPPV  Y   PPP
Sbjct: 63  KHYSPPPV------YKSPPPPV-KYYSPPPVYK--SPPPPVYK--SPPPPVKHYS--PPP 109

Query: 425 VYKYKSPPPPAKK---PYKYPSPPPPVYKYKSPPPPVYSPPPPVYK------YKSPPPPV 577
           VYK  SPPPP K    P  Y SPPPPV K+ SPPP   SPPPPV        YKSPPPPV
Sbjct: 110 VYK--SPPPPVKHYSPPPVYKSPPPPV-KHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPV 166

 Score = 79.0 bits (193), Expect = 3e-13
 Identities = 48/86 (55%), Positives = 50/86 (58%), Gaps = 15/86 (17%)
 Frame = +2

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV-YSPPPP 544
           Y Y SPPPPV  Y   PPPVYK  SPPPP K    + SPPP    YKSPPPPV +  PPP
Sbjct: 21  YFYSSPPPPVKHYS--PPPVYK--SPPPPVK----HYSPPPV---YKSPPPPVKHYSPPP 69

Query: 545 VYK--------------YKSPPPPVY 580
           VYK              YKSPPPPVY
Sbjct: 70  VYKSPPPPVKYYSPPPVYKSPPPPVY 95

[52][TOP]
>UniRef100_Q40402 Extensin (ext) n=1 Tax=Nicotiana plumbaginifolia RepID=Q40402_NICPL
          Length = 416

 Score =  218 bits (556), Expect = 2e-55
 Identities = 143/309 (46%), Positives = 144/309 (46%), Gaps = 117/309 (37%)
 Frame = +2

Query: 2   YKSPPP---------PPKKPY------KYPSPPPPVYKYNSPPPPYKYPSPP-PPPYKYP 133
           YKSPPP         PPKKPY       Y SPPPP   Y SPPPP K   PP  P YK P
Sbjct: 53  YKSPPPPIPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSP 112

Query: 134 SPPPPVYK----------------YKSPPPPVYKYKSPPPP--------VYKYKSPPPPV 241
            PP PVYK                YKSPPPP   YKSPPPP           YKSPPPP 
Sbjct: 113 PPPTPVYKSPPSPKKPHYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPT 172

Query: 242 YKYKSP-----------------PPPPKKPY------KYPSPPPPVYKYNSPPPPYK--Y 346
             YKSP                 PPPPKKPY       Y SPPPP   Y SPPPP K  +
Sbjct: 173 PVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYH 232

Query: 347 PSP----PPPPYKYPSPPPPVYK---------------------YKSPPPPVYKYKSPPP 451
           PSP    P P YK P PP PVYK                     YKSPPPP   YKSPPP
Sbjct: 233 PSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPP 292

Query: 452 PAKKPYK-----------YPSPPPPVYKYKSPPP---------------PVY-SPPPPVY 550
           P KKPY            Y SPPPP   YKSPPP               PVY SPPPP  
Sbjct: 293 P-KKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPAPVYKSPPPPTP 351

Query: 551 KYKSPPPPV 577
            YKSPPPPV
Sbjct: 352 VYKSPPPPV 360

 Score =  216 bits (549), Expect = 1e-54
 Identities = 121/225 (53%), Positives = 123/225 (54%), Gaps = 32/225 (14%)
 Frame = +2

Query: 2   YKSPPPPPKKPYK------YPSPPPPVYKYNSPPPPYKYPSPPPPPYK----YPSPPPPV 151
           YKSPPPP KKPY       Y SPPPP   Y SPPPP K   P P PY     Y SPPPP 
Sbjct: 193 YKSPPPP-KKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPT 251

Query: 152 YKYKSPPPPVYKYKSPPPPVYK---YKSPPPPVYKYKSPPPPPKKPYK-----------Y 289
             YKSPPPP   Y   P P +    YKSPPPP   YKSPPPP KKPY            Y
Sbjct: 252 PVYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPP-KKPYHPSPTPYHPSPVY 310

Query: 290 PSPPPPVYKYNSPPPPYKYPSPPPPPYK----YPSPPPPVYKYKSPPPPVYKYKSPPPPA 457
            SPPPP   Y SPPPP K   P P PY     Y SPPPP   YKSPPPPV  Y   P P 
Sbjct: 311 KSPPPPTPVYKSPPPPKKPYHPSPTPYHPAPVYKSPPPPTPVYKSPPPPVKPYHPSPTPY 370

Query: 458 KKPYKYPSPPPPVYKYKSPPPP--VYSPPPP--VYKYKSPPPPVY 580
                Y SPPPP   YKSPPPP  VY  PPP   Y Y SPPPP +
Sbjct: 371 HPAPVYKSPPPPTPVYKSPPPPTPVYKSPPPHHPYVYASPPPPYH 415

 Score =  215 bits (548), Expect = 2e-54
 Identities = 130/264 (49%), Positives = 131/264 (49%), Gaps = 75/264 (28%)
 Frame = +2

Query: 8   SPPPPPKKPYK-----------YPSPPPPVYKYNSPPPPYK---------YPSPPPPPYK 127
           S PPPPKKPY            Y SPPPP+  Y SPPPP K         Y SPPPP   
Sbjct: 31  SSPPPPKKPYHPSPTPYYPAPVYKSPPPPIPVYKSPPPPKKPYYPPHTPVYKSPPPPTPV 90

Query: 128 YPSPPPP--------VYKYKSPPPPVYKYKSPPPP--------VYKYKSPPPPVYKYKSP 259
           Y SPPPP           YKSPPPP   YKSPP P           YKSPPPP   YKSP
Sbjct: 91  YKSPPPPKKPHYPPHTPVYKSPPPPTPVYKSPPSPKKPHYPPHTPVYKSPPPPTPVYKSP 150

Query: 260 PPPPKKPYK-----YPSPPPPVYKYNSPPPPYKYPSPP-------PPPYKYPSPPPPVYK 403
           PPP K  Y      Y SPPPP   Y SPPPP K   PP       PPP K P  PP    
Sbjct: 151 PPPKKPHYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPV 210

Query: 404 YKSPPPPVYKYKSPPPPAKKPYK-----------YPSPPPPVYKYKSPPP---------- 520
           YKSPPPP   YKSPPPP KKPY            Y SPPPP   YKSPPP          
Sbjct: 211 YKSPPPPTPVYKSPPPP-KKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPT 269

Query: 521 -----PVY-SPPPPVYKYKSPPPP 574
                PVY SPPPP   YKSPPPP
Sbjct: 270 PYHPSPVYKSPPPPTPVYKSPPPP 293

 Score =  179 bits (455), Expect = 1e-43
 Identities = 110/190 (57%), Positives = 116/190 (61%), Gaps = 10/190 (5%)
 Frame = +2

Query: 35  YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVY 214
           Y+Y SPPPP   Y+  P PY YP+P      Y SPPPP+  YKSPPPP   Y  P  PVY
Sbjct: 28  YQYSSPPPPKKPYHPSPTPY-YPAPV-----YKSPPPPIPVYKSPPPPKKPYYPPHTPVY 81

Query: 215 KYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYK-YPSPPPPPYKYPSPPP 391
           K  SPPPP   YKSPPPP KKP+ YP P  PVYK  SPPPP   Y SPP P  K P  PP
Sbjct: 82  K--SPPPPTPVYKSPPPP-KKPH-YP-PHTPVYK--SPPPPTPVYKSPPSP--KKPHYPP 132

Query: 392 PVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY-SPPPP-------- 544
               YKSPPPP   YKSPPPP KKP+ YP P  PVYK   PP PVY SPPPP        
Sbjct: 133 HTPVYKSPPPPTPVYKSPPPP-KKPH-YP-PHTPVYKSPPPPTPVYKSPPPPKKPHYPPH 189

Query: 545 VYKYKSPPPP 574
              YKSPPPP
Sbjct: 190 TPVYKSPPPP 199

 Score =  130 bits (328), Expect = 6e-29
 Identities = 73/133 (54%), Positives = 74/133 (55%), Gaps = 18/133 (13%)
 Frame = +2

Query: 2   YKSPPPPPKKPYK-----------YPSPPPPVYKYNSPPPPYKYPSPPPPPYK----YPS 136
           YKSPPPP KKPY            Y SPPPP   Y SPPPP K   P P PY     Y S
Sbjct: 287 YKSPPPP-KKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPAPVYKS 345

Query: 137 PPPPVYKYKSPPPPVYKYKSPPPPVYK---YKSPPPPVYKYKSPPPPPKKPYKYPSPPPP 307
           PPPP   YKSPPPPV  Y   P P +    YKSPPPP   YKS PPPP   YK P P  P
Sbjct: 346 PPPPTPVYKSPPPPVKPYHPSPTPYHPAPVYKSPPPPTPVYKS-PPPPTPVYKSPPPHHP 404

Query: 308 VYKYNSPPPPYKY 346
            Y Y SPPPPY Y
Sbjct: 405 -YVYASPPPPYHY 416

 Score =  125 bits (313), Expect = 3e-27
 Identities = 71/124 (57%), Positives = 73/124 (58%), Gaps = 11/124 (8%)
 Frame = +2

Query: 242 YKYKSPPPPPKKPYKYPSPPP--PVYKYNSPPPPYK-YPSPPPPPYKYPSPPPPVYKYKS 412
           Y+Y SPPPP KKPY +PSP P  P   Y SPPPP   Y SPPPP   Y  P  PVYK  S
Sbjct: 28  YQYSSPPPP-KKPY-HPSPTPYYPAPVYKSPPPPIPVYKSPPPPKKPYYPPHTPVYK--S 83

Query: 413 PPPPVYKYKSPPPPAKKPYK-----YPSPPPPVYKYKSPPPPV---YSPPPPVYKYKSPP 568
           PPPP   YKSPPPP K  Y      Y SPPPP   YKSPP P    Y P  PVYK   PP
Sbjct: 84  PPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPTPVYKSPPSPKKPHYPPHTPVYKSPPPP 143

Query: 569 PPVY 580
            PVY
Sbjct: 144 TPVY 147

[53][TOP]
>UniRef100_Q9STN0 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9STN0_ARATH
          Length = 437

 Score =  218 bits (555), Expect = 3e-55
 Identities = 127/239 (53%), Positives = 132/239 (55%), Gaps = 48/239 (20%)
 Frame = +2

Query: 8   SPPP----PPKKPYKYPSPP-----PPVYKYNSPPPPYKYPSPP-----PPPYKYPSPPP 145
           SPPP    PP  PY Y SPP     PP Y Y+ PP PY Y SPP     PPPY Y SPPP
Sbjct: 208 SPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAY-SPPP 266

Query: 146 PVYKYKSPP-----PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP----PPKKPYKYPSP 298
             Y YKSPP     PP Y Y SPPP  Y YKSPP   Y Y SPPP    PP  PY Y SP
Sbjct: 267 SPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPP---YVYSSPPPYAYSPPPSPYVYKSP 322

Query: 299 P-----PPVYKYNSPPPPYKYPSPP-----PPPYKYPSPPPPVYKYKSPPPPVYKYKSPP 448
           P     PP Y Y+ PP PY Y SPP     PPPY Y SPPP  Y YKSPP   Y Y SPP
Sbjct: 323 PYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPP---YVYSSPP 378

Query: 449 PP--AKKPYKYPSPP-------PPVYKYKSPPPPVYSPPP------PVYKYKSPPPPVY 580
           P   +  PY Y  PP       PP Y Y SPPP VY+PPP      P Y Y SPPPP+Y
Sbjct: 379 PYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPPSPSYSYSSPPPPIY 437

 Score =  214 bits (546), Expect = 3e-54
 Identities = 132/251 (52%), Positives = 135/251 (53%), Gaps = 57/251 (22%)
 Frame = +2

Query: 2   YKSPPP----PPKKPYKYPSPP------------PPVYKYNSPPPPYKYPSPP-----PP 118
           Y SPPP    PP  PY Y SPP            PP Y Y+ PP PY Y SPP     PP
Sbjct: 175 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPP 234

Query: 119 PYKYPSPPPPVYKYKSPP-----PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP----PP 271
           PY Y SPPP  Y YKSPP     PP Y Y SPPP  Y YKSPP   Y Y SPPP    PP
Sbjct: 235 PYAY-SPPPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPP---YVYSSPPPYAYSPP 289

Query: 272 KKPYKYPSPP-----PPVYKYNSPPPPYKYPSPP-----PPPYKYPSPPPPVYKYKSPPP 421
             PY Y SPP     PP Y Y+ PP PY Y SPP     PPPY Y SPPP  Y YKSPP 
Sbjct: 290 PSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPP- 347

Query: 422 PVYKYKSPPP----PAKKPYKYPSPP-----PPVYKYKSPPPPVYSPPPP---VYK---- 553
             Y Y SPPP    P   PY Y SPP     PP Y Y SPPP  YSPPPP   VYK    
Sbjct: 348 --YVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYTY-SPPPYAYSPPPPCPDVYKPPPY 404

Query: 554 -YKSPPPPVYS 583
            Y SPPP VY+
Sbjct: 405 VYSSPPPYVYN 415

 Score =  214 bits (544), Expect = 5e-54
 Identities = 132/255 (51%), Positives = 135/255 (52%), Gaps = 61/255 (23%)
 Frame = +2

Query: 2   YKSPPP----PPKKPYKYPSPP-----PPVYKYNSPPPPYKYPSPP-----PPPYKYPSP 139
           Y SPPP    PP  PY Y SPP     PP Y Y+ PP PY Y SPP     PPPY Y SP
Sbjct: 40  YSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAY-SP 98

Query: 140 PPPVYKYKSPP-----PPVYKYKSPPPPVYKYKSPP-----PPVYKYKSPPP-------- 265
           PP  Y YKSPP     PP Y Y SPPP  Y YKSPP     PP Y Y SPPP        
Sbjct: 99  PPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPPYVYSSPPPYVYSSPPPYAYSPPPY 157

Query: 266 ---PPKKPYKYPSPP-----PPVYKYNSPPPPYKYPSPP-----PPPYKYPSPPPPVYKY 406
              PP  PY Y SPP     PP Y Y+ PP PY Y SPP     PPPY Y SPPP  Y  
Sbjct: 158 AYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAY-SPPPYAY-- 214

Query: 407 KSPPPPVYKYKSPP-----PPAKKPYKYPSPPPP-VYK-----YKSPPPPVYSPPPPVYK 553
            SPPP  Y YKSPP     PP   PY Y  PP P VYK     Y SPPP  YSPPP  Y 
Sbjct: 215 -SPPPSPYVYKSPPYVYSSPP---PYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYV 270

Query: 554 YKSPP-----PPVYS 583
           YKSPP     PP Y+
Sbjct: 271 YKSPPYVYSSPPPYA 285

 Score =  209 bits (533), Expect = 1e-52
 Identities = 134/254 (52%), Positives = 136/254 (53%), Gaps = 60/254 (23%)
 Frame = +2

Query: 2   YKSPPP----PPKKPYKYPSPP-----PPVYKYNSPPPPYKYPSPP-----PPPYKYPSP 139
           Y SPPP    PP  PY Y SPP     PP Y Y+ PP PY Y SPP     PPPY Y SP
Sbjct: 88  YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYVYSSP 147

Query: 140 PP-----PVYKYKSPPPPVYKYKSPP-----PPVYKYKSPPPPVYKYKSPP-----PPP- 271
           PP     P Y Y SPPP  Y YKSPP     PP Y Y SPPP  Y YKSPP     PPP 
Sbjct: 148 PPYAYSPPPYAY-SPPPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPPYVYSSPPPY 205

Query: 272 ---KKPYKYPSPPPPVYKYNSPP------PPYKYPSPPPPPYKYPSPP-----PPVYKYK 409
                PY Y SPPP  Y Y SPP      PPY Y SPPP PY Y SPP     PP Y Y 
Sbjct: 206 AYSPPPYAY-SPPPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPPYVYSSPPPYAY- 262

Query: 410 SPPPPVYKYKSPP-----PPAKKPYKYPSPPPP-VYK-----YKSPPPPVYSPPPPVYKY 556
           SPPP  Y YKSPP     PP   PY Y  PP P VYK     Y SPPP  YSPPP  Y Y
Sbjct: 263 SPPPSPYVYKSPPYVYSSPP---PYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVY 319

Query: 557 KSPP-----PPVYS 583
           KSPP     PP Y+
Sbjct: 320 KSPPYVYSSPPPYA 333

 Score =  207 bits (528), Expect = 4e-52
 Identities = 130/242 (53%), Positives = 134/242 (55%), Gaps = 50/242 (20%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP-----PPPYKYPSPPPPVYKYKSPP 172
           SPP PP  PY Y SPPP  Y Y+ PP PY Y SPP     PPPY Y SPPP  Y YKSPP
Sbjct: 31  SPPSPP--PYVYSSPPP--YTYSPPPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPP 85

Query: 173 -----PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP----PPKKPYKYPSPP-----PPV 310
                PP Y Y SPPP  Y YKSPP   Y Y SPPP    PP  PY Y SPP     PP 
Sbjct: 86  YVYSSPPPYAY-SPPPSPYVYKSPP---YVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPP 141

Query: 311 YKYNSP------PPPYKYPSPPPPPYKYPSPP-----PPVYKYKSPPPPVYKYKSPP--- 448
           Y Y+SP      PPPY Y SPPP PY Y SPP     PP Y Y SPPP  Y YKSPP   
Sbjct: 142 YVYSSPPPYAYSPPPYAY-SPPPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPPYVY 199

Query: 449 --PP----AKKPYKYPSPPPP-VYK-----YKSPPPPVYSPPPPVYKYKSPP-----PPV 577
             PP    +  PY Y  PP P VYK     Y SPPP  YSPPP  Y YKSPP     PP 
Sbjct: 200 SSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPP 259

Query: 578 YS 583
           Y+
Sbjct: 260 YA 261

 Score =  205 bits (522), Expect = 2e-51
 Identities = 135/276 (48%), Positives = 138/276 (50%), Gaps = 82/276 (29%)
 Frame = +2

Query: 2   YKSPPP----PPKKPYKYPSPP-----PPVYKYNSPPP------PYKYPSPPPPPYKYPS 136
           Y SPPP    PP  PY Y SPP     PP Y Y+SPPP      PY Y SPPP PY Y S
Sbjct: 112 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYVYSSPPPYAYSPPPYAY-SPPPSPYVYKS 170

Query: 137 PP-----PPVYKYKSPPPPVYKYKSPP------------PPVYKYKSPPPP-VYK----- 247
           PP     PP Y Y SPPP  Y YKSPP            PP Y Y  PP P VYK     
Sbjct: 171 PPYVYSSPPPYAY-SPPPSPYVYKSPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYV 229

Query: 248 YKSPPP----PPKKPYKYPSPP-----PPVYKYNSPPPPYKYPSPP-----PPPYKYPSP 385
           Y SPPP    PP  PY Y SPP     PP Y Y+ PP PY Y SPP     PPPY Y SP
Sbjct: 230 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAY-SP 288

Query: 386 PPPVYKYKSPP--------------PPVYKYKSPP-----PPAKKPYKYPSPPPP-VYK- 502
           PP  Y YKSPP              P  Y YKSPP     PP   PY Y  PP P VYK 
Sbjct: 289 PPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPP---PYAYSPPPSPYVYKS 345

Query: 503 ----YKSPPPPVYSPPPPVYKYKSPP-----PPVYS 583
               Y SPPP  YSPPP  Y YKSPP     PP Y+
Sbjct: 346 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYT 381

 Score =  183 bits (464), Expect = 1e-44
 Identities = 115/224 (51%), Positives = 118/224 (52%), Gaps = 50/224 (22%)
 Frame = +2

Query: 62  VYKYNSPPPPYKYPSPP------PPPYKYPSPPPPVYKYKSPP-----PPVYKYKSPPPP 208
           V  + S   PY  PSPP      PPPY Y SPPP  Y YKSPP     PP Y Y SPPP 
Sbjct: 20  VAAHTSAQYPYSPPSPPPYVYSSPPPYTY-SPPPSPYVYKSPPYVYSSPPPYAY-SPPPS 77

Query: 209 VYKYKSPPPPVYKYKSPPP----PPKKPYKYPSPP-----PPVYKYNSPPPPYKYPSPP- 358
            Y YKSPP   Y Y SPPP    PP  PY Y SPP     PP Y Y+ PP PY Y SPP 
Sbjct: 78  PYVYKSPP---YVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPY 134

Query: 359 ----PPPYKYPSPP-----PPVYKYKSPPPP-VYK-----YKSPPP----PAKKPYKYPS 481
               PPPY Y SPP     PP Y Y  PP P VYK     Y SPPP    P   PY Y S
Sbjct: 135 VYSSPPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKS 194

Query: 482 PP-----PPVYKYKSPPPPVYSPPPPVYKYKSPP-----PPVYS 583
           PP     PP Y Y SPPP  YSPPP  Y YKSPP     PP Y+
Sbjct: 195 PPYVYSSPPPYAY-SPPPYAYSPPPSPYVYKSPPYVYSSPPPYA 237

 Score =  163 bits (412), Expect = 1e-38
 Identities = 97/189 (51%), Positives = 100/189 (52%), Gaps = 46/189 (24%)
 Frame = +2

Query: 2   YKSPPP----PPKKPYKYPSPP-----PPVYKYNSPPPPYKYPSPP-----PPPYKYPSP 139
           Y SPPP    PP  PY Y SPP     PP Y Y+ PP PY Y SPP     PPPY Y SP
Sbjct: 254 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAY-SP 312

Query: 140 PPPVYKYKSPP-----PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP----PPKKPYKYP 292
           PP  Y YKSPP     PP Y Y SPPP  Y YKSPP   Y Y SPPP    PP  PY Y 
Sbjct: 313 PPSPYVYKSPPYVYSSPPPYAY-SPPPSPYVYKSPP---YVYSSPPPYAYSPPPSPYVYK 368

Query: 293 SPP------------PPVYKYNSPPP--------PYKYPSPPPPPYKYP--SPPP-PVYK 403
           SPP            PP Y Y+ PPP        PY Y SPPP  Y  P  SPPP P Y 
Sbjct: 369 SPPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPPSPSYS 428

Query: 404 YKSPPPPVY 430
           Y SPPPP+Y
Sbjct: 429 YSSPPPPIY 437

[54][TOP]
>UniRef100_Q9FSG0 Extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG0_NICSY
          Length = 161

 Score =  218 bits (554), Expect = 4e-55
 Identities = 108/151 (71%), Positives = 110/151 (72%), Gaps = 5/151 (3%)
 Frame = +2

Query: 92  YKYPSPPPPP--YKYPSPPPPVYKYKSPPPPVYKYKS--PPPPVYKYKSPPPPVYKYKSP 259
           Y Y SPPPP   Y Y SPPPPVYKYKSPPPPVYK+KS  PPPPVYKYKSPPPPVYKYKSP
Sbjct: 28  YYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSP 87

Query: 260 PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 439
           PPPP     Y SPPPP+YKY SPP       PPPP YK  SPPPPVYKYKSPPPP   YK
Sbjct: 88  PPPPP---VYKSPPPPIYKYKSPP-------PPPPVYK--SPPPPVYKYKSPPPPPPVYK 135

Query: 440 SPPPPAKKPYKYPSPPPPV-YKYKSPPPPVY 529
           SPPPP      Y SPPPP  Y Y SPPPP Y
Sbjct: 136 SPPPPV-----YKSPPPPYHYYYTSPPPPHY 161

 Score =  218 bits (554), Expect = 4e-55
 Identities = 108/153 (70%), Positives = 110/153 (71%), Gaps = 2/153 (1%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           Y S PPPP K Y Y SPPPPVYKY SPPPP YK+ SPP        PPPPVYKYKSPPPP
Sbjct: 29  YYSSPPPPTKKYVYSSPPPPVYKYKSPPPPVYKHKSPP--------PPPPVYKYKSPPPP 80

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
           VYKYKSPPPP   YKSPPPP+YKYKSPPPPP     Y SPPPPVYKY SPP       PP
Sbjct: 81  VYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPP---VYKSPPPPVYKYKSPP-------PP 130

Query: 359 PPPYKYPSPPPPVYKYKSPPPPV-YKYKSPPPP 454
           PP YK  SPPPPV  YKSPPPP  Y Y SPPPP
Sbjct: 131 PPVYK--SPPPPV--YKSPPPPYHYYYTSPPPP 159

 Score =  216 bits (549), Expect = 1e-54
 Identities = 105/148 (70%), Positives = 107/148 (72%), Gaps = 5/148 (3%)
 Frame = +2

Query: 152 YKYKSPPPPV--YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS 325
           Y Y SPPPP   Y Y SPPPPVYKYKSPPPPVYK+KSPP           PPPPVYKY S
Sbjct: 28  YYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPVYKHKSPP-----------PPPPVYKYKS 76

Query: 326 PPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYK 502
           PPPP YKY SPPPPP  Y SPPPP+YKYKSPPPP   YKSPPPP    YKY SPPPP   
Sbjct: 77  PPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPPPV---YKYKSPPPPPPV 133

Query: 503 YKSPPPPVY-SPPPPV-YKYKSPPPPVY 580
           YKSPPPPVY SPPPP  Y Y SPPPP Y
Sbjct: 134 YKSPPPPVYKSPPPPYHYYYTSPPPPHY 161

 Score =  215 bits (547), Expect = 2e-54
 Identities = 105/149 (70%), Positives = 108/149 (72%), Gaps = 4/149 (2%)
 Frame = +2

Query: 65  YKYNSPPPP---YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP 235
           Y Y+SPPPP   Y Y SPPPP YKY SPPPPVYK+KSPP        PPPPVYKYKSPPP
Sbjct: 28  YYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPVYKHKSPP--------PPPPVYKYKSPPP 79

Query: 236 PVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYK-YPSPPPPPYKYPSPPPPVYKYKS 412
           PVYKYKSPPPPP     Y SPPPP+YKY SPPPP   Y SPPPP YKY SPPPP   YKS
Sbjct: 80  PVYKYKSPPPPPP---VYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKS 136

Query: 413 PPPPVYKYKSPPPPAKKPYKYPSPPPPVY 499
           PPPPV  YKSPPPP    Y Y SPPPP Y
Sbjct: 137 PPPPV--YKSPPPPYH--YYYTSPPPPHY 161

 Score =  178 bits (451), Expect = 3e-43
 Identities = 84/115 (73%), Positives = 87/115 (75%), Gaps = 2/115 (1%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           YKSPPPP  K +K P PPPPVYKY SPPPP YKY SPPPPP  Y SPPPP+YKYKSPPPP
Sbjct: 52  YKSPPPPVYK-HKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPP 110

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPV-YKYNSPPPPY 340
              YKSPPPPVYKYKSPPPP   YKSPPPP      Y SPPPP  Y Y SPPPP+
Sbjct: 111 PPVYKSPPPPVYKYKSPPPPPPVYKSPPPP-----VYKSPPPPYHYYYTSPPPPH 160

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 37/62 (59%), Positives = 37/62 (59%), Gaps = 17/62 (27%)
 Frame = +2

Query: 446 PPPAKKPYKYPSPPP------------PVYKYKSPPPPVYS-----PPPPVYKYKSPPPP 574
           P   K  Y Y SPPP            PVYKYKSPPPPVY      PPPPVYKYKSPPPP
Sbjct: 21  PLECKANYYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPVYKHKSPPPPPPVYKYKSPPPP 80

Query: 575 VY 580
           VY
Sbjct: 81  VY 82

[55][TOP]
>UniRef100_B9GU80 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9GU80_POPTR
          Length = 153

 Score =  216 bits (550), Expect = 1e-54
 Identities = 122/191 (63%), Positives = 124/191 (64%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP       PSPPPP Y Y SPPPP   PSPPPP Y Y SPPPP     SPPPP Y 
Sbjct: 1   SPPPPS------PSPPPPYY-YKSPPPPS--PSPPPP-YHYKSPPPPS---PSPPPPYY- 46

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
           YKSPPPP     SPPPP Y YKSPPPP       PSPPPP Y Y SPPPP   PSPPPP 
Sbjct: 47  YKSPPPPS---PSPPPPYY-YKSPPPPS------PSPPPPYY-YKSPPPPS--PSPPPP- 92

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
           Y Y SPPPP     S PPP Y YKSPPPP+      PSPPPP Y Y SPPPPV SPPPPV
Sbjct: 93  YYYKSPPPP----SSSPPPPYVYKSPPPPS------PSPPPPYY-YHSPPPPVKSPPPPV 141

Query: 548 YKYKSPPPPVY 580
           Y Y SPPPP +
Sbjct: 142 YIYASPPPPTH 152

 Score =  187 bits (474), Expect = 7e-46
 Identities = 109/169 (64%), Positives = 110/169 (65%)
 Frame = +2

Query: 77  SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKS 256
           SPPPP   PSPPPP Y Y SPPPP     SPPPP Y YKSPPPP     SPPPP Y YKS
Sbjct: 1   SPPPPS--PSPPPP-YYYKSPPPPS---PSPPPP-YHYKSPPPPS---PSPPPPYY-YKS 49

Query: 257 PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 436
           PPPP       PSPPPP Y Y SPPPP   PSPPPP Y Y SPPPP     SPPPP Y Y
Sbjct: 50  PPPPS------PSPPPPYY-YKSPPPPS--PSPPPP-YYYKSPPPPS---PSPPPPYY-Y 95

Query: 437 KSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           KSPPPP+       S PPP Y YKSPPPP  SPPPP Y Y SPPPPV S
Sbjct: 96  KSPPPPS-------SSPPPPYVYKSPPPPSPSPPPPYY-YHSPPPPVKS 136

 Score =  177 bits (450), Expect = 4e-43
 Identities = 103/160 (64%), Positives = 103/160 (64%), Gaps = 9/160 (5%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPP
Sbjct: 15  YKSPPPPSPSPPPPYHYKSPPPPS---PSPPPPYYYKSPPPPS---PSPPPPYY-YKSPP 67

Query: 173 PPVYKYKSPPPPVYKYKSPPPPV------YKYKSPPPPPKKPYKYPSPPPPVYKYNSPPP 334
           PP     SPPPP Y YKSPPPP       Y YKSPPPP        SPPPP Y Y SPPP
Sbjct: 68  PPS---PSPPPPYY-YKSPPPPSPSPPPPYYYKSPPPPSS------SPPPP-YVYKSPPP 116

Query: 335 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 454
           P   PS PPPPY Y SPPPPV   KSPPPPVY Y SPPPP
Sbjct: 117 P--SPS-PPPPYYYHSPPPPV---KSPPPPVYIYASPPPP 150

 Score =  134 bits (338), Expect = 4e-30
 Identities = 79/136 (58%), Positives = 79/136 (58%), Gaps = 21/136 (15%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV- 151
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY Y SPPPP  
Sbjct: 31  YKSPPPPSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSP 87

Query: 152 -----YKYKSPPPPV------YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSP 298
                Y YKSPPPP       Y YKSPPPP     SPPPP Y Y SPPPP K      SP
Sbjct: 88  SPPPPYYYKSPPPPSSSPPPPYVYKSPPPPS-P--SPPPPYY-YHSPPPPVK------SP 137

Query: 299 PPPVYKYNSPPPPYKY 346
           PPPVY Y SPPPP  Y
Sbjct: 138 PPPVYIYASPPPPTHY 153

[56][TOP]
>UniRef100_B9GWA6 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa
           RepID=B9GWA6_POPTR
          Length = 202

 Score =  213 bits (542), Expect = 9e-54
 Identities = 119/192 (61%), Positives = 122/192 (63%), Gaps = 9/192 (4%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           YKSPPPP   P  PY Y SPPPP  K  SPPP Y Y SPPPP    PSPPPP Y Y SPP
Sbjct: 41  YKSPPPPSPSPPPPYHYSSPPPPPLK-KSPPPSYVYKSPPPPS---PSPPPP-YHYSSPP 95

Query: 173 PPVYKYKSPPPPVYKYKSPPPPV------YKYKSPPPPPKKPYKYPSPPPPVYKYNSPPP 334
           PP    KSPPPP Y YKSPPPP       Y Y SPPPP K      SPPPP Y Y SPPP
Sbjct: 96  PPK---KSPPPP-YVYKSPPPPSPSLSPPYHYSSPPPPKK------SPPPP-YIYKSPPP 144

Query: 335 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSP 514
           P   PSPPPP Y Y SP PP    K  PPP+Y YKSPPPP+      PSPPPP Y YKSP
Sbjct: 145 PS--PSPPPP-YHYSSPSPP----KKSPPPLYIYKSPPPPS------PSPPPPYY-YKSP 190

Query: 515 PPPVYSPPPPVY 550
           PPP +SPPPP Y
Sbjct: 191 PPPTHSPPPPYY 202

 Score =  204 bits (520), Expect = 3e-51
 Identities = 117/204 (57%), Positives = 121/204 (59%), Gaps = 15/204 (7%)
 Frame = +2

Query: 17  PPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKS 196
           P    P  + SP   V    SP P Y Y SPPPP    PSPPPP Y Y SPPPP    K 
Sbjct: 18  PATSIPLLFTSPAKEV----SPTPRYVYKSPPPPS---PSPPPP-YHYSSPPPP--PLKK 67

Query: 197 PPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP----- 361
            PPP Y YKSPPPP     SP PPP  PY Y SPPPP     SPPPPY Y SPPP     
Sbjct: 68  SPPPSYVYKSPPPP-----SPSPPP--PYHYSSPPPP---KKSPPPPYVYKSPPPPSPSL 117

Query: 362 -PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKK---PYKYPSP------PPPVYKYKS 511
            PPY Y SPPPP    KSPPPP Y YKSPPPP+     PY Y SP      PPP+Y YKS
Sbjct: 118 SPPYHYSSPPPP---KKSPPPP-YIYKSPPPPSPSPPPPYHYSSPSPPKKSPPPLYIYKS 173

Query: 512 PPPPVYSPPPPVYKYKSPPPPVYS 583
           PPPP  SPPPP Y YKSPPPP +S
Sbjct: 174 PPPPSPSPPPPYY-YKSPPPPTHS 196

[57][TOP]
>UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH
          Length = 760

 Score =  210 bits (535), Expect = 6e-53
 Identities = 104/204 (50%), Positives = 118/204 (57%), Gaps = 14/204 (6%)
 Frame = +2

Query: 5    KSPPPPPKKPY--KYPSPPPPVYKYNSPPPPYKYPSP--PPPPYKYPSPPPPVYKYKSPP 172
            + PPPPP  P   ++  PPP  Y Y+SPPPP+  P P  PPPP+   SPPPP+Y Y SPP
Sbjct: 536  RPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPH---SPPPPIYPYLSPP 592

Query: 173  PPVYKYKSPPP-PVYK--------YKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS 325
            PP     SPPP PVY            PPPP  +Y  PPPPP   Y  P PPPPVY  + 
Sbjct: 593  PPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSP-PPPPVYYSSP 651

Query: 326  PPPPYKYPSPPPPP-YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYK 502
            PPPP  Y SPPPPP   Y SPPPP   Y SPPP    Y SPPPP   P +   PP PV  
Sbjct: 652  PPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVH 711

Query: 503  YKSPPPPVYSPPPPVYKYKSPPPP 574
            +  PPP V+  PPP   ++SPPPP
Sbjct: 712  HSPPPPMVHHSPPPPVIHQSPPPP 735

 Score =  199 bits (507), Expect = 1e-49
 Identities = 112/226 (49%), Positives = 121/226 (53%), Gaps = 33/226 (14%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKY-----PSPPPPVYKYNSPPPPYKYPSPPP----PPYKYPSPPPPVY 154
            Y  PPPPP  P  Y     P PPPP   Y+ PPPP   P PPP    PP   P PPPPVY
Sbjct: 436  YSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVY 495

Query: 155  KYKSPPPPVYK---YKSPPPPVYKYKSPPP-----PVYKYKSPPPPPKKPY--KYPSPPP 304
                PPPP      Y  PPPPVY    PPP     PVY  + PPPPP  P   ++  PPP
Sbjct: 496  SPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPP 555

Query: 305  PVYKYNSPPPPYKYPSP--PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP------PAK 460
              Y Y+SPPPP+  P P  PPPP+   SPPPP+Y Y SPPPP     SPPP      P  
Sbjct: 556  EPYYYSSPPPPHSSPPPHSPPPPH---SPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPP 612

Query: 461  KPYKYPSPPPPVYKYKSPPPPV---YS--PPPPVY-KYKSPPPPVY 580
             P   P PPPP  +Y  PPPP    YS  PPPPVY     PPPPVY
Sbjct: 613  PPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYS-SPPPPPVY 657

 Score =  195 bits (496), Expect = 2e-48
 Identities = 106/212 (50%), Positives = 116/212 (54%), Gaps = 19/212 (8%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYK----------YPSPPPPPYKYPS 136
            Y SPPPP     P  P    SPPPP+Y Y SPPPP            Y  PPPPP   P 
Sbjct: 560  YSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPP 619

Query: 137  PPPPVYKYK-SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVY 313
            PPPP  +Y   PPPPV  Y SPPPP   Y SPPPP   Y SPPPPP  P  Y SPPPP  
Sbjct: 620  PPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPP--PVHYSSPPPPEV 677

Query: 314  KYNSPPP-PYKYPSPPPPPYK--YPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSP 484
             Y+SPPP P  Y SPPPPP      SPPP    + SPPPP+  + SPPPP      + SP
Sbjct: 678  HYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMV-HHSPPPPV----IHQSP 732

Query: 485  PPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
            PPP  +Y+ P PPV         Y SPPPP +
Sbjct: 733  PPPSPEYEGPLPPVIG-----VSYASPPPPPF 759

 Score =  190 bits (482), Expect = 8e-47
 Identities = 103/215 (47%), Positives = 112/215 (52%), Gaps = 26/215 (12%)
 Frame = +2

Query: 8   SPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           SP PP   P  P   PSPPPP   +++PP     P P PPP  Y  PPPP      PPPP
Sbjct: 393 SPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPP-----PPPPP 447

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKY-----PSPPPPVYKYNSPPPPYK 343
           VY    PPPP      PPPPVY    PPPPP  P        PSPPPP     SPPPP  
Sbjct: 448 VYSPPPPPPP-----PPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPP-- 500

Query: 344 YPSPPPPPYKYPSPPPPVYKYKSPPP-----PVYKYKSPPPP--AKKPYKYPSPPPPVYK 502
            P PPPPP  Y  PPPPVY    PPP     PVY  + PPPP  +  P ++  PPP  Y 
Sbjct: 501 -PPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYY 559

Query: 503 YKSP-----------PPPVYSPPPPVYKYKSPPPP 574
           Y SP           PPP +SPPPP+Y Y SPPPP
Sbjct: 560 YSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPP 594

 Score =  187 bits (476), Expect = 4e-46
 Identities = 106/203 (52%), Positives = 113/203 (55%), Gaps = 11/203 (5%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   P PPPPVY   SPPPP   P PPPP Y  P PPPP      PPPPVY 
Sbjct: 430 SPPPPVYSPPPPPPPPPPVY---SPPPPPP-PPPPPPVYSPPPPPPP----PPPPPPVY- 480

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP---- 355
             SPPPP      PPPPVY    PPPPP  P  Y  PPPPVY  + PPPP   P+P    
Sbjct: 481 --SPPPP--SPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYS-SPPPPPSPAPTPVYCT 535

Query: 356 ---PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV 526
              PPPP+   SPPPP  ++  PPP  Y Y SPPPP   P  + SPPPP     SPPPP+
Sbjct: 536 RPPPPPPH---SPPPP--QFSPPPPEPYYYSSPPPPHSSPPPH-SPPPP----HSPPPPI 585

Query: 527 YS----PPPPVYKYKSPPPPVYS 583
           Y     PPPP      PP PVYS
Sbjct: 586 YPYLSPPPPPTPVSSPPPTPVYS 608

 Score =  168 bits (426), Expect = 2e-40
 Identities = 96/185 (51%), Positives = 99/185 (53%), Gaps = 6/185 (3%)
 Frame = +2

Query: 47  SPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 208
           SP PPV    +P PP   PSPPPP      P    SPPPP     SPPPPVY   SPPPP
Sbjct: 393 SPRPPVV---TPLPPPSLPSPPPPAPIFSTPPTLTSPPPP-----SPPPPVY---SPPPP 441

Query: 209 VYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPP 388
                 PPPP   Y  PPPPP      P PPPPVY   SPPPP   P PPPP Y  P P 
Sbjct: 442 ------PPPPPPVYSPPPPPP------PPPPPPVY---SPPPPPPPPPPPPPVYSPPPPS 486

Query: 389 PPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPP 568
           PP      PPPPVY    PPPP   P  Y  PPPPV  Y SPPPP    P PVY  + PP
Sbjct: 487 PP-----PPPPPVYSPPPPPPPPPPPPVYSPPPPPV--YSSPPPPPSPAPTPVYCTRPPP 539

Query: 569 PPVYS 583
           PP +S
Sbjct: 540 PPPHS 544

 Score =  113 bits (283), Expect = 1e-23
 Identities = 56/117 (47%), Positives = 66/117 (56%), Gaps = 2/117 (1%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYK--YKSPPP 175
           Y SPPPPP   Y  P PPPPV+  + PPP   Y SPPP P  Y SPPPP      +SPPP
Sbjct: 648 YSSPPPPPVY-YSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPP 706

Query: 176 PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKY 346
               + SPPPP+  +  PPP +++    PPPP   Y+ P PP     Y SPPPP  Y
Sbjct: 707 APVVHHSPPPPMVHHSPPPPVIHQ---SPPPPSPEYEGPLPPVIGVSYASPPPPPFY 760

[58][TOP]
>UniRef100_Q8LK15 Extensin n=1 Tax=Brassica napus RepID=Q8LK15_BRANA
          Length = 259

 Score =  210 bits (535), Expect = 6e-53
 Identities = 125/232 (53%), Positives = 136/232 (58%), Gaps = 39/232 (16%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYN------SPPPPYKYP--SPPPPPYKYPSPPPPVYK 157
           + S PPPP K Y+Y SPPPPV  Y+      SPPPP K+     PPPP K  SPP     
Sbjct: 31  FYSSPPPPVKHYEYKSPPPPVMHYSLPQVYHSPPPPKKHTVNKSPPPPVKQYSPP----W 86

Query: 158 YKSPPPPV--YKYKSPPPPVYKYKSPPP-PVYKYKSPPPPPK---KPYKYPSPPPP--VY 313
            +SPPPP   Y YKSPPPPV +Y SPPP   Y Y+SPPPP K    P  Y SPPPP   Y
Sbjct: 87  LRSPPPPRKDYVYKSPPPPVKQYSSPPPNKYYVYQSPPPPVKHYSPPSVYHSPPPPKNQY 146

Query: 314 KYNSPPPPYKYPSPP-----PPP---YKYPSPPPPVYKYK------SPPPPV--YKYKSP 445
            Y SPPPP K+ +PP     PPP   Y Y SPPPPV  Y       SPPPP   Y YKSP
Sbjct: 147 VYKSPPPPVKHYTPPVYHSGPPPKKHYMYKSPPPPVMHYSLPQVYHSPPPPKKHYVYKSP 206

Query: 446 PPPAK---KPYKYPSPPPP--VYKYKSPPPPV--YSPPPPVYKYKSPPPPVY 580
           PPP K       Y SPPPP   Y YKSPPPPV  Y PP  +Y YKSPPPP +
Sbjct: 207 PPPVKHYSPRLVYHSPPPPKKKYVYKSPPPPVRHYFPPHHLYLYKSPPPPYH 258

 Score =  185 bits (470), Expect = 2e-45
 Identities = 110/209 (52%), Positives = 117/209 (55%), Gaps = 57/209 (27%)
 Frame = +2

Query: 122 YKYPSPPPPV--YKYKSPPPPVYKYKSP-----PPPVYKY---KSPPPPVYKYKSP---- 259
           Y Y SPPPPV  Y+YKSPPPPV  Y  P     PPP  K+   KSPPPPV +Y  P    
Sbjct: 30  YFYSSPPPPVKHYEYKSPPPPVMHYSLPQVYHSPPPPKKHTVNKSPPPPVKQYSPPWLRS 89

Query: 260 PPPPKKPYKYPSPPPPVYKYNSPPPP--YKYPSPPP------PPYKYPSPPPP--VYKYK 409
           PPPP+K Y Y SPPPPV +Y+SPPP   Y Y SPPP      PP  Y SPPPP   Y YK
Sbjct: 90  PPPPRKDYVYKSPPPPVKQYSSPPPNKYYVYQSPPPPVKHYSPPSVYHSPPPPKNQYVYK 149

Query: 410 SPPPPVYKYKSP----PPPAKKPYKYPSPPPPV------------------YKYKSPPPP 523
           SPPPPV  Y  P     PP KK Y Y SPPPPV                  Y YKSPPPP
Sbjct: 150 SPPPPVKHYTPPVYHSGPPPKKHYMYKSPPPPVMHYSLPQVYHSPPPPKKHYVYKSPPPP 209

Query: 524 V---------YSPPPP--VYKYKSPPPPV 577
           V         +SPPPP   Y YKSPPPPV
Sbjct: 210 VKHYSPRLVYHSPPPPKKKYVYKSPPPPV 238

 Score =  126 bits (317), Expect = 1e-27
 Identities = 75/144 (52%), Positives = 81/144 (56%), Gaps = 29/144 (20%)
 Frame = +2

Query: 2   YKSPPPPPKK---PYKYPSPPPPV--YKYNSPPPPYKYPSPP-----PPP---YKYPSPP 142
           Y+SPPPP K    P  Y SPPPP   Y Y SPPPP K+ +PP     PPP   Y Y SPP
Sbjct: 120 YQSPPPPVKHYSPPSVYHSPPPPKNQYVYKSPPPPVKHYTPPVYHSGPPPKKHYMYKSPP 179

Query: 143 PPVYKYK------SPPPPV--YKYKSPPPPVYKYK------SPPPP--VYKYKSPPPPPK 274
           PPV  Y       SPPPP   Y YKSPPPPV  Y       SPPPP   Y YKSPPPP +
Sbjct: 180 PPVMHYSLPQVYHSPPPPKKHYVYKSPPPPVKHYSPRLVYHSPPPPKKKYVYKSPPPPVR 239

Query: 275 KPYKYPSPPPPVYKYNSPPPPYKY 346
             +    PP  +Y Y SPPPPY Y
Sbjct: 240 HYF----PPHHLYLYKSPPPPYHY 259

[59][TOP]
>UniRef100_C3VPW8 Extensin n=1 Tax=Lithospermum erythrorhizon RepID=C3VPW8_LITER
          Length = 247

 Score =  207 bits (526), Expect = 6e-52
 Identities = 123/206 (59%), Positives = 133/206 (64%), Gaps = 13/206 (6%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           Y SPPPP     P   Y + SPPPPVYK  SPPPP  + SPPPP YK  SPPPP++K  S
Sbjct: 37  YSSPPPPKKYSPPPHHYHHKSPPPPVYK--SPPPPM-HKSPPPPVYK--SPPPPMHK--S 89

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKK----PYKYPSPPPPVYKYNSPPP 334
           PPPP  K  SPPPPVYK  SPPPP++K    PPPPKK    P  Y SPPPP++K  SPPP
Sbjct: 90  PPPP--KKYSPPPPVYK--SPPPPMHK---SPPPPKKYSPPPPVYKSPPPPMHK--SPPP 140

Query: 335 PYKYPSPPPPPYKYPSPP----PPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYK 502
           P KY SPPPP YK P PP    PP  K  SPPPPVYK  SPPPP  K     SPPPP  K
Sbjct: 141 PKKY-SPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYK--SPPPPMHK-----SPPPP--K 190

Query: 503 YKSPPPPVYSPPPPVYKYKSPPPPVY 580
             SPPPPV+ PPP      SPPPPV+
Sbjct: 191 KYSPPPPVHKPPPHWSHKYSPPPPVH 216

 Score =  202 bits (514), Expect = 2e-50
 Identities = 123/200 (61%), Positives = 132/200 (66%), Gaps = 11/200 (5%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPVYKYNSPPP-PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK- 187
           P      YKY SPPPP  K  SPPP  Y + SPPPP YK  SPPPP+  +KSPPPPVYK 
Sbjct: 28  PSETSANYKYSSPPPP--KKYSPPPHHYHHKSPPPPVYK--SPPPPM--HKSPPPPVYKS 81

Query: 188 -----YKSPPPPVYKYKSPPPPVYKYKSPPPP----PKKPYKYPSPPPPVYKYNSPPPPY 340
                +KSPPPP  K  SPPPPV  YKSPPPP    P  P KY SPPPPVYK  SPPPP 
Sbjct: 82  PPPPMHKSPPPP--KKYSPPPPV--YKSPPPPMHKSPPPPKKY-SPPPPVYK--SPPPPM 134

Query: 341 KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP 520
                PPPP KY SPPPPV  YKSPPPP+  +KSPPPP K      SPPPPV  YKSPPP
Sbjct: 135 H--KSPPPPKKY-SPPPPV--YKSPPPPM--HKSPPPPKKY-----SPPPPV--YKSPPP 180

Query: 521 PVYSPPPPVYKYKSPPPPVY 580
           P++  PPP  KY SPPPPV+
Sbjct: 181 PMHKSPPPPKKY-SPPPPVH 199

 Score =  167 bits (424), Expect = 4e-40
 Identities = 103/181 (56%), Positives = 110/181 (60%), Gaps = 30/181 (16%)
 Frame = +2

Query: 122 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPP 301
           +  PS     YKY SPPPP  K  SPPP  Y +KSPPPPVYK  SPPPP  K     SPP
Sbjct: 25  FTIPSETSANYKYSSPPPP--KKYSPPPHHYHHKSPPPPVYK--SPPPPMHK-----SPP 75

Query: 302 PPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK--------------YK 439
           PPVYK  SPPPP  + SPPPP  K  SPPPPV  YKSPPPP++K              YK
Sbjct: 76  PPVYK--SPPPPM-HKSPPPP--KKYSPPPPV--YKSPPPPMHKSPPPPKKYSPPPPVYK 128

Query: 440 SPPPPAKK---PYKYPSPPPPVYK------YKSPPPP-VYSPPPPVYK------YKSPPP 571
           SPPPP  K   P K  SPPPPVYK      +KSPPPP  YSPPPPVYK      +KSPPP
Sbjct: 129 SPPPPMHKSPPPPKKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYKSPPPPMHKSPPP 188

Query: 572 P 574
           P
Sbjct: 189 P 189

 Score =  142 bits (357), Expect = 2e-32
 Identities = 89/162 (54%), Positives = 97/162 (59%), Gaps = 27/162 (16%)
 Frame = +2

Query: 2   YKSPPPP----PKKPYKYPSPPPPVYK------YNSPPPPYKYPSPPPPPYKYPSPP--- 142
           YKSPPPP    P  P KY SPPPPVYK      + SPPPP KY SPPPP YK P PP   
Sbjct: 79  YKSPPPPMHKSPPPPKKY-SPPPPVYKSPPPPMHKSPPPPKKY-SPPPPVYKSPPPPMHK 136

Query: 143 -PPVYKYKSPPPPVYK------YKSPPPPVYKYKSPPPPVYK------YKSPPPPPKKPY 283
            PP  K  SPPPPVYK      +KSPPPP  K  SPPPPVYK      +KSPPPP K   
Sbjct: 137 SPPPPKKYSPPPPVYKSPPPPMHKSPPPP--KKYSPPPPVYKSPPPPMHKSPPPPKKY-- 192

Query: 284 KYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKY 406
              SPPPPV+K   PPP + +  SPPPP +K    PP  Y+Y
Sbjct: 193 ---SPPPPVHK---PPPHWSHKYSPPPPVHK---SPPHHYRY 225

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 52/107 (48%), Positives = 59/107 (55%), Gaps = 7/107 (6%)
 Frame = +2

Query: 281 YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK 460
           +  PS     YKY+SPPPP KY           SPPP  Y +KSPPPPVYK         
Sbjct: 25  FTIPSETSANYKYSSPPPPKKY-----------SPPPHHYHHKSPPPPVYK--------- 64

Query: 461 KPYKYPSPPPPVYKYKSPPPPVY-SPPPPVYKYK------SPPPPVY 580
                 SPPPP++K  SPPPPVY SPPPP++K        SPPPPVY
Sbjct: 65  ------SPPPPMHK--SPPPPVYKSPPPPMHKSPPPPKKYSPPPPVY 103

[60][TOP]
>UniRef100_Q40503 Extensin n=1 Tax=Nicotiana tabacum RepID=Q40503_TOBAC
          Length = 224

 Score =  206 bits (524), Expect = 1e-51
 Identities = 118/210 (56%), Positives = 123/210 (58%), Gaps = 19/210 (9%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPP--PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           S PPPPKKPY Y SPPPPV+ Y SPP  P YK P PP  PY +PSP        +P  PV
Sbjct: 31  SSPPPPKKPYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPY-HPSP--------TPYHPV 81

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYK------YPSPPPPVYKYNSPPPPYK 343
             YKSPPPP   Y  P PPVYK    PPPPKKPY       Y SPPPP   Y SPPPP K
Sbjct: 82  PVYKSPPPPKKPYYPPHPPVYK---SPPPPKKPYSLPHTPVYKSPPPPTPVYKSPPPPKK 138

Query: 344 ---------YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPV 496
                    Y SPPPP   Y  P  PV  YKSPPPP   YKSPPPP KKP+ YP P  PV
Sbjct: 139 PHYPPHTPIYKSPPPPNKPYYPPHTPV--YKSPPPPTPVYKSPPPP-KKPH-YP-PHTPV 193

Query: 497 YKYKSPPPPVYSPPPP--VYKYKSPPPPVY 580
           YK   PP PVY  PPP   Y Y SPPPP +
Sbjct: 194 YKSPPPPTPVYKSPPPHHPYVYASPPPPYH 223

 Score =  175 bits (443), Expect = 3e-42
 Identities = 110/186 (59%), Positives = 112/186 (60%), Gaps = 23/186 (12%)
 Frame = +2

Query: 92  YKYPSPPPP--PYKYPSPPPPVYKYKSPPP-PVYKYKSPPPPVYKYK-SPPP--PVYKYK 253
           Y+Y SPPPP  PY Y SPPPPV+ Y SPP  PVYK  SPPPP   Y  SP P  PV  YK
Sbjct: 28  YQYSSPPPPKKPYLYKSPPPPVHVYPSPPHHPVYK--SPPPPKKPYHPSPTPYHPVPVYK 85

Query: 254 SPPPPPKKPYKYPSPPPPVYKYNSPPPPYK-YPSPPPPPYKYPSPPPPVYKYKSPPPPVY 430
           SPPPP KKPY YP P PPVYK  SPPPP K Y  P  P YK P PP PV  YKSPPPP  
Sbjct: 86  SPPPP-KKPY-YP-PHPPVYK--SPPPPKKPYSLPHTPVYKSPPPPTPV--YKSPPPPKK 138

Query: 431 K--------YKSPPPPAKKPYK-----YPSPPPPVYKYKSPPPPV---YSPPPPVYKYKS 562
                    YKSPPPP K  Y      Y SPPPP   YKSPPPP    Y P  PVYK   
Sbjct: 139 PHYPPHTPIYKSPPPPNKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPP 198

Query: 563 PPPPVY 580
           PP PVY
Sbjct: 199 PPTPVY 204

 Score =  172 bits (435), Expect = 2e-41
 Identities = 102/176 (57%), Positives = 106/176 (60%), Gaps = 10/176 (5%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPP--PVYKYNSPPPPYK-YPSPPPPPYKYPSPPPPVYK----- 157
           YKSPPPP KKPY +PSP P  PV  Y SPPPP K Y  P PP YK P PP   Y      
Sbjct: 61  YKSPPPP-KKPY-HPSPTPYHPVPVYKSPPPPKKPYYPPHPPVYKSPPPPKKPYSLPHTP 118

Query: 158 -YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPP 334
            YKSPPPP   YKSPPPP   +  P  P+YK    PPPP KPY YP P  PVYK  SPPP
Sbjct: 119 VYKSPPPPTPVYKSPPPPKKPHYPPHTPIYK---SPPPPNKPY-YP-PHTPVYK--SPPP 171

Query: 335 PYK-YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVY 499
           P   Y SPPPP  K P  PP    YKSPPPP   YKSPPP    PY Y SPPPP +
Sbjct: 172 PTPVYKSPPPP--KKPHYPPHTPVYKSPPPPTPVYKSPPP--HHPYVYASPPPPYH 223

 Score =  123 bits (308), Expect = 1e-26
 Identities = 72/130 (55%), Positives = 73/130 (56%), Gaps = 15/130 (11%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYP------SPPPPVYKYNSPPPPYK---------YPSPPPPPYKYPS 136
           YKSPPPP KKPY  P      SPPPP   Y SPPPP K         Y SPPPP   Y  
Sbjct: 102 YKSPPPP-KKPYSLPHTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPIYKSPPPPNKPYYP 160

Query: 137 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYK 316
           P  PVYK  SPPPP   YKSPPPP   +  P  PVYK  S PPPP   YK P P  P Y 
Sbjct: 161 PHTPVYK--SPPPPTPVYKSPPPPKKPHYPPHTPVYK--S-PPPPTPVYKSPPPHHP-YV 214

Query: 317 YNSPPPPYKY 346
           Y SPPPPY Y
Sbjct: 215 YASPPPPYHY 224

[61][TOP]
>UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO
          Length = 538

 Score =  206 bits (523), Expect = 1e-51
 Identities = 116/217 (53%), Positives = 121/217 (55%), Gaps = 27/217 (12%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPP----PPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           PPPP  P   PSPP    PPVY   SPPPP    SPPPPP   PSPPPPVY    PPPPV
Sbjct: 235 PPPPSPPMPVPSPPVYLPPPVY---SPPPPPPVYSPPPPP---PSPPPPVYSPPPPPPPV 288

Query: 182 YKYKSPPPPVYK----YKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYK---------YN 322
           Y    PPPPVY       SPPPP     SPPPPP  P   PSPPPPVY            
Sbjct: 289 YS-PPPPPPVYSPPPPPPSPPPPPPPVYSPPPPPSPP--PPSPPPPVYSPPPPPPSPPPP 345

Query: 323 SPPPPYKYP----SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSP-- 484
           SPPPP   P     PPPPP   P PPPP++   SPPPP   Y S PPP   P+  P P  
Sbjct: 346 SPPPPSPLPPCVRPPPPPPPNSPPPPPPLF---SPPPPTPYYYSSPPPPSPPHSPPPPPH 402

Query: 485 -PPPVYKYKSPPPPVYSPPPPVYKYKSPPP---PVYS 583
            PPP     SPPPP +SPPPP+Y Y SPPP   PVYS
Sbjct: 403 SPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYS 439

 Score =  202 bits (515), Expect = 1e-50
 Identities = 107/205 (52%), Positives = 111/205 (54%), Gaps = 14/205 (6%)
 Frame = +2

Query: 2   YKSPPPPP--KKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 175
           Y  PPPPP    P   PSPPPPVY    PPPP   P PPPP Y   SPPPP      PPP
Sbjct: 256 YSPPPPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPPPPPPVY---SPPPPPPSPPPPPP 312

Query: 176 PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
           PVY    PPPP     SPPPPV  Y  PPPPP  P   P PP P+     PPPP    SP
Sbjct: 313 PVY--SPPPPPSPPPPSPPPPV--YSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSP 368

Query: 356 PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYP---------SPPPPVYKYK 508
           PPPP  +  PPP  Y Y SPPPP   +  PPPP   P   P         SPPPP+Y Y 
Sbjct: 369 PPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYL 428

Query: 509 SPPP---PVYSPPPPVYKYKSPPPP 574
           SPPP   PVYSPPPP   Y  PPPP
Sbjct: 429 SPPPPPHPVYSPPPPPV-YSPPPPP 452

 Score =  199 bits (505), Expect = 2e-49
 Identities = 102/200 (51%), Positives = 111/200 (55%), Gaps = 8/200 (4%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           Y  PPPPP  P   P PP P+     PPPP    SPPPPP  +  PPP  Y Y SPPPP 
Sbjct: 333 YSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPS 392

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKP----YKYPSPPPPVYKYNSPPPPYKYP 349
             +  PPPP     SPPPP   + SPPPPP  P    Y Y SPPPP +   SPPPP  Y 
Sbjct: 393 PPHSPPPPP----HSPPPPSPPH-SPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYS 447

Query: 350 SPPPP---PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK-KPYKYPSPPPPVYKYKSPP 517
            PPPP   P   P PPPP  +Y  PPP      SPPPP + KP   PSPPPP   Y SPP
Sbjct: 448 PPPPPSPPPCIEPPPPPPCAEYSPPPPS----PSPPPPTQYKPPPSPSPPPPPVHYYSPP 503

Query: 518 PPVYSPPPPVYKYKSPPPPV 577
           PP  SPPPP   Y+ P PP+
Sbjct: 504 PPSQSPPPPAPVYEGPLPPI 523

 Score =  182 bits (461), Expect = 2e-44
 Identities = 102/188 (54%), Positives = 109/188 (57%), Gaps = 15/188 (7%)
 Frame = +2

Query: 11  PPPPPKKPYKYP---SPPPPV-YKYNSPPPPYKYPSPPPPPYKYP------SPPPPVYKY 160
           PPPPP  P   P   SPPPP  Y Y+SPPPP    SPPPPP+  P      SPPPP +  
Sbjct: 361 PPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPH-- 418

Query: 161 KSPPPPVYKYKSPPPPVYK-YKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP 337
            SPPPP+Y Y SPPPP +  Y  PPPPVY   SPPPPP  P     PPPP     SPPPP
Sbjct: 419 -SPPPPIYPYLSPPPPPHPVYSPPPPPVY---SPPPPPSPPPCIEPPPPPPCAEYSPPPP 474

Query: 338 YKYPSPPPP----PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKY 505
              PSPPPP    P   PSPPPP   Y SPPPP    +SPPPPA   Y+ P PP     Y
Sbjct: 475 S--PSPPPPTQYKPPPSPSPPPPPVHYYSPPPPS---QSPPPPAPV-YEGPLPPITGVSY 528

Query: 506 KSPPPPVY 529
            SPPPP Y
Sbjct: 529 ASPPPPPY 536

 Score =  168 bits (425), Expect = 3e-40
 Identities = 91/175 (52%), Positives = 100/175 (57%), Gaps = 12/175 (6%)
 Frame = +2

Query: 17  PPPKKPYKYPSPPPPVYKYNSPPPPYKYP------SPPPPPYKYPSPPPPVYKYKSPPPP 178
           PPP  PY Y SPPPP   ++ PPPP+  P      SPPPPP+   SPPPP+Y Y SPPPP
Sbjct: 377 PPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPH---SPPPPIYPYLSPPPP 433

Query: 179 VYK-YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYK----YPSPPPPV-YKYNSPPPPY 340
            +  Y  PPPPVY    PP P    + PPPPP   Y      PSPPPP  YK   PPP  
Sbjct: 434 PHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYK---PPPS- 489

Query: 341 KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKY 505
             PSPPPPP  Y SPPPP    +SPPPP   Y+ P PP      Y SPPPP Y Y
Sbjct: 490 --PSPPPPPVHYYSPPPP---SQSPPPPAPVYEGPLPPI-TGVSYASPPPPPYYY 538

 Score =  157 bits (398), Expect = 4e-37
 Identities = 92/183 (50%), Positives = 96/183 (52%), Gaps = 21/183 (11%)
 Frame = +2

Query: 89  PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 268
           P+    P PPP   PSPP PV     P PPVY     PPPVY   SPPPP   Y  PPPP
Sbjct: 227 PFVPTLPAPPP---PSPPMPV-----PSPPVYL----PPPVY---SPPPPPPVYSPPPPP 271

Query: 269 PKKP---YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYK--------YKSP 415
           P  P   Y  P PPPPVY   SPPPP    SPPPPP   P PPPPVY           SP
Sbjct: 272 PSPPPPVYSPPPPPPPVY---SPPPPPPVYSPPPPPPSPPPPPPPVYSPPPPPSPPPPSP 328

Query: 416 PPPVYK---------YKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV-YKYKSP 565
           PPPVY            SPPPP+  P     PPPP      PPPP++SPPPP  Y Y SP
Sbjct: 329 PPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYSSP 388

Query: 566 PPP 574
           PPP
Sbjct: 389 PPP 391

 Score =  142 bits (359), Expect = 1e-32
 Identities = 76/147 (51%), Positives = 84/147 (57%), Gaps = 6/147 (4%)
 Frame = +2

Query: 14  PPPPKKPYKYP----SPPPPVYKYNS-PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           PPPP  P+  P    SPPPP+Y Y S PPPP+   SPPPPP   P PPP      SPPP 
Sbjct: 404 PPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPPPPVYSPPPPP------SPPPC 457

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPK-KPYKYPSPPPPVYKYNSPPPPYKYPSP 355
           +   + PPPP     SPPPP     SPPPP + KP   PSPPPP   Y SPPPP + P P
Sbjct: 458 I---EPPPPPPCAEYSPPPP---SPSPPPPTQYKPPPSPSPPPPPVHYYSPPPPSQSPPP 511

Query: 356 PPPPYKYPSPPPPVYKYKSPPPPVYKY 436
           P P Y+ P PP     Y SPPPP Y Y
Sbjct: 512 PAPVYEGPLPPITGVSYASPPPPPYYY 538

 Score =  103 bits (258), Expect = 8e-21
 Identities = 58/106 (54%), Positives = 59/106 (55%), Gaps = 3/106 (2%)
 Frame = +2

Query: 275 KPYKYPSPPPPVYKYNSPPPPYKYPSPP---PPPYKYPSPPPPVYKYKSPPPPVYKYKSP 445
           KP+    P PP      P PP   PSPP   PPP   P PPPPVY   SPPPP     SP
Sbjct: 226 KPFVPTLPAPP-----PPSPPMPVPSPPVYLPPPVYSPPPPPPVY---SPPPPP---PSP 274

Query: 446 PPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           PPP   P   P PPPPVY    PPPPVYSPPPP      PPPPVYS
Sbjct: 275 PPPVYSP---PPPPPPVYS-PPPPPPVYSPPPPPPSPPPPPPPVYS 316

 Score = 97.1 bits (240), Expect = 9e-19
 Identities = 51/96 (53%), Positives = 55/96 (57%), Gaps = 6/96 (6%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP----PPPYKYPSPPPPVYKYKSP 169
           Y  PPPP   P   P PPPP  +Y SPPPP   P PP    PPP   PSPPPP   Y SP
Sbjct: 446 YSPPPPPSPPPCIEPPPPPPCAEY-SPPPPSPSPPPPTQYKPPP--SPSPPPPPVHYYSP 502

Query: 170 PPPVYKYKSPPPPVYKYKSPPPPV--YKYKSPPPPP 271
           PPP    +SPPPP   Y+ P PP+    Y SPPPPP
Sbjct: 503 PPP---SQSPPPPAPVYEGPLPPITGVSYASPPPPP 535

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 32/63 (50%), Positives = 34/63 (53%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           YK PP         PSPPPP   Y SPPPP + P PP P Y+ P PP     Y SPPPP 
Sbjct: 484 YKPPPS--------PSPPPPPVHYYSPPPPSQSPPPPAPVYEGPLPPITGVSYASPPPPP 535

Query: 182 YKY 190
           Y Y
Sbjct: 536 YYY 538

[62][TOP]
>UniRef100_Q06446 Extensin n=1 Tax=Solanum tuberosum RepID=Q06446_SOLTU
          Length = 291

 Score =  204 bits (520), Expect = 3e-51
 Identities = 121/222 (54%), Positives = 125/222 (56%), Gaps = 41/222 (18%)
 Frame = +2

Query: 35  YKYPSPPPPVYKYNSPPPPYKYPSPPP----PPYKYPSP------PPPVYKYKSPPPPVY 184
           Y+Y SPPPPV+ Y SPP    Y SPPP    P YK P P      PP    YKSPPP  +
Sbjct: 28  YQYSSPPPPVHVYPSPPHHPVYKSPPPHHHHPVYKSPPPSEKPHYPPHTPVYKSPPPHHH 87

Query: 185 K--YKSPPPPVYKYKSPPPPVYK--------YKSPPPPPKKP-YKYPSPPPPVYKYNSPP 331
              YKSPPPP   YKSPPPP           YKSPPP    P YK+P PP PVYK  SPP
Sbjct: 88  HPVYKSPPPPTPVYKSPPPPKTPHYPPHTPVYKSPPPHHHHPVYKFPPPPTPVYK--SPP 145

Query: 332 PPYK---------YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYK---- 472
           PP           Y SPPPP   Y SPPPP   YKSPPPP   YKSPPPP  KPY     
Sbjct: 146 PPKDPHYPPHTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPV-KPYHPAPV 204

Query: 473 YPSPPPPVYKYKSP------PPPVY-SPPPPVYKYKSPPPPV 577
           Y SPPPP   YKSP      P PVY SPPPP   YKSPPPPV
Sbjct: 205 YKSPPPPTPVYKSPPVKPYHPAPVYKSPPPPTPIYKSPPPPV 246

 Score =  201 bits (512), Expect = 3e-50
 Identities = 130/266 (48%), Positives = 136/266 (51%), Gaps = 73/266 (27%)
 Frame = +2

Query: 2   YKSPPPP----PKKPYK--YPSPPP----PVYKYNSPPPPYKYPSPP-------PPPYK- 127
           Y SPPPP    P  P+   Y SPPP    PVYK  SPPP  K   PP       PPP+  
Sbjct: 30  YSSPPPPVHVYPSPPHHPVYKSPPPHHHHPVYK--SPPPSEKPHYPPHTPVYKSPPPHHH 87

Query: 128 ---YPSPPPPVYKYKSPPPP--------VYKYKSPPP----PVYKYKSPPPPVYKYKSPP 262
              Y SPPPP   YKSPPPP           YKSPPP    PVYK+  PP PVYK    P
Sbjct: 88  HPVYKSPPPPTPVYKSPPPPKTPHYPPHTPVYKSPPPHHHHPVYKFPPPPTPVYK---SP 144

Query: 263 PPPKKP--------YKYPSPPPPVYK--------YNSPPPP---YKYPSP------PPPP 367
           PPPK P        YK P PP PVYK        Y SPPPP   YK P P      P P 
Sbjct: 145 PPPKDPHYPPHTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPVKPYHPAPV 204

Query: 368 YKYPSPPPPVYK------------YKSPPPPVYKYKSPPPPAKKPYKYPSP--PPPVYKY 505
           YK P PP PVYK            YKSPPPP   YKSPPPP K  +  P+P  P PVYK 
Sbjct: 205 YKSPPPPTPVYKSPPVKPYHPAPVYKSPPPPTPIYKSPPPPVKPYHPSPTPYHPKPVYKS 264

Query: 506 KSPPPPVY-SPPPPVYKYKSPPPPVY 580
             PP PVY SPPP  Y Y SPPPP +
Sbjct: 265 PPPPTPVYKSPPPTHYVYSSPPPPYH 290

 Score =  132 bits (332), Expect = 2e-29
 Identities = 74/138 (53%), Positives = 76/138 (55%), Gaps = 23/138 (16%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYK--------YNSPPPPYKYPSPPPPPYKYPSPPPPVYK 157
           YKSPPPP    YK P PP PVYK        Y SPPPP K P  P P YK P PP PVYK
Sbjct: 159 YKSPPPPTPV-YKSPPPPTPVYKSPPPPTPVYKSPPPPVK-PYHPAPVYKSPPPPTPVYK 216

Query: 158 ------------YKSPPPPVYKYKSPPPPVYKYKSPPPPVYK---YKSPPPPPKKPYKYP 292
                       YKSPPPP   YKSPPPPV  Y   P P +    YKSPPPP      Y 
Sbjct: 217 SPPVKPYHPAPVYKSPPPPTPIYKSPPPPVKPYHPSPTPYHPKPVYKSPPPPTP---VYK 273

Query: 293 SPPPPVYKYNSPPPPYKY 346
           SPPP  Y Y+SPPPPY Y
Sbjct: 274 SPPPTHYVYSSPPPPYHY 291

[63][TOP]
>UniRef100_Q39865 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39865_SOYBN
          Length = 169

 Score =  202 bits (515), Expect = 1e-50
 Identities = 118/202 (58%), Positives = 121/202 (59%), Gaps = 15/202 (7%)
 Frame = +2

Query: 20  PPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSP 199
           PP  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y Y SPPPP     SP
Sbjct: 1   PP--PYYYHSPPPPS---PSPPPPYYYKSPPPPS---PSPPPPYY-YHSPPPPS---PSP 48

Query: 200 PPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP----- 364
           PPP Y Y SPPPP     SP PP   PY Y SPPPP     SPPPPY Y SPPPP     
Sbjct: 49  PPPYY-YHSPPPP-----SPSPP--SPYYYKSPPPPS---PSPPPPYYYKSPPPPSPTSH 97

Query: 365 -PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPP------ 523
            PY Y SPPPP     S PPP Y Y SPPPP+      PSPPPP Y Y SPPPP      
Sbjct: 98  PPYYYKSPPPPT----SYPPPPYHYVSPPPPS------PSPPPP-YHYTSPPPPSPAPAP 146

Query: 524 --VY-SPPPPVYKYKSPPPPVY 580
             +Y SPPPPVY Y SPPPP+Y
Sbjct: 147 KYIYKSPPPPVYIYASPPPPIY 168

 Score =  193 bits (491), Expect = 7e-48
 Identities = 110/185 (59%), Positives = 112/185 (60%), Gaps = 18/185 (9%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           Y SPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y Y SPP
Sbjct: 6   YHSPPPPSPSPPPPYYYKSPPPPS---PSPPPPYYYHSPPPPS---PSPPPPYY-YHSPP 58

Query: 173 PPV------YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKK---PYKYPSPPPPVYKYNS 325
           PP       Y YKSPPPP     SPPPP Y YKSPPPP      PY Y SPPPP    + 
Sbjct: 59  PPSPSPPSPYYYKSPPPPS---PSPPPPYY-YKSPPPPSPTSHPPYYYKSPPPPT---SY 111

Query: 326 PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV------YKYKSPPPPAKKPYKYPSPP 487
           PPPPY Y SPPPP    PSPPPP Y Y SPPPP       Y YKSPPPP    Y Y SPP
Sbjct: 112 PPPPYHYVSPPPPS---PSPPPP-YHYTSPPPPSPAPAPKYIYKSPPPPV---YIYASPP 164

Query: 488 PPVYK 502
           PP+YK
Sbjct: 165 PPIYK 169

[64][TOP]
>UniRef100_O65375 F12F1.9 protein n=1 Tax=Arabidopsis thaliana RepID=O65375_ARATH
          Length = 744

 Score =  200 bits (509), Expect = 6e-50
 Identities = 119/226 (52%), Positives = 125/226 (55%), Gaps = 35/226 (15%)
 Frame = +2

Query: 2    YKSPPPPPK-------KPYKYPSPP-----PPVYKYNSPPPPYKYPSP-----PPPPYKY 130
            Y SPPPPP        + Y  P PP     P V  Y+ PPPPY   SP     PPPP   
Sbjct: 404  YSSPPPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPS 463

Query: 131  PSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPV 310
            PSPPPP Y Y SPPPP Y Y SPPPP Y Y SPPPP Y Y SPPP    PY Y SPPPP 
Sbjct: 464  PSPPPP-YVYSSPPPP-YVYSSPPPPPYVYSSPPPPPYVYSSPPP----PYVYSSPPPP- 516

Query: 311  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKY----KSPPPPVYKY-----KSPPPPAKK 463
            Y Y+SPPPP   P  PPPP    SPPPPV  Y    +SPPPP   Y     +SPPPP+  
Sbjct: 517  YVYSSPPPP---PPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPS-- 571

Query: 464  PYKYP----SPPPPVYKYKSPPPPVYSPPPPVYKY-----KSPPPP 574
            P  YP    SPPPP   Y   PP  YSPPPP   Y      SPPPP
Sbjct: 572  PVYYPPVTNSPPPPSPVYY--PPVTYSPPPPSPVYYPQVTPSPPPP 615

 Score =  192 bits (488), Expect = 2e-47
 Identities = 118/219 (53%), Positives = 120/219 (54%), Gaps = 30/219 (13%)
 Frame = +2

Query: 8    SPPPPPKKPYK-----YPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
            SPPPPP          YP PPPP     SPPPPY Y SPPPP Y Y SPPPP Y Y SPP
Sbjct: 440  SPPPPPYSKMSPSVRAYPPPPPPS---PSPPPPYVYSSPPPP-YVYSSPPPPPYVYSSPP 495

Query: 173  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKY-- 346
            PP Y Y SPPPP Y Y SPPPP Y Y SPPPPP      PSPPPP  + +SPPPP  Y  
Sbjct: 496  PPPYVYSSPPPP-YVYSSPPPP-YVYSSPPPPP------PSPPPPCPE-SSPPPPVVYYA 546

Query: 347  ---PSPPPP-PYKYP----SPPPPVYKY-----KSPPP--PVY----KYKSPPP-PAKKP 466
                SPPPP P  YP    SPPPP   Y      SPPP  PVY     Y  PPP P   P
Sbjct: 547  PVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYP 606

Query: 467  YKYPSPPPPVYKYKSPPPPVYSPPPPVY---KYKSPPPP 574
               PSPPPP   Y  P  P   PP PVY      SPPPP
Sbjct: 607  QVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPP 645

 Score =  192 bits (488), Expect = 2e-47
 Identities = 116/218 (53%), Positives = 118/218 (54%), Gaps = 30/218 (13%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP      PSPPPP Y Y+SPPPPY Y SPPPPPY Y SPPPP Y Y SPPPP Y Y
Sbjct: 458  PPPPPS-----PSPPPP-YVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPP-YVY 510

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKY----NSPPP--PYKYP- 349
             SPPPP Y Y SPPP       PPP P  P    SPPPPV  Y     SPPP  P  YP 
Sbjct: 511  SSPPPP-YVYSSPPP-------PPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPP 562

Query: 350  ---SPPPP-PYKYP----SPPPPVYKY-----KSPPPP---VYKYKSPPPPAKKPYKY-- 475
               SPPPP P  YP    SPPPP   Y      SPPPP    Y   +P PP   P  Y  
Sbjct: 563  VTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPP 622

Query: 476  --PSPPPPVYKYKSPPPPVYSPPPPVY---KYKSPPPP 574
              PSPPPP   Y  P  P   PP PVY      SPPPP
Sbjct: 623  VTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPP 660

 Score =  188 bits (477), Expect = 3e-46
 Identities = 107/197 (54%), Positives = 111/197 (56%), Gaps = 17/197 (8%)
 Frame = +2

Query: 35  YKYPSPPPPVYKYNS-----PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK-- 193
           Y   SPPPP +K +      PPP Y Y SPPPPP    SP   V  Y  PPPP  K    
Sbjct: 378 YNIFSPPPPTFKMSPEVRTLPPPIYVYSSPPPPPSSKMSPT--VRAYSPPPPPSSKMSPS 435

Query: 194 ----SPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
               SPPPP Y   SP    Y    PPPPP      PSPPPP Y Y+SPPPPY Y SPPP
Sbjct: 436 VRAYSPPPPPYSKMSPSVRAYP---PPPPPS-----PSPPPP-YVYSSPPPPYVYSSPPP 486

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV--YSP 535
           PPY Y SPPPP Y Y SPPPP Y Y SPPP    PY Y SPPPP     SPPPP    SP
Sbjct: 487 PPYVYSSPPPPPYVYSSPPPP-YVYSSPPP----PYVYSSPPPPP---PSPPPPCPESSP 538

Query: 536 PPPVYKY----KSPPPP 574
           PPPV  Y    +SPPPP
Sbjct: 539 PPPVVYYAPVTQSPPPP 555

 Score =  179 bits (455), Expect = 1e-43
 Identities = 118/253 (46%), Positives = 124/253 (49%), Gaps = 62/253 (24%)
 Frame = +2

Query: 2    YKSPPPP------PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP-PYKYPSPPPPVYKY 160
            Y SPPPP      P  PY Y SPPPP Y Y+SPPPPY Y SPPPP  Y  P PPPP    
Sbjct: 472  YSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPP---- 527

Query: 161  KSPPPPVYKYKSPPPPVYKY----KSPPPPVYKYKSP---PPPPKKPYKYP----SPPP- 304
             SPPPP  +  SPPPPV  Y    +SPPPP   Y  P    PPP  P  YP    SPPP 
Sbjct: 528  -SPPPPCPE-SSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPP 585

Query: 305  -PVY----KYNSPPP-----PYKYPSPPPPPYKY-----PSPPPPVYKY-----KSPPPP 424
             PVY     Y+ PPP     P   PSPPPP   Y     PSPPPP   Y      SPPPP
Sbjct: 586  SPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPP 645

Query: 425  ---VYKYKSPPPPAKKPYKYP----SPPPPVYKYKSP---PPPVYS-------------P 535
                Y   +P PP   P  YP    SPPPP   Y SP   PPP  +              
Sbjct: 646  SPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYE 705

Query: 536  PPPVYKYKSPPPP 574
            PPP Y Y S PPP
Sbjct: 706  PPPEYSYSSSPPP 718

 Score =  174 bits (442), Expect = 3e-42
 Identities = 97/179 (54%), Positives = 100/179 (55%), Gaps = 16/179 (8%)
 Frame = +2

Query: 92  YKYPSPPPPPYKYPSP-----PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYK- 253
           Y   SPPPP +K  SP     PPP+Y Y SPPPP     SP   V  Y  PPPP  K   
Sbjct: 378 YNIFSPPPPTFKM-SPEVRTLPPPIYVYSSPPPPPSSKMSPT--VRAYSPPPPPSSKMSP 434

Query: 254 -----SPPPPPKKPYK-----YPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYK 403
                SPPPPP          YP PPPP     SPPPPY Y SPPPP Y Y SPPPP Y 
Sbjct: 435 SVRAYSPPPPPYSKMSPSVRAYPPPPPPS---PSPPPPYVYSSPPPP-YVYSSPPPPPYV 490

Query: 404 YKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
           Y SPPPP Y Y SPPPP    Y Y SPPPP Y Y SPPPP  SPPPP  +   PPP VY
Sbjct: 491 YSSPPPPPYVYSSPPPP----YVYSSPPPP-YVYSSPPPPPPSPPPPCPESSPPPPVVY 544

 Score =  169 bits (427), Expect = 2e-40
 Identities = 111/221 (50%), Positives = 116/221 (52%), Gaps = 32/221 (14%)
 Frame = +2

Query: 8    SPPPP-----PKKPYKY--PSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
            SPPPP     P  PY Y  P PPP VY  + PPPPY Y S PPPPY Y SPPPP Y Y S
Sbjct: 465  SPPPPYVYSSPPPPYVYSSPPPPPYVYS-SPPPPPYVY-SSPPPPYVYSSPPPP-YVYSS 521

Query: 167  PPPPVYKYKSPPPPVYKYKSPPPPVYKYK--SPPPPPKKPYKYP----SPPPPVYKY--- 319
            PPPP     SPPPP  +  SPPPPV  Y   +  PPP  P  YP    SPPPP   Y   
Sbjct: 522  PPPPP---PSPPPPCPE-SSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPP 577

Query: 320  --NSPPP--PYKYP----SPPPP-----PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK 460
              NSPPP  P  YP    SPPPP     P   PSPPPP   Y    PPV     PP P  
Sbjct: 578  VTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYY---PPVTPSPPPPSPVY 634

Query: 461  KPYKYPSPPPPVYKYKSPPPPVYSPPPPVY---KYKSPPPP 574
             P   PSPPPP   Y  P  P   PP PVY   + +SPPPP
Sbjct: 635  YPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPP 675

 Score =  145 bits (367), Expect = 2e-33
 Identities = 85/164 (51%), Positives = 90/164 (54%), Gaps = 10/164 (6%)
 Frame = +2

Query: 122 YKYPSPPPPVYKY----KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKY 289
           Y   SPPPP +K     ++ PPP+Y Y SPPPP     SP    Y   SPPPPP      
Sbjct: 378 YNIFSPPPPTFKMSPEVRTLPPPIYVYSSPPPPPSSKMSPTVRAY---SPPPPPSSKMS- 433

Query: 290 PSPPPPVYKYNSPPPPYKYPSP-----PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 454
               P V  Y+ PPPPY   SP     PPPP   PSPPPP Y Y SPPPP Y Y SPPPP
Sbjct: 434 ----PSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPP-YVYSSPPPP-YVYSSPPPP 487

Query: 455 AKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP-VYS 583
              PY Y SPPPP Y Y        SPPPP Y Y SPPPP VYS
Sbjct: 488 ---PYVYSSPPPPPYVYS-------SPPPP-YVYSSPPPPYVYS 520

 Score =  124 bits (311), Expect = 5e-27
 Identities = 94/235 (40%), Positives = 100/235 (42%), Gaps = 59/235 (25%)
 Frame = +2

Query: 2    YKSPPPPPKKP---YKYPSPPPPVYKY-------------------NSPPPPYK--YP-- 103
            Y SPPPPP  P       SPPPPV  Y                    SPPPP    YP  
Sbjct: 519  YSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPV 578

Query: 104  --SPPPP-PYKYP----SPPPPVYKY-----KSPPPPVYKY-----KSPPPPVYKY---- 220
              SPPPP P  YP    SPPPP   Y      SPPPP   Y      SPPPP   Y    
Sbjct: 579  TNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPV 638

Query: 221  -KSPPPPVYKY---KSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKY---PSPPPPPYK-- 373
              SPPPP   Y    +P PPP  P  YPS      +  SPPPP +Y   PS  PPP K  
Sbjct: 639  TPSPPPPSPVYYPPVTPSPPPPSPVYYPS------ETQSPPPPTEYYYSPSQSPPPTKAC 692

Query: 374  ---YPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY 529
               +P    P Y+    PPP Y Y S PPP      +P  P   Y    PPPP Y
Sbjct: 693  KEGHPPQATPSYE----PPPEYSYSSSPPPPSPTSYFPPMPSVSYDASPPPPPSY 743

 Score =  110 bits (276), Expect = 6e-23
 Identities = 80/179 (44%), Positives = 82/179 (45%), Gaps = 39/179 (21%)
 Frame = +2

Query: 17   PPPKKPYKYP----SPPPP--VY----KYNSPPP-----PYKYPSPPPPPYKY-----PS 136
            PPP  P  YP    SPPPP  VY     Y+ PPP     P   PSPPPP   Y     PS
Sbjct: 567  PPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPS 626

Query: 137  PPPPVYKY-----KSPPPPVYKY-----KSPPPPVYKY-----KSPPPPVYKYKSPP--P 265
            PPPP   Y      SPPPP   Y      SPPPP   Y     +SPPPP   Y SP   P
Sbjct: 627  PPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSP 686

Query: 266  PPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY--KYPSPPPPVYKYKSPPPPVYKY 436
            PP K  K   PP     Y  PPP Y Y S PPPP    Y  P P V    SPPPP   Y
Sbjct: 687  PPTKACKEGHPPQATPSYE-PPPEYSYSSSPPPPSPTSYFPPMPSVSYDASPPPPPSYY 744

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 59/136 (43%), Positives = 62/136 (45%), Gaps = 23/136 (16%)
 Frame = +2

Query: 8    SPPPPPKKPYKYP----SPPPPVYKYN-----SPPPPYKY------PSPPPP-PYKYPS- 136
            +P PPP  P  YP    SPPPP   Y      SPPPP         PSPPPP P  YPS 
Sbjct: 609  TPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSE 668

Query: 137  ---PPPPVYKYKSP---PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSP 298
               PPPP   Y SP   PPP    K   PP       PPP Y Y S PPPP     +P  
Sbjct: 669  TQSPPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPPPPSPTSYFPPM 728

Query: 299  PPPVYKYNSPPPPYKY 346
            P   Y  + PPPP  Y
Sbjct: 729  PSVSYDASPPPPPSYY 744

[65][TOP]
>UniRef100_Q41120 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=Q41120_PHAVU
          Length = 154

 Score =  198 bits (504), Expect = 2e-49
 Identities = 109/177 (61%), Positives = 111/177 (62%), Gaps = 9/177 (5%)
 Frame = +2

Query: 26  KKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 205
           K PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPPPP     SPPP
Sbjct: 2   KPPYYYKSPPPP---SPSPPPPYYYKSPPPPS---PSPPPPYY-YKSPPPP---SPSPPP 51

Query: 206 PVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPP------PVYKYNSPPPPYKYPSPPPPP 367
           P Y YKSPPPP     SP PPP  PY Y SPPP      P Y Y SPPPP  Y   PPPP
Sbjct: 52  PYY-YKSPPPP-----SPSPPP--PYYYHSPPPPSPTPHPPYYYKSPPPPTSY---PPPP 100

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP---YKYPSPPPPVYKYKSPPPPVY 529
           Y Y SPPPP     SPPPP Y YKSPPPP+  P   Y Y SPPPP Y Y SPPPP+Y
Sbjct: 101 YHYVSPPPP---SPSPPPPYY-YKSPPPPSPAPAPKYIYKSPPPPAYIYSSPPPPIY 153

 Score =  189 bits (481), Expect = 1e-46
 Identities = 108/180 (60%), Positives = 112/180 (62%), Gaps = 15/180 (8%)
 Frame = +2

Query: 86  PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP 265
           PPY Y SPPPP    PSPPPP Y YKSPPPP     SPPPP Y YKSPPPP     SP P
Sbjct: 3   PPYYYKSPPPPS---PSPPPPYY-YKSPPPPS---PSPPPPYY-YKSPPPP-----SPSP 49

Query: 266 PPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV------ 427
           PP  PY Y SPPPP     SPPPPY Y SPPPP    P+P PP Y YKSPPPP       
Sbjct: 50  PP--PYYYKSPPPPS---PSPPPPYYYHSPPPPS---PTPHPPYY-YKSPPPPTSYPPPP 100

Query: 428 YKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPP--------VY-SPPPPVYKYKSPPPPVY 580
           Y Y SPPPP+      PSPPPP Y YKSPPPP        +Y SPPPP Y Y SPPPP+Y
Sbjct: 101 YHYVSPPPPS------PSPPPPYY-YKSPPPPSPAPAPKYIYKSPPPPAYIYSSPPPPIY 153

 Score =  185 bits (470), Expect = 2e-45
 Identities = 106/177 (59%), Positives = 108/177 (61%), Gaps = 12/177 (6%)
 Frame = +2

Query: 59  PVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 238
           P Y Y SPPPP   PSPPPP Y Y SPPPP     SPPPP Y YKSPPPP     SPPPP
Sbjct: 3   PPYYYKSPPPPS--PSPPPP-YYYKSPPPPS---PSPPPPYY-YKSPPPPS---PSPPPP 52

Query: 239 VYKYKSPPPP---PKKPYKYPSPPPPV------YKYNSPPPPYKYPSPPPPPYKYPSPPP 391
            Y YKSPPPP   P  PY Y SPPPP       Y Y SPPPP  YP   PPPY Y SPPP
Sbjct: 53  YY-YKSPPPPSPSPPPPYYYHSPPPPSPTPHPPYYYKSPPPPTSYP---PPPYHYVSPPP 108

Query: 392 PVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY---SPPPPVYK 553
           P     SPPPP Y YKSPPPP+  P        P Y YKSPPPP Y   SPPPP+YK
Sbjct: 109 PS---PSPPPPYY-YKSPPPPSPAP-------APKYIYKSPPPPAYIYSSPPPPIYK 154

 Score =  159 bits (401), Expect = 2e-37
 Identities = 85/148 (57%), Positives = 88/148 (59%), Gaps = 14/148 (9%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y +  PP
Sbjct: 23  YKSPPPPSPSPPPPYYYKSPPPPS---PSPPPPYYYKSPPPPS---PSPPPPYYYHSPPP 76

Query: 173 P-----PVYKYKSPPPPV------YKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKY 319
           P     P Y YKSPPPP       Y Y SPPPP     SP PPP  PY Y SPPPP    
Sbjct: 77  PSPTPHPPYYYKSPPPPTSYPPPPYHYVSPPPP-----SPSPPP--PYYYKSPPPP---S 126

Query: 320 NSPPPPYKYPSPPPPPYKYPSPPPPVYK 403
            +P P Y Y SPPPP Y Y SPPPP+YK
Sbjct: 127 PAPAPKYIYKSPPPPAYIYSSPPPPIYK 154

[66][TOP]
>UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
           RepID=UPI00015B501E
          Length = 406

 Score =  196 bits (499), Expect = 9e-49
 Identities = 102/203 (50%), Positives = 103/203 (50%), Gaps = 12/203 (5%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           Y  PPPP   P   P PPPP   Y  PPPP   P PPPP    P PPPP   Y  PPPP 
Sbjct: 175 YGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPP----PPPPPPA--YGPPPPPA 228

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP------YK 343
           Y    PPPP      PPPP Y    PPPPP  P  Y  PPPP Y    PPPP      Y 
Sbjct: 229 YGPPPPPPP-----PPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYA 283

Query: 344 Y-----PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKY- 505
           Y     P PPPPP  Y  PPPP Y    PPPP   Y  PPPPA  P   P PPPP   Y 
Sbjct: 284 YGPPPPPPPPPPPPAYSPPPPPAYG-PPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYA 342

Query: 506 KSPPPPVYSPPPPVYKYKSPPPP 574
             PPPP Y+PPPP   Y  PPPP
Sbjct: 343 PPPPPPAYAPPPPPPAYAPPPPP 365

 Score =  196 bits (498), Expect = 1e-48
 Identities = 101/202 (50%), Positives = 101/202 (50%), Gaps = 11/202 (5%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           Y  PPPP   P   P PPPP   Y  PPPP   P PPPP    P PPPP   Y  PPPP 
Sbjct: 106 YAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPP----PPPPPPA--YGPPPPPA 159

Query: 182 Y---KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPS 352
           Y       PPPP   Y  PPPP Y    PPPPP  P  Y  PPPP Y    PPPP   P 
Sbjct: 160 YGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAY---GPPPP---PP 213

Query: 353 PPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYS 532
           PPPPP  Y  PPPP Y    PPPP      PPPPA  P   P PPPP   Y  PPPP Y 
Sbjct: 214 PPPPPPAYGPPPPPAYGPPPPPPP-----PPPPPAYSPPPPPPPPPPPAAYGPPPPPAYG 268

Query: 533 PPPP--------VYKYKSPPPP 574
           PPPP         Y Y  PPPP
Sbjct: 269 PPPPPPPPPPPAAYAYGPPPPP 290

 Score =  195 bits (495), Expect = 2e-48
 Identities = 102/202 (50%), Positives = 102/202 (50%), Gaps = 12/202 (5%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P  Y  PPPP Y    PPPP   P PPPPP  Y  PPPP Y    PPPP    
Sbjct: 142 PPPPPPPPPAYGPPPPPAY---GPPPP---PPPPPPPPAYGPPPPPAYGPPPPPPP---- 191

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP Y    PPPP Y    PPPPP  P  Y  PPPP Y    PPPP   P PPPP Y
Sbjct: 192 -PPPPPAYG--PPPPPAYGPPPPPPPPPPPPAYGPPPPPAY---GPPPPPP-PPPPPPAY 244

Query: 371 K---YPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKY-------PSPPPPVYKYKSPPP 520
                P PPPP   Y  PPPP Y    PPPP   P  Y       P PPPP   Y  PPP
Sbjct: 245 SPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPP 304

Query: 521 PVYS--PPPPVYKYKSPPPPVY 580
           P Y   PPPP   Y  PPPP Y
Sbjct: 305 PAYGPPPPPPPPAYAPPPPPAY 326

 Score =  194 bits (493), Expect = 4e-48
 Identities = 101/202 (50%), Positives = 103/202 (50%), Gaps = 12/202 (5%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVY-----KYKSPPP 175
           PPPPP  P  Y  PPPP Y    PPPP   P PPPPP  Y  PPPP Y         PPP
Sbjct: 188 PPPPPPPPPAYGPPPPPAY---GPPPP---PPPPPPPPAYGPPPPPAYGPPPPPPPPPPP 241

Query: 176 PVYKYKSPPPPV---YKYKSPPPPVYKYKSPPPPPKKPYKY----PSPPPPVYKYNSPPP 334
           P Y    PPPP      Y  PPPP Y    PPPPP  P  Y    P PPPP      PPP
Sbjct: 242 PAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPP------PPP 295

Query: 335 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSP 514
           P  Y SPPPPP   P PPPP   Y  PPPP Y   +PPPP   P  Y  PPPP      P
Sbjct: 296 PPAY-SPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPP 354

Query: 515 PPPVYSPPPPVYKYKSPPPPVY 580
           PPP Y+PPPP  KY   P  VY
Sbjct: 355 PPPAYAPPPPPPKYSPAPIVVY 376

 Score =  193 bits (491), Expect = 7e-48
 Identities = 104/212 (49%), Positives = 104/212 (49%), Gaps = 21/212 (9%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVY---KYKSPPPPV 181
           PPPPP  P  Y  PPPP Y    PPPP   P PPPPP  Y  PPPP Y       PPPP 
Sbjct: 165 PPPPPPPPPAYGPPPPPAY---GPPPP---PPPPPPPPAYGPPPPPAYGPPPPPPPPPPP 218

Query: 182 YKYKSPPPPVY-----KYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP--- 337
             Y  PPPP Y         PPPP Y    PPPPP  P  Y  PPPP Y    PPPP   
Sbjct: 219 PAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPP 278

Query: 338 ---YKY-----PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPP 493
              Y Y     P PPPPP  Y  PPPP Y    PPPP   Y  PPPPA  P   P PPPP
Sbjct: 279 PAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPPPPPPP-AYAPPPPPAYGPPAPPPPPPP 337

Query: 494 VYKYKSPPPP--VYSPPPPVYKYKSPPPPVYS 583
              Y  PPPP     PPPP      PPPP YS
Sbjct: 338 PPAYAPPPPPPAYAPPPPPPAYAPPPPPPKYS 369

 Score =  189 bits (481), Expect = 1e-46
 Identities = 101/202 (50%), Positives = 101/202 (50%), Gaps = 12/202 (5%)
 Frame = +2

Query: 11  PPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY---KYPSPPPPVYKYKSPP 172
           P PP   P  P   P PPPP Y    PPPP  Y  PPPP Y     P PPPP   Y  PP
Sbjct: 76  PAPPAYAPPPPVYAPPPPPPAYA--PPPPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPPP 133

Query: 173 PPVY---KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYK 343
           PP Y       PPPP   Y  PPPP Y    PPPPP  P  Y  PPPP Y    PPPP  
Sbjct: 134 PPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAY---GPPPP-- 188

Query: 344 YPSPPPPPYKYPSPPPPVY---KYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSP 514
            P PPPPP  Y  PPPP Y       PPPP   Y  PPPPA  P   P PPPP   Y  P
Sbjct: 189 -PPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPP 247

Query: 515 PPPVYSPPPPVYKYKSPPPPVY 580
           PPP   PPPP   Y  PPPP Y
Sbjct: 248 PPP--PPPPPPAAYGPPPPPAY 267

 Score =  188 bits (477), Expect = 3e-46
 Identities = 102/208 (49%), Positives = 105/208 (50%), Gaps = 17/208 (8%)
 Frame = +2

Query: 11  PPPPPK--------------KPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPP 148
           PPPPP                P  Y +PPPPVY    PPP Y   +PPPPP  Y  PPPP
Sbjct: 57  PPPPPAYDDCDEIVLVPGKPAPPAY-APPPPVYAPPPPPPAY---APPPPPPAYAPPPPP 112

Query: 149 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSP 328
            Y   +PPPP      PPPP   Y  PPPP Y    PPPPP  P  Y  PPPP Y    P
Sbjct: 113 AY---APPPP----PPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAY---GP 162

Query: 329 PPPYKYPSPPPPPYKYPSPPPPVY---KYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVY 499
           PPP   P PPPPP  Y  PPPP Y       PPPP   Y  PPPPA  P   P PPPP  
Sbjct: 163 PPP---PPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPP 219

Query: 500 KYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
            Y  PPPP Y PPPP      PPPP YS
Sbjct: 220 AYGPPPPPAYGPPPP--PPPPPPPPAYS 245

 Score =  186 bits (471), Expect = 2e-45
 Identities = 99/196 (50%), Positives = 102/196 (52%), Gaps = 8/196 (4%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P  Y  PPPP Y    PPPP   P PPPPP  Y  PPPP      PPPP   Y
Sbjct: 211 PPPPPPPPPAYGPPPPPAY---GPPPP---PPPPPPPPAYSPPPPP-----PPPPPPAAY 259

Query: 191 KSPPPPVYKYKSPPPP-------VYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP 349
             PPPP Y    PPPP        Y    PPPPP  P  Y  PPPP Y    PPPP  Y 
Sbjct: 260 GPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPPPPPPPAYA 319

Query: 350 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY 529
            PPPP Y  P+PPPP      PPPP Y   +PPPP   P   P PPPP Y    PPPP Y
Sbjct: 320 PPPPPAYGPPAPPPP-----PPPPPAY---APPPP--PPAYAPPPPPPAYA-PPPPPPKY 368

Query: 530 SPPP-PVYKYKSPPPP 574
           SP P  VY   +PPPP
Sbjct: 369 SPAPIVVYGPPAPPPP 384

 Score =  167 bits (424), Expect = 4e-40
 Identities = 91/188 (48%), Positives = 94/188 (50%), Gaps = 5/188 (2%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPP-----VYKYKSPPP 175
           PPPPP   Y  P PPPP      PPPP  Y  PPPP Y  P PPPP      Y Y  PPP
Sbjct: 236 PPPPPPPAYSPPPPPPP------PPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPP 289

Query: 176 PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
           P      PPPP   Y  PPPP Y    PPPPP  P  Y  PPPP Y   +PPPP     P
Sbjct: 290 P-----PPPPPPPAYSPPPPPAY---GPPPPPPPP-AYAPPPPPAYGPPAPPPP-----P 335

Query: 356 PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
           PPPP   P PPPP Y   +PPPP   Y  PPPP K        P P+  Y  P PP   P
Sbjct: 336 PPPPAYAPPPPPPAY---APPPPPPAYAPPPPPPK------YSPAPIVVYGPPAPP---P 383

Query: 536 PPPVYKYK 559
           PPP  K K
Sbjct: 384 PPPAPKRK 391

 Score =  145 bits (365), Expect = 3e-33
 Identities = 85/178 (47%), Positives = 89/178 (50%), Gaps = 1/178 (0%)
 Frame = +2

Query: 44  PSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYK 223
           P PPPP   Y+        P  P PP    +PPPPVY    PPPP Y   +PPPP   Y 
Sbjct: 54  PQPPPPPPAYDDCDEIVLVPGKPAPPAY--APPPPVYA-PPPPPPAY---APPPPPPAYA 107

Query: 224 SPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYK 403
            PPPP Y   +PPPPP  P     PPPP Y    PPPP  Y  PPPPP   P PPPP Y 
Sbjct: 108 PPPPPAY---APPPPPPPP-----PPPPSY---GPPPPPAYGPPPPPP---PPPPPPAYG 153

Query: 404 YKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY-SPPPPVYKYKSPPPP 574
              PPPP Y    PPPP         PPPP      PPPP Y  PPPP Y    PPPP
Sbjct: 154 --PPPPPAY---GPPPP---------PPPP------PPPPAYGPPPPPAYGPPPPPPP 191

[67][TOP]
>UniRef100_B9GF15 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GF15_POPTR
          Length = 152

 Score =  196 bits (498), Expect = 1e-48
 Identities = 115/183 (62%), Positives = 115/183 (62%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           YKSPPPP        SPPPP Y Y SPPPP   P   PPPY Y SPPPP     SPPPP 
Sbjct: 2   YKSPPPPST------SPPPP-YIYKSPPPP---PPSSPPPYIYKSPPPPS---PSPPPP- 47

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
           Y Y SPPPP     SPPPP Y YKSPPPPP  P   PSPPPP Y Y SPPPP   PS PP
Sbjct: 48  YVYMSPPPPS---PSPPPP-YIYKSPPPPPPPP--SPSPPPP-YVYKSPPPP--SPS-PP 97

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPP 541
           PPY Y SPPPP     SPPPP Y Y SPPPP       PSPPPP Y YKSPPPP  SPPP
Sbjct: 98  PPYVYNSPPPP---SPSPPPP-YVYNSPPPPPSS----PSPPPP-YIYKSPPPPSPSPPP 148

Query: 542 PVY 550
           P Y
Sbjct: 149 PPY 151

 Score =  177 bits (448), Expect = 7e-43
 Identities = 101/168 (60%), Positives = 102/168 (60%), Gaps = 9/168 (5%)
 Frame = +2

Query: 98  YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPP--PPVYKYKSPPPPVYKYKSPPPPP 271
           Y SPPPP     SPPPP Y YKSPPPP      PP  PP Y YKSPPPP     SP PPP
Sbjct: 2   YKSPPPPS---TSPPPP-YIYKSPPPP------PPSSPPPYIYKSPPPP-----SPSPPP 46

Query: 272 KKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP------PPPVYK 433
             PY Y SPPPP     SPPPPY Y SPPPPP      PPP Y YKSP      PPP Y 
Sbjct: 47  --PYVYMSPPPPS---PSPPPPYIYKSPPPPPPPPSPSPPPPYVYKSPPPPSPSPPPPYV 101

Query: 434 YKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP-PPPVYKYKSPPPP 574
           Y SPPPP+      PSPPPP Y Y SPPPP  SP PPP Y YKSPPPP
Sbjct: 102 YNSPPPPS------PSPPPP-YVYNSPPPPPSSPSPPPPYIYKSPPPP 142

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 36/67 (53%), Positives = 36/67 (53%), Gaps = 16/67 (23%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPV------YKYNSPPPPYKYPSPPPP-------PYKYP 133
           YKSPPPP   P  PY Y SPPPP       Y YNSPPPP   PSPPPP       P    
Sbjct: 86  YKSPPPPSPSPPPPYVYNSPPPPSPSPPPPYVYNSPPPPPSSPSPPPPYIYKSPPPPSPS 145

Query: 134 SPPPPVY 154
            PPPP Y
Sbjct: 146 PPPPPYY 152

[68][TOP]
>UniRef100_Q6GUG3 Serine/proline-rich repeat protein n=2 Tax=Lupinus angustifolius
           RepID=Q6GUG3_LUPAN
          Length = 198

 Score =  195 bits (496), Expect = 2e-48
 Identities = 115/196 (58%), Positives = 118/196 (60%), Gaps = 12/196 (6%)
 Frame = +2

Query: 29  KPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 208
           +PY Y  PP   Y Y SPPPP   PS PPPPY Y SPPPP     SPPPP Y YKSPPPP
Sbjct: 33  QPYYYYQPPS--YYYQSPPPPSPSPS-PPPPYVYKSPPPP---SPSPPPP-YAYKSPPPP 85

Query: 209 VYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYP 379
                SPPPP Y YKSPPPP   P  PY   SPPPP    +SPPPPY Y SPPPP    P
Sbjct: 86  ---SPSPPPP-YLYKSPPPPSPSPPPPYVNKSPPPP---SSSPPPPYIYKSPPPPS---P 135

Query: 380 SPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPP----- 544
           SPPPP     SPPPP     SPPPP+      PSPPPP Y YKSPPPP  SPPPP     
Sbjct: 136 SPPPP---SPSPPPP---SPSPPPPS------PSPPPP-YVYKSPPPPSPSPPPPSPSPP 182

Query: 545 ----VYKYKSPPPPVY 580
                Y Y SPPPPVY
Sbjct: 183 PPYHPYLYSSPPPPVY 198

 Score =  152 bits (385), Expect = 1e-35
 Identities = 92/160 (57%), Positives = 92/160 (57%), Gaps = 17/160 (10%)
 Frame = +2

Query: 2   YKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPV- 151
           YKSPPPP   P  PY Y SPPPP     SPPPPY Y SPPPP      PY   SPPPP  
Sbjct: 63  YKSPPPPSPSPPPPYAYKSPPPPS---PSPPPPYLYKSPPPPSPSPPPPYVNKSPPPPSS 119

Query: 152 -----YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYK 316
                Y YKSPPPP     SPPPP     SPPPP     SP PPP      PSPPPP Y 
Sbjct: 120 SPPPPYIYKSPPPP---SPSPPPP---SPSPPPP-----SPSPPPPS----PSPPPP-YV 163

Query: 317 YNSPPPPYKYPSPPPPPYKYPSPPPPV--YKYKSPPPPVY 430
           Y SPPPP   PSPPPP    PSPPPP   Y Y SPPPPVY
Sbjct: 164 YKSPPPP--SPSPPPPS---PSPPPPYHPYLYSSPPPPVY 198

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 54/88 (61%), Positives = 57/88 (64%)
 Frame = +2

Query: 311 YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPP 490
           + YN+  P Y Y    PP Y Y SPPPP     SPPPP Y YKSPPPP+      PSPPP
Sbjct: 27  HPYNAGQPYYYYQ---PPSYYYQSPPPPSPS-PSPPPP-YVYKSPPPPS------PSPPP 75

Query: 491 PVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           P Y YKSPPPP  SPPPP Y YKSPPPP
Sbjct: 76  P-YAYKSPPPPSPSPPPP-YLYKSPPPP 101

[69][TOP]
>UniRef100_A5BQP2 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BQP2_VITVI
          Length = 1190

 Score =  195 bits (496), Expect = 2e-48
 Identities = 118/215 (54%), Positives = 126/215 (58%), Gaps = 22/215 (10%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPP-PVYKYNSPPPP--YKYPSPPPPP-YKYPSPPP-PVYKYKS 166
           YK P PPP   YK P PPP P+YK   PPP   YK P PPP P YK P PPP P+YK   
Sbjct: 298 YKKPLPPPVPVYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPL 357

Query: 167 PPP-PVYKYKSPPP-PVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPP-PVYKYNSPPPP 337
           PPP P+YK   PPP PVYK K  PPPV  YK P PPP   YK P PPP P+YK   PPP 
Sbjct: 358 PPPVPIYKKPLPPPVPVYK-KPLPPPVPVYKKPLPPPVPVYKKPLPPPVPIYKKPLPPPV 416

Query: 338 --YKYPSPPP-PPYKYPSPPP-PVYKYKSPPPPVYKYKSPPPPAKKPYKYPSP------- 484
             YK P PPP P YK P PPP PVYK K  PPPV  YK P PP    YK P P       
Sbjct: 417 PIYKKPLPPPVPVYKKPLPPPVPVYK-KPLPPPVPVYKKPLPPPVPVYKKPCPPEIPKIL 475

Query: 485 PPPVYKYKSPPP---PVYSPPPPVYKYKSPPPPVY 580
           PPP+  YK P P   P+Y P PP+ K   P PP+Y
Sbjct: 476 PPPIPIYKKPLPPFVPIYKPIPPISKPLPPFPPIY 510

 Score =  179 bits (454), Expect = 1e-43
 Identities = 117/220 (53%), Positives = 123/220 (55%), Gaps = 28/220 (12%)
 Frame = +2

Query: 5   KSPPPPPKKPY------------KYPSPPPPVY-KYNSPPPPYKYPSPPPPPYKYPSPPP 145
           K PP     P+            K+P  PP VY  +  PP P K   PP P YK P PPP
Sbjct: 224 KLPPYSKSHPWYKPMPKIYLPPIKFPPLPPKVYPPFTFPPLPPKVFPPPVPIYKKPLPPP 283

Query: 146 -PVYKYKSPPP-PVYKYKSPPP-PVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPP-PVY 313
            PVYK   PPP PVYK   PPP PVYK K  PPPV  YK P PPP   YK P PPP P+Y
Sbjct: 284 VPVYKKPLPPPVPVYKKPLPPPVPVYK-KPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIY 342

Query: 314 KYNSPPPP--YKYPSPPPPP-YKYPSPPP-PVYKYKSPPPPVYKYKSPPPPAKKPYKYPS 481
           K   PPP   YK P PPP P YK P PPP PVYK K  PPPV  YK P PP    YK P 
Sbjct: 343 KKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYK-KPLPPPVPVYKKPLPPPVPVYKKPL 401

Query: 482 PPP-PVYKYKSPPP-PVYS----PPPPVYKYKSPPP-PVY 580
           PPP P+YK   PPP P+Y     PP PVYK   PPP PVY
Sbjct: 402 PPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVY 441

 Score =  169 bits (427), Expect = 2e-40
 Identities = 109/206 (52%), Positives = 117/206 (56%), Gaps = 13/206 (6%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPP-PVYKYNSPPPP--YKYPSPPPPP-YKYPSPPP-PVYKYKS 166
           YK P PPP   YK P PPP P+YK   PPP   YK P PPP P YK P PPP PVYK   
Sbjct: 342 YKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPL 401

Query: 167 PPP-PVYKYKSPPP-PVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPP-PVYKYNSPP-- 331
           PPP P+YK   PPP P+YK K  PPPV  YK P PPP   YK P PPP PVYK   PP  
Sbjct: 402 PPPVPIYKKPLPPPVPIYK-KPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPV 460

Query: 332 PPYKYPSPPPPPYKYPSPPPPVYKYKSPP-PPVYKYKSPPPPAKKPYKYPSPPPPVYKYK 508
           P YK P PP  P   P PP P+YK   PP  P+YK   P PP  KP     P PP+YK  
Sbjct: 461 PVYKKPCPPEIPKILP-PPIPIYKKPLPPFVPIYK---PIPPISKPL---PPFPPIYKKP 513

Query: 509 SPPPPVYSPP--PPVYKYKSPPPPVY 580
            PP P    P  PPV+K+    PP Y
Sbjct: 514 WPPIPQVPLPKFPPVHKF----PPKY 535

 Score =  155 bits (393), Expect = 2e-36
 Identities = 102/236 (43%), Positives = 114/236 (48%), Gaps = 42/236 (17%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP---P 172
            YK   PP   PY  PSPP  VY   SP P Y  P PPP P  +   PPPV  Y  P   P
Sbjct: 863  YKQQIPPSVPPYTAPSPPQ-VYDQPSPQPVYYEPHPPPVPIYHKPLPPPVRVYGQPFPSP 921

Query: 173  PPVYKYKSPPP-PVYKYKS-----PPPPVYKYKSPPPPPKKPYKYPSP------PPPVYK 316
             PVYK   PPP P+YK        PP PV+K   PPP PK P   P P      PPP   
Sbjct: 922  VPVYKKPLPPPVPIYKKPPLPSLPPPVPVHKKSLPPPVPKPPLPPPVPVSQEPLPPPSPV 981

Query: 317  YNSPPPP-----YKYPSPP------PPP---YKYPSPPPPVYKYKS-----PPPPVYKYK 439
            YN P PP      K P PP      PPP   +K P+ PPPV  YK      PPPPV  Y 
Sbjct: 982  YNEPLPPSPVPVLKKPIPPIVEKPLPPPVPIFKKPALPPPVPVYKKPPLPPPPPPVPVYG 1041

Query: 440  SPPPPAKKPYKYPSPPP-PVYKYKSPPP-PVYSPPPPVYK------YKSPPPPVYS 583
             P PP    +K P PPP P+ +   PPP P++ P PP+ K          PPP+YS
Sbjct: 1042 EPLPPPVPAFKKPYPPPLPIVEKPLPPPIPIHKPIPPISKPAPTPEVLPAPPPIYS 1097

 Score =  148 bits (374), Expect = 3e-34
 Identities = 103/236 (43%), Positives = 112/236 (47%), Gaps = 46/236 (19%)
 Frame = +2

Query: 2    YKSPPPP-----PKKPYKY------PSPPPPVYKYNSPPPPYKYPSPPP----------P 118
            YK PP P     PK   K+      P P P  Y      PP  +P PPP          P
Sbjct: 813  YKYPPLPTLPHWPKPLPKFYLPPFSPVPTPITYPAPEADPPVSHPPPPPVYKQQIPPSVP 872

Query: 119  PYKYPSP--------PPPVYKYKSPPPPVYKYKSP-PPPVYKYKSP-PPPVYKYKSPPPP 268
            PY  PSP        P PVY Y+  PPPV  Y  P PPPV  Y  P P PV  YK P PP
Sbjct: 873  PYTAPSPPQVYDQPSPQPVY-YEPHPPPVPIYHKPLPPPVRVYGQPFPSPVPVYKKPLPP 931

Query: 269  PKKPYKYP-----SPPPPVYKYNSPPPPYKYPSPPPPPY-KYPSPPP-PVYKYKSPPPPV 427
            P   YK P      PP PV+K + PPP  K P PPP P  + P PPP PVY    PP PV
Sbjct: 932  PVPIYKKPPLPSLPPPVPVHKKSLPPPVPKPPLPPPVPVSQEPLPPPSPVYNEPLPPSPV 991

Query: 428  YKYKSP-PPPAKKP-------YKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPP 571
               K P PP  +KP       +K P+ PPPV  YK PP P   PP PVY    PPP
Sbjct: 992  PVLKKPIPPIVEKPLPPPVPIFKKPALPPPVPVYKKPPLPPPPPPVPVYGEPLPPP 1047

 Score =  147 bits (371), Expect = 6e-34
 Identities = 98/199 (49%), Positives = 107/199 (53%), Gaps = 17/199 (8%)
 Frame = +2

Query: 35  YKYPSPP----PPVYKYNSPPPPYK-YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSP 199
           YK+P  P    P +  Y+   P YK  P    PP K+P  PP VY       P + +   
Sbjct: 212 YKHPQLPKVSWPKLPPYSKSHPWYKPMPKIYLPPIKFPPLPPKVY-------PPFTFPPL 264

Query: 200 PPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPP-PVYKYNSPP--PPYKYPSPPPPP- 367
           PP V+     PPPV  YK P PPP   YK P PPP PVYK   PP  P YK P PPP P 
Sbjct: 265 PPKVF-----PPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPI 319

Query: 368 YKYPSPPP-PVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPP-PVYKYKSPPP-PVYS-- 532
           YK P PPP P+YK K  PPPV  YK P PP    YK P PPP P+YK   PPP PVY   
Sbjct: 320 YKKPLPPPVPIYK-KPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKP 378

Query: 533 --PPPPVYKYKSPPP-PVY 580
             PP PVYK   PPP PVY
Sbjct: 379 LPPPVPVYKKPLPPPVPVY 397

 Score =  130 bits (327), Expect = 8e-29
 Identities = 96/261 (36%), Positives = 113/261 (43%), Gaps = 70/261 (26%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPS-----PPPPVYKYNSPPPPYKYPSPPPPP------------YKY 130
            YK P PPP   YK P      PP PV+K + PPP  K P PPP P            Y  
Sbjct: 925  YKKPLPPPVPIYKKPPLPSLPPPVPVHKKSLPPPVPKPPLPPPVPVSQEPLPPPSPVYNE 984

Query: 131  PSPPPPVYKYKSPPPPVYKYKSPPP-PVYKYKSPPPPVYKYKSPPPPPKKP----YKYPS 295
            P PP PV   K P PP+ +   PPP P++K  + PPPV  YK PP PP  P    Y  P 
Sbjct: 985  PLPPSPVPVLKKPIPPIVEKPLPPPVPIFKKPALPPPVPVYKKPPLPPPPPPVPVYGEPL 1044

Query: 296  PPP-PVYKYNSPPPP--YKYPSPPP-------PPYKYPSP-------PPPVYKYKSP--- 415
            PPP P +K   PPP    + P PPP       PP   P+P       PPP+Y  K P   
Sbjct: 1045 PPPVPAFKKPYPPPLPIVEKPLPPPIPIHKPIPPISKPAPTPEVLPAPPPIYSPKPPILN 1104

Query: 416  ------------PPPVYKYKSPPP-PAKKPYK--------YPSPPPPVYKYKSPP--PPV 526
                        P P+ K   PPP P +KP          Y  P PP+ K  + P  PP+
Sbjct: 1105 PTPKPKVLPPPQPVPITKKPLPPPVPIQKPVPAAQNPPPVYKKPLPPIPKAPALPKLPPL 1164

Query: 527  YSPPP-----PVYKYKSPPPP 574
               PP     P Y   +  PP
Sbjct: 1165 PKTPPKYFYHPKYGLGNAKPP 1185

 Score =  116 bits (290), Expect = 1e-24
 Identities = 79/167 (47%), Positives = 85/167 (50%), Gaps = 3/167 (1%)
 Frame = +2

Query: 86   PPYKYPSPPPPPYKYPSPPPPVYKYK-SPPPPVYKYKSPP--PPVYKYKSPPPPVYKYKS 256
            P YKYP  P  P+ +P P P  Y    SP P    Y +P   PPV     PPPPVYK + 
Sbjct: 811  PFYKYPPLPTLPH-WPKPLPKFYLPPFSPVPTPITYPAPEADPPVSH--PPPPPVYKQQI 867

Query: 257  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 436
            PP  P  PY  PSPP  VY   SP P Y  P PPP P  +   PPPV  Y  P P     
Sbjct: 868  PPSVP--PYTAPSPPQ-VYDQPSPQPVYYEPHPPPVPIYHKPLPPPVRVYGQPFP----- 919

Query: 437  KSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPV 577
             SP P  KKP      PPPV  YK PP P   PP PV+K KS PPPV
Sbjct: 920  -SPVPVYKKPL-----PPPVPIYKKPPLPSLPPPVPVHK-KSLPPPV 959

 Score =  115 bits (287), Expect = 3e-24
 Identities = 81/217 (37%), Positives = 94/217 (43%), Gaps = 25/217 (11%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYPSPPPPVYKYNSPPPP------------YKYPSPPPP-------PYK 127
            + P PPP   Y  P PP PV     P PP            +K P+ PPP       P  
Sbjct: 972  QEPLPPPSPVYNEPLPPSPVPVLKKPIPPIVEKPLPPPVPIFKKPALPPPVPVYKKPPLP 1031

Query: 128  YPSPPPPVYKYKSPPP-PVYKYKSPPP-PVYKYKSPPP-PVYKYKSPPPPPKKPYKYPS- 295
             P PP PVY    PPP P +K   PPP P+ +   PPP P++K   P PP  KP   P  
Sbjct: 1032 PPPPPVPVYGEPLPPPVPAFKKPYPPPLPIVEKPLPPPIPIHK---PIPPISKPAPTPEV 1088

Query: 296  --PPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPY 469
               PPP+Y   SP PP   P+P P   K   PP PV   K P P       PP P +KP 
Sbjct: 1089 LPAPPPIY---SPKPPILNPTPKP---KVLPPPQPVPITKKPLP-------PPVPIQKPV 1135

Query: 470  KYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
                 PPPVYK   PP P     P +      PP  +
Sbjct: 1136 PAAQNPPPVYKKPLPPIPKAPALPKLPPLPKTPPKYF 1172

 Score =  113 bits (282), Expect = 1e-23
 Identities = 74/168 (44%), Positives = 87/168 (51%), Gaps = 13/168 (7%)
 Frame = +2

Query: 116 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPK--KPYKY 289
           P YK+P  P   +    P    + +  P P +Y      PP+   K PP PPK   P+ +
Sbjct: 210 PYYKHPQLPKVSWPKLPPYSKSHPWYKPMPKIYL-----PPI---KFPPLPPKVYPPFTF 261

Query: 290 PSPPPPVYKYNSPPPPYKYPSPPPPP---YKYPSPPP-PVYKYKSPPPPVYKYKSPPPPA 457
           P  PP V+    PPP   Y  P PPP   YK P PPP PVYK K  PPPV  YK P PP 
Sbjct: 262 PPLPPKVF----PPPVPIYKKPLPPPVPVYKKPLPPPVPVYK-KPLPPPVPVYKKPLPPP 316

Query: 458 KKPYKYPSPPP-PVYKYKSPPP-PVYS----PPPPVYKYKSPPP-PVY 580
              YK P PPP P+YK   PPP P+Y     PP P+YK   PPP P+Y
Sbjct: 317 VPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIY 364

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 56/120 (46%), Positives = 65/120 (54%), Gaps = 4/120 (3%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPP-PVYKYNSPP--PPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           YK P PPP   YK P PPP PVYK   PP  P YK P PP  P   P PP P+YK   PP
Sbjct: 430 YKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPCPPEIPKILP-PPIPIYKKPLPP 488

Query: 173 -PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP 349
             P+YK   P PP+ K   P PP+YK   PP P     K+    PPV+K+  PP  + +P
Sbjct: 489 FVPIYK---PIPPISKPLPPFPPIYKKPWPPIPQVPLPKF----PPVHKF--PPKYFHHP 539

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 58/156 (37%), Positives = 71/156 (45%), Gaps = 4/156 (2%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPP-PVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
            +K P PPP    + P PPP P++K   P PP   P+P P   +    PPP+Y   SP PP
Sbjct: 1051 FKKPYPPPLPIVEKPLPPPIPIHK---PIPPISKPAPTP---EVLPAPPPIY---SPKPP 1101

Query: 179  VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP---KKPYKYPSPPPPVYKYNSPPPPYKYP 349
            +      P P  K   PP PV   K P PPP   +KP      PPPVYK   PP P    
Sbjct: 1102 ILN----PTPKPKVLPPPQPVPITKKPLPPPVPIQKPVPAAQNPPPVYKKPLPPIPKAPA 1157

Query: 350  SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPA 457
             P  PP   P  PP  + +     P Y   +  PP+
Sbjct: 1158 LPKLPP--LPKTPPKYFYH-----PKYGLGNAKPPS 1186

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 51/111 (45%), Positives = 56/111 (50%), Gaps = 2/111 (1%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPP-PVYKYNSPPPPYKYPSPPPPPYKYPSPP-PPVYKYKSPPP 175
           YK P PPP   YK P PPP PVYK   PP   K   PP P YK P PP  P+YK   P P
Sbjct: 441 YKKPLPPPVPVYKKPLPPPVPVYKKPCPPEIPKILPPPIPIYKKPLPPFVPIYK---PIP 497

Query: 176 PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSP 328
           P+ K   P PP+YK   PP P       PP  K P KY   P   + + SP
Sbjct: 498 PISKPLPPFPPIYKKPWPPIPQVPLPKFPPVHKFPPKYFHHPK--FGFGSP 546

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 40/87 (45%), Positives = 45/87 (51%), Gaps = 4/87 (4%)
 Frame = +2

Query: 332  PPYKYPSPPPPPYKYPSPPPPVYKYK-SPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYK 508
            P YKYP  P  P+ +P P P  Y    SP P    Y  P P A  P  +P PPPPVYK +
Sbjct: 811  PFYKYPPLPTLPH-WPKPLPKFYLPPFSPVPTPITY--PAPEADPPVSHP-PPPPVYKQQ 866

Query: 509  SPP--PPVYSP-PPPVYKYKSPPPPVY 580
             PP  PP  +P PP VY   SP P  Y
Sbjct: 867  IPPSVPPYTAPSPPQVYDQPSPQPVYY 893

[70][TOP]
>UniRef100_Q09084 Extensin (Class II) n=1 Tax=Solanum lycopersicum RepID=Q09084_SOLLC
          Length = 322

 Score =  192 bits (487), Expect = 2e-47
 Identities = 102/217 (47%), Positives = 119/217 (54%), Gaps = 28/217 (12%)
 Frame = +2

Query: 14  PPPPKKPYKYPSP---PPPVYK------YNSPPPPYKYPSPPPPPY------KYPSPPPP 148
           PPPP   Y +PSP   PPPVY       Y+ PPP YK  SPPPPP       K PSP PP
Sbjct: 89  PPPPSPVYDHPSPSSPPPPVYYSPPPPVYHEPPPTYKPKSPPPPPTPSYEHPKTPSPLPP 148

Query: 149 VYKYKSPP-PPVYKYK---SPPPPVYKY-KSPPPPVYKYKSP----PPPPKKPYKYPSP- 298
              Y+ P  PP +++    SPP P Y++ K+P PP   Y+ P    PPPP   Y++P P 
Sbjct: 149 TPSYEHPKTPPSHEHPKTPSPPTPSYEHPKTPSPPTPSYEHPKTPSPPPPTPSYEHPQPQ 208

Query: 299 ---PPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPY 469
              PPP   Y  P  P  +P+PP PP   P PPPP   ++  P P Y Y SPPPP+    
Sbjct: 209 SPPPPPTPSYEHPKTP-SHPTPPTPPCNEPPPPPPNSHWEPKPSPPYTYSSPPPPS---- 263

Query: 470 KYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
             PSPPPP Y Y SPPPP  SPPPP Y    PPPP Y
Sbjct: 264 --PSPPPPTYYYSSPPPPSPSPPPPTYSSPPPPPPFY 298

 Score =  183 bits (464), Expect = 1e-44
 Identities = 108/245 (44%), Positives = 127/245 (51%), Gaps = 55/245 (22%)
 Frame = +2

Query: 5   KSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKY-------PSPPPPVYKY- 160
           K  PPPPK     P PPP  YK +   P Y++ SPPPP +K        P PP PVY + 
Sbjct: 46  KRSPPPPKST---PLPPPAPYKKS---PTYQHRSPPPPTHKISPVTHHSPPPPSPVYDHP 99

Query: 161 --KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPS-----PPPPVYKY 319
              SPPPPVY   SPPPPVY     PPP YK KSPPPPP   Y++P      PP P Y++
Sbjct: 100 SPSSPPPPVYY--SPPPPVYH---EPPPTYKPKSPPPPPTPSYEHPKTPSPLPPTPSYEH 154

Query: 320 NSPPPPYKYP---SPPPPPYKYP---SPPPPVYKYK---SPPPPVYKYK-----SPPPPA 457
              PP +++P   SPP P Y++P   SPP P Y++    SPPPP   Y+     SPPPP 
Sbjct: 155 PKTPPSHEHPKTPSPPTPSYEHPKTPSPPTPSYEHPKTPSPPPPTPSYEHPQPQSPPPPP 214

Query: 458 KKPYKYPS-----------------PPP---------PVYKYKSPPPPVYSPPPPVYKYK 559
              Y++P                  PPP         P Y Y SPPPP  SPPPP Y Y 
Sbjct: 215 TPSYEHPKTPSHPTPPTPPCNEPPPPPPNSHWEPKPSPPYTYSSPPPPSPSPPPPTYYYS 274

Query: 560 SPPPP 574
           SPPPP
Sbjct: 275 SPPPP 279

 Score =  169 bits (429), Expect = 1e-40
 Identities = 100/218 (45%), Positives = 109/218 (50%), Gaps = 26/218 (11%)
 Frame = +2

Query: 2   YKSPPP--PPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 175
           Y  PPP   PK P     PPPP   Y  P  P   P PP P Y++P  PP     K+P P
Sbjct: 117 YHEPPPTYKPKSP-----PPPPTPSYEHPKTP--SPLPPTPSYEHPKTPPSHEHPKTPSP 169

Query: 176 PVYKYK-----SPPPPVY---KYKSPPPPVYKY-----KSPPPPPKKPYKYPS----PPP 304
           P   Y+     SPP P Y   K  SPPPP   Y     +SPPPPP   Y++P     P P
Sbjct: 170 PTPSYEHPKTPSPPTPSYEHPKTPSPPPPTPSYEHPQPQSPPPPPTPSYEHPKTPSHPTP 229

Query: 305 PVYKYNSPPPP---YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKY 475
           P    N PPPP     +   P PPY Y SPPPP     SPPPP Y Y SPPPP+      
Sbjct: 230 PTPPCNEPPPPPPNSHWEPKPSPPYTYSSPPPP---SPSPPPPTYYYSSPPPPS------ 280

Query: 476 PSPPPPVYKYKSPPPPVYS--PPPPV--YKYKSPPPPV 577
           PSPPPP Y    PPPP Y   P PPV    Y SPPPPV
Sbjct: 281 PSPPPPTYSSPPPPPPFYENIPLPPVIGVSYASPPPPV 318

 Score =  133 bits (334), Expect = 1e-29
 Identities = 68/141 (48%), Positives = 76/141 (53%), Gaps = 7/141 (4%)
 Frame = +2

Query: 5   KSPPPPPKKP-YKYPSP----PPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP 169
           K+P PPP  P Y++P P    PPP   Y  P  P  +P+PP PP   P PPPP   ++  
Sbjct: 191 KTPSPPPPTPSYEHPQPQSPPPPPTPSYEHPKTP-SHPTPPTPPCNEPPPPPPNSHWEPK 249

Query: 170 PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY--K 343
           P P Y Y SPPPP     SPPPP Y Y SPPPP       PSPPPP Y    PPPP+   
Sbjct: 250 PSPPYTYSSPPPPS---PSPPPPTYYYSSPPPPS------PSPPPPTYSSPPPPPPFYEN 300

Query: 344 YPSPPPPPYKYPSPPPPVYKY 406
            P PP     Y SPPPPV  Y
Sbjct: 301 IPLPPVIGVSYASPPPPVIPY 321

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 44/75 (58%), Positives = 46/75 (61%), Gaps = 2/75 (2%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           Y SPPPP       PSPPPP Y Y+SPPPP   PSPPPP Y  P PPPP Y+   P PPV
Sbjct: 256 YSSPPPPS------PSPPPPTYYYSSPPPPS--PSPPPPTYSSPPPPPPFYE-NIPLPPV 306

Query: 182 Y--KYKSPPPPVYKY 220
               Y SPPPPV  Y
Sbjct: 307 IGVSYASPPPPVIPY 321

[71][TOP]
>UniRef100_P13983 Extensin n=1 Tax=Nicotiana tabacum RepID=EXTN_TOBAC
          Length = 620

 Score =  192 bits (487), Expect = 2e-47
 Identities = 107/209 (51%), Positives = 110/209 (52%), Gaps = 17/209 (8%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYK---YKSPPPP 178
           SPPPP   P     PP P+Y   SPPPP   PSPPP P    SPPPP Y      SPPPP
Sbjct: 283 SPPPPTYSP----PPPSPIY---SPPPPAYSPSPPPTPTPTFSPPPPAYSPPPTYSPPPP 335

Query: 179 VY------KYKSPPPPVYKYKSPP---PPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPP 331
            Y         SPPPPVY    PP   PP   Y  PPPP   P    SPPPP Y+ + PP
Sbjct: 336 TYLPLPSSPIYSPPPPVYSPPPPPSYSPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPP 395

Query: 332 PP-YKYPSPPPPPYKYP----SPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPV 496
           PP Y  P P PP Y  P    SPPPP Y    P PP Y   SPPPPA     Y  PPPP 
Sbjct: 396 PPAYSPPLPAPPTYSPPPPTYSPPPPTYAQPPPLPPTY---SPPPPA-----YSPPPPPT 447

Query: 497 YKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           Y   SPPPP YSPPPP Y    PPPP YS
Sbjct: 448 Y---SPPPPTYSPPPPAYAQPPPPPPTYS 473

 Score =  177 bits (448), Expect = 7e-43
 Identities = 107/205 (52%), Positives = 111/205 (54%), Gaps = 16/205 (7%)
 Frame = +2

Query: 8   SPPPPPKKPYKYP---SPPPPVYKYNSPPPPYKYPSPPPPPYKYP----SPPPPVYKYKS 166
           SPPPP   P       SPPPPVY   SPPPP  Y SPPPP Y  P    SPPPP +   S
Sbjct: 331 SPPPPTYLPLPSSPIYSPPPPVY---SPPPPPSY-SPPPPTYLPPPPPSSPPPPSF---S 383

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYK-----YKSPPP----PPKKPYKYPSPPPPVYKY 319
           PPPP Y+   PPPP Y    P PP Y      Y  PPP    PP  P  Y SPPPP Y  
Sbjct: 384 PPPPTYEQSPPPPPAYSPPLPAPPTYSPPPPTYSPPPPTYAQPPPLPPTY-SPPPPAY-- 440

Query: 320 NSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVY 499
            SPPPP  Y SPPPP Y   SPPPP Y    PPPP Y   SPPPPA  P     PP P+Y
Sbjct: 441 -SPPPPPTY-SPPPPTY---SPPPPAYAQPPPPPPTY---SPPPPAYSP----PPPSPIY 488

Query: 500 KYKSPPPPVYSPPPPVYKYKSPPPP 574
              SPPPP   P PP +   SPPPP
Sbjct: 489 ---SPPPPQVQPLPPTF---SPPPP 507

 Score =  176 bits (446), Expect = 1e-42
 Identities = 100/204 (49%), Positives = 110/204 (53%), Gaps = 13/204 (6%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           Y  PPPP   P    SPPPP Y+ + PPPP Y  P P PP Y   SPPPP Y   SPPPP
Sbjct: 368 YLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPPTY---SPPPPTY---SPPPP 421

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
            Y    P PP Y   SPPPP Y   SPPPPP       SPPPP Y  + PPP Y  P PP
Sbjct: 422 TYAQPPPLPPTY---SPPPPAY---SPPPPPTY-----SPPPPTY--SPPPPAYAQPPPP 468

Query: 359 PPPYKYPSP---PPPVYKYKSPPPPVYK----YKSPPPPAK-----KPYKYPSPPPPVYK 502
           PP Y  P P   PPP     SPPPP  +      SPPPP +      P++ P PP P Y 
Sbjct: 469 PPTYSPPPPAYSPPPPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYG 528

Query: 503 YKSPPPPVYSPPPPVYKYKSPPPP 574
            + P PP +SPPPP  +  SPPPP
Sbjct: 529 -QPPSPPTFSPPPP-RQIHSPPPP 550

 Score =  168 bits (425), Expect = 3e-40
 Identities = 105/243 (43%), Positives = 115/243 (47%), Gaps = 51/243 (20%)
 Frame = +2

Query: 8   SPPPP------PKKPYKYPSPPPPVYKYNSPP----PPYKYPSP----PPPPYKYP---- 133
           SPPPP      P  P +   P PP +++  P     PP   PSP    PP P + P    
Sbjct: 205 SPPPPTHVQPTPSPPSRGHQPQPPTHRHAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPT 264

Query: 134 -SPPPPVYK---------------YKSPPP-PVYKYKSPPPPVYKYKSPPPPVYKYKSPP 262
            SPPPP Y                Y  PPP P+Y   SPPPP Y    PP P   + SPP
Sbjct: 265 YSPPPPAYAQSPQPSPTYSPPPPTYSPPPPSPIY---SPPPPAYSPSPPPTPTPTF-SPP 320

Query: 263 PPPKKPYKYPSPPPPVYK-------YNSPPPPYKYP-----SPPPPPYKYP----SPPPP 394
           PP   P    SPPPP Y        Y+ PPP Y  P     SPPPP Y  P    SPPPP
Sbjct: 321 PPAYSPPPTYSPPPPTYLPLPSSPIYSPPPPVYSPPPPPSYSPPPPTYLPPPPPSSPPPP 380

Query: 395 VYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            +   SPPPP Y+   PPPPA  P   P P PP Y   SPPPP YSPPPP Y    P PP
Sbjct: 381 SF---SPPPPTYEQSPPPPPAYSP---PLPAPPTY---SPPPPTYSPPPPTYAQPPPLPP 431

Query: 575 VYS 583
            YS
Sbjct: 432 TYS 434

 Score =  165 bits (418), Expect = 2e-39
 Identities = 97/225 (43%), Positives = 112/225 (49%), Gaps = 32/225 (14%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYPSPP---PPVYKYNSPPPPYKYPSPPPPPYK-----YPSPPPPVYKY 160
            +SPPPPP      P+PP   PP   Y+ PPP Y  P P PP Y      Y  PPPP Y  
Sbjct: 391  QSPPPPPAYSPPLPAPPTYSPPPPTYSPPPPTYAQPPPLPPTYSPPPPAYSPPPPPTY-- 448

Query: 161  KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSP---PPPPKKPYKYPSP----------P 301
             SPPPP Y   SPPPP Y    PPPP Y    P   PPPP   Y  P P          P
Sbjct: 449  -SPPPPTY---SPPPPAYAQPPPPPPTYSPPPPAYSPPPPSPIYSPPPPQVQPLPPTFSP 504

Query: 302  PPVYKYNSPPPPYKYPSPPPPPY-KYPSPP----PPVYKYKSPPPPVYKYKSPPPPAKKP 466
            PP  + + PPPP++ P PP P Y + PSPP    PP  +  SPPPP ++ ++P P   +P
Sbjct: 505  PPPRRIHLPPPPHRQPRPPTPTYGQPPSPPTFSPPPPRQIHSPPPPHWQPRTPTPTYGQP 564

Query: 467  YKYPSPP----PPVYKYKSPPPPVY--SPPPPVYKYKSPPPPVYS 583
               PSPP    PP  +  SPPPP     PP P Y     PP  YS
Sbjct: 565  ---PSPPTFSAPPPRQIHSPPPPHRQPRPPTPTYGQPPSPPTTYS 606

 Score =  162 bits (411), Expect = 1e-38
 Identities = 99/231 (42%), Positives = 109/231 (47%), Gaps = 40/231 (17%)
 Frame = +2

Query: 11  PPP----PPKKPYKYPSP---PPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP 169
           PPP    PP  P   PSP   PPP Y   SPPPP      P PP +   P PP +++  P
Sbjct: 179 PPPTYAQPPPTPIYSPSPQVQPPPTY---SPPPPTHVQPTPSPPSRGHQPQPPTHRHAPP 235

Query: 170 P----PPVYK-----------YKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPS 295
                PP ++            + P PP Y   SPPPP Y     P P   P  P   P 
Sbjct: 236 THRHAPPTHQPSPLRHLPPSPRRQPQPPTY---SPPPPAYAQSPQPSPTYSPPPPTYSPP 292

Query: 296 PPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYK---YKSPPPPVY------KYKSPP 448
           PP P+Y   SPPPP   PSPPP P    SPPPP Y      SPPPP Y         SPP
Sbjct: 293 PPSPIY---SPPPPAYSPSPPPTPTPTFSPPPPAYSPPPTYSPPPPTYLPLPSSPIYSPP 349

Query: 449 PPAKKPYKYP--SPPPPVY----KYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           PP   P   P  SPPPP Y       SPPPP +SPPPP Y+   PPPP YS
Sbjct: 350 PPVYSPPPPPSYSPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYS 400

 Score =  140 bits (353), Expect = 7e-32
 Identities = 87/199 (43%), Positives = 101/199 (50%), Gaps = 18/199 (9%)
 Frame = +2

Query: 8   SPPPPPKKPYKYP--SPPPPVYKYNSPPPPYKYPSPPPPPYK------YPSPPPPVYKYK 163
           SPPPP   P   P  SPPPP Y  + PPP Y  P PPPP Y        P PP P+Y   
Sbjct: 434 SPPPPAYSPPPPPTYSPPPPTY--SPPPPAYAQPPPPPPTYSPPPPAYSPPPPSPIY--- 488

Query: 164 SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP-----PPKKPYKYPSPPPPVYKYNSP 328
           SPPPP  +   P PP +   SPPPP   +  PPP     PP   Y  P P PP +   SP
Sbjct: 489 SPPPPQVQ---PLPPTF---SPPPPRRIHLPPPPHRQPRPPTPTYGQP-PSPPTF---SP 538

Query: 329 PPPYKYPSPPPPPYKYPSPPPPVYKYKSPP----PPVYKYKSPPPPAKKPYKYPSPPPPV 496
           PPP +  SPPPP ++  +P P   +  SPP    PP  +  SPPP    P++ P PP P 
Sbjct: 539 PPPRQIHSPPPPHWQPRTPTPTYGQPPSPPTFSAPPPRQIHSPPP----PHRQPRPPTPT 594

Query: 497 YKYKSPPPPVYSPP-PPVY 550
           Y     PP  YSPP PP Y
Sbjct: 595 YGQPPSPPTTYSPPSPPPY 613

 Score =  120 bits (302), Expect = 6e-26
 Identities = 68/162 (41%), Positives = 83/162 (51%), Gaps = 22/162 (13%)
 Frame = +2

Query: 2   YKSPPPPPKK-----PYKYPSPPPPVYKYNSPPPPYKYPSPP-------------PPPYK 127
           Y  PPPPP       P   P PP P+Y   SPPPP   P PP             PPP++
Sbjct: 462 YAQPPPPPPTYSPPPPAYSPPPPSPIY---SPPPPQVQPLPPTFSPPPPRRIHLPPPPHR 518

Query: 128 YPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPP-- 301
            P PP P Y  + P PP +   SPPPP  +  SPPPP ++ ++P P   +P   PSPP  
Sbjct: 519 QPRPPTPTYG-QPPSPPTF---SPPPP-RQIHSPPPPHWQPRTPTPTYGQP---PSPPTF 570

Query: 302 --PPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 421
             PP  + +SPPPP++ P PP P Y  P  PP  Y   SPPP
Sbjct: 571 SAPPPRQIHSPPPPHRQPRPPTPTYGQPPSPPTTYSPPSPPP 612

 Score =  110 bits (275), Expect = 8e-23
 Identities = 92/282 (32%), Positives = 106/282 (37%), Gaps = 88/282 (31%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP--PPPPYKYPSP-----------P 142
           Y  PP   + P       PP     +PP     PSP   PP + YP P           P
Sbjct: 33  YLPPPVTSQPPPSSIGLSPPSAPTTTPPSRGHVPSPRHAPPRHAYPPPSHGHLPPSVGGP 92

Query: 143 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSP-------------PPPPKKPY 283
           PP   ++   PP   +  PP PV    S PPP Y    P             PP P   +
Sbjct: 93  PP---HRGHLPPSRGFNPPPSPVIS-PSHPPPSYGAPPPSHGPGHLPSHGQRPPSPSHGH 148

Query: 284 KYPS----PP----PPVYKYNSP------PPPYKYPSPPPPPYKYPSP---PPPVYKYKS 412
             PS    PP    PP ++  SP      PPP  Y  PPP P   PSP   PPP Y   S
Sbjct: 149 APPSGGHTPPRGQHPPSHRRPSPPSRHGHPPPPTYAQPPPTPIYSPSPQVQPPPTY---S 205

Query: 413 PPPPVYKYKSPPPPAK---------------------------------KPYKYP----- 478
           PPPP +   +P PP++                                  P + P     
Sbjct: 206 PPPPTHVQPTPSPPSRGHQPQPPTHRHAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPTY 265

Query: 479 SPPPPVYKYK-------SPPPPVYSPPPPVYKYKSPPPPVYS 583
           SPPPP Y          SPPPP YSPPPP   Y SPPPP YS
Sbjct: 266 SPPPPAYAQSPQPSPTYSPPPPTYSPPPPSPIY-SPPPPAYS 306

[72][TOP]
>UniRef100_Q9SPM1 Extensin-like protein n=1 Tax=Solanum lycopersicum RepID=Q9SPM1_SOLLC
          Length = 711

 Score =  185 bits (470), Expect = 2e-45
 Identities = 116/213 (54%), Positives = 127/213 (59%), Gaps = 21/213 (9%)
 Frame = +2

Query: 8    SPPPPPKKPYKYP--SPPPPVYKYNSPPPPYKYPSPP----PPPYKYP-----SPPPPVY 154
            SPPPP   P   P  SPPPPV+   SPPPP   P PP    PPP   P     SPPPPV+
Sbjct: 465  SPPPPVHSPPPPPVASPPPPVH---SPPPPVASPPPPVHSPPPPVHSPPPPVASPPPPVH 521

Query: 155  KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP-PKKPYKYPSPPPPVYK----Y 319
               SPPPPV+   SPPPPV+   SPPPPV+   SPPPP    P    SPPPPV+      
Sbjct: 522  ---SPPPPVH---SPPPPVH---SPPPPVH---SPPPPVHSPPPPVASPPPPVHSPPPPV 569

Query: 320  NSPPPPYKYPSP----PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP-AKKPYKYPSP 484
            +SPPPP   P P    PPPP   P PPPPV    SPPPPV+   SPPPP A  P    SP
Sbjct: 570  HSPPPPVHSPPPPVASPPPPVHSPPPPPPV---ASPPPPVH---SPPPPVASPPPPVHSP 623

Query: 485  PPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
            PPPV    SPPPPV+SPPPPV+   SPPPPV+S
Sbjct: 624  PPPV---ASPPPPVHSPPPPVH---SPPPPVHS 650

 Score =  184 bits (468), Expect = 3e-45
 Identities = 116/222 (52%), Positives = 126/222 (56%), Gaps = 30/222 (13%)
 Frame = +2

Query: 8    SPPPPPKKPYKYP--SPPPPVYKYNSPPPPYKYPSPP---PPPYKYPSPPPPVYKYKSPP 172
            SPPPP   P   P  SPPPPV+   SPPPP   P PP   PPP    SPPPPV+   SPP
Sbjct: 436  SPPPPVHSPPPPPVASPPPPVH---SPPPPVASPPPPVHSPPPPPVASPPPPVH---SPP 489

Query: 173  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYP-----SPPPPVYK---- 316
            PPV    SPPPPV+   SPPPPV+   SPPPP   P  P   P     SPPPPV+     
Sbjct: 490  PPV---ASPPPPVH---SPPPPVH---SPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPP 540

Query: 317  YNSPPPPYKYPSP----PPPPYKYP-----SPPPPVYK----YKSPPPPVYKYKSPPPPA 457
             +SPPPP   P P    PPPP   P     SPPPPV+       SPPPPV+    PPP A
Sbjct: 541  VHSPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPPPVA 600

Query: 458  KKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
              P    SPPPPV    SPPPPV+SPPPPV    SPPPPV+S
Sbjct: 601  SPPPPVHSPPPPV---ASPPPPVHSPPPPV---ASPPPPVHS 636

 Score =  178 bits (452), Expect = 2e-43
 Identities = 114/213 (53%), Positives = 124/213 (58%), Gaps = 21/213 (9%)
 Frame = +2

Query: 8   SPPPP--PKKPYKYPSPPPPVYKYNSPPPPYKYPSPP---PPPYKYPSPPPPVYKYKSPP 172
           +PP P  P  P   PSPPPP  K   PPPP   P PP   PPP    SPPPPV+   SPP
Sbjct: 406 TPPKPSTPTTPKPNPSPPPP--KTLPPPPPKTSPPPPVHSPPPPPVASPPPPVH---SPP 460

Query: 173 PPVYKYKSPPPPVYK-----YKSPPPPVYKYKSPPPP-PKKPYKYPSPPPPVYKYNSPPP 334
           PPV    SPPPPV+        SPPPPV+   SPPPP    P    SPPPPV+   SPPP
Sbjct: 461 PPV---ASPPPPVHSPPPPPVASPPPPVH---SPPPPVASPPPPVHSPPPPVH---SPPP 511

Query: 335 PYKYPSP----PPPPYKYP-----SPPPPVYKYKSPPPPVYKYKSPPPP-AKKPYKYPSP 484
           P   P P    PPPP   P     SPPPPV+   SPPPPV+   SPPPP A  P    SP
Sbjct: 512 PVASPPPPVHSPPPPVHSPPPPVHSPPPPVH---SPPPPVH---SPPPPVASPPPPVHSP 565

Query: 485 PPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           PPPV+   SPPPPV+SPPPPV    SPPPPV+S
Sbjct: 566 PPPVH---SPPPPVHSPPPPV---ASPPPPVHS 592

 Score =  177 bits (448), Expect = 7e-43
 Identities = 112/202 (55%), Positives = 122/202 (60%), Gaps = 10/202 (4%)
 Frame = +2

Query: 8    SPPPPPKKPYK-YPSPPPPVYKYNSPPPPYKYPSPP--PPPYKYPSPPPPVYKYKSPPPP 178
            SPPPP   P     SPPPPV+   SPPPP   P PP   PP    SPPPPV+   SPPPP
Sbjct: 501  SPPPPVHSPPPPVASPPPPVH---SPPPPVHSPPPPVHSPPPPVHSPPPPVH---SPPPP 554

Query: 179  VYKYKSPPPPVYKYKSPPPPVYKYKSPPPP-PKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
            V    SPPPPV+   SPPPPV+   SPPPP    P    SPPPPV+   SPPPP    SP
Sbjct: 555  V---ASPPPPVH---SPPPPVH---SPPPPVHSPPPPVASPPPPVH---SPPPPPPVASP 602

Query: 356  PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP-AKKPYKYPSPPPPVYKYKSPPPPVYS 532
            PPP +   SPPPPV    SPPPPV+   SPPPP A  P    SPPPPV+   SPPPPV+S
Sbjct: 603  PPPVH---SPPPPV---ASPPPPVH---SPPPPVASPPPPVHSPPPPVH---SPPPPVHS 650

Query: 533  PPPPVYK-----YKSPPPPVYS 583
            PPPPV         SPPPPV+S
Sbjct: 651  PPPPVASPPPALVFSPPPPVHS 672

 Score =  172 bits (437), Expect = 1e-41
 Identities = 106/197 (53%), Positives = 118/197 (59%), Gaps = 6/197 (3%)
 Frame = +2

Query: 8    SPPPPPKKPYK-YPSPPPPVYKYNSPPPPYKYPSPP---PPPYKYPSPPPPVYKYKSPPP 175
            SPPPP   P     SPPPPV+   SPPPP   P PP   PPP  + SPPPPV+   SPPP
Sbjct: 522  SPPPPVHSPPPPVHSPPPPVH---SPPPPVHSPPPPVASPPPPVH-SPPPPVH---SPPP 574

Query: 176  PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
            PV+   SPPPPV    SPPPPV+   SPPPPP       SPPPPV+   SPPPP   P P
Sbjct: 575  PVH---SPPPPV---ASPPPPVH---SPPPPP----PVASPPPPVH---SPPPPVASPPP 618

Query: 356  P--PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY 529
            P   PP    SPPPPV+   SPPPPV+   SPPPP   P    + PPP   + SPPPPV+
Sbjct: 619  PVHSPPPPVASPPPPVH---SPPPPVH---SPPPPVHSPPPPVASPPPALVF-SPPPPVH 671

Query: 530  SPPPPVYKYKSPPPPVY 580
            SPPPP     SPPPP +
Sbjct: 672  SPPPPA-PVMSPPPPTF 687

 Score =  171 bits (434), Expect = 3e-41
 Identities = 110/219 (50%), Positives = 122/219 (55%), Gaps = 28/219 (12%)
 Frame = +2

Query: 8    SPPPPPKKPYK-YPSPPPPVYKYNSPPPPYKYPSPP--PPPYKYPSPPPPVYKYKSPPPP 178
            SPPPP   P     SPPPPV+   SPPPP   P PP   PP    SPPPPV+   SPPPP
Sbjct: 515  SPPPPVHSPPPPVHSPPPPVH---SPPPPVHSPPPPVHSPPPPVASPPPPVH---SPPPP 568

Query: 179  VYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYP 349
            V+   SPPPPV+   SPPPPV    SPPPP   P  P    SPPPPV+   SPPPP   P
Sbjct: 569  VH---SPPPPVH---SPPPPV---ASPPPPVHSPPPPPPVASPPPPVH---SPPPPVASP 616

Query: 350  SPP----PPPYKYP-----SPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYP--SPPPPV 496
             PP    PPP   P     SPPPPV+   SPPPPV+   SPPPP   P      SPPPPV
Sbjct: 617  PPPVHSPPPPVASPPPPVHSPPPPVH---SPPPPVH---SPPPPVASPPPALVFSPPPPV 670

Query: 497  YKYKSPPPPVYSPPPPVYK-----------YKSPPPPVY 580
            +    PP PV SPPPP ++           Y SPPPP++
Sbjct: 671  HS-PPPPAPVMSPPPPTFEDVALPPTLGSLYASPPPPIF 708

 Score =  168 bits (425), Expect = 3e-40
 Identities = 105/205 (51%), Positives = 115/205 (56%), Gaps = 12/205 (5%)
 Frame = +2

Query: 5   KSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPP---PPVYKYKSPPP 175
           +SP  PPK     P P  P     +P PP     PPPPP   P PP   PP     SPPP
Sbjct: 396 QSPKDPPKTVTP-PKPSTPTTPKPNPSPPPPKTLPPPPPKTSPPPPVHSPPPPPVASPPP 454

Query: 176 PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP--KKPYKYPSPPPPVYKYNSPPPPYKYP 349
           PV+   SPPPPV    SPPPPV+   SPPPPP    P    SPPPPV    SPPPP   P
Sbjct: 455 PVH---SPPPPV---ASPPPPVH---SPPPPPVASPPPPVHSPPPPV---ASPPPPVHSP 502

Query: 350 SPP--PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPA-KKPYKYPSPPPPVYK----YK 508
            PP   PP    SPPPPV+   SPPPPV+   SPPPP    P    SPPPPV+       
Sbjct: 503 PPPVHSPPPPVASPPPPVH---SPPPPVH---SPPPPVHSPPPPVHSPPPPVHSPPPPVA 556

Query: 509 SPPPPVYSPPPPVYKYKSPPPPVYS 583
           SPPPPV+SPPPPV+   SPPPPV+S
Sbjct: 557 SPPPPVHSPPPPVH---SPPPPVHS 578

 Score =  137 bits (345), Expect = 6e-31
 Identities = 86/171 (50%), Positives = 97/171 (56%), Gaps = 6/171 (3%)
 Frame = +2

Query: 8   SPPPPPKKPYK-YPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           SPPPP   P     SPPPPV+   SPPPP    SPPPP +   SPPPPV    SPPPPV+
Sbjct: 571 SPPPPVHSPPPPVASPPPPVH---SPPPPPPVASPPPPVH---SPPPPV---ASPPPPVH 621

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP--- 355
              SPPPPV    SPPPPV+   SPPPP        SPPPPV+   SPPPP   P P   
Sbjct: 622 ---SPPPPV---ASPPPPVH---SPPPP------VHSPPPPVH---SPPPPVASPPPALV 663

Query: 356 --PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYK 502
             PPPP   P PP PV    SPPPP ++  + PP       Y SPPPP+++
Sbjct: 664 FSPPPPVHSPPPPAPV---MSPPPPTFEDVALPPTLGS--LYASPPPPIFQ 709

 Score =  122 bits (306), Expect = 2e-26
 Identities = 75/147 (51%), Positives = 89/147 (60%), Gaps = 3/147 (2%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           +  PPPPP       SPPPPV+   SPPPP    SPPPP +   SPPPPV    SPPPPV
Sbjct: 591 HSPPPPPP-----VASPPPPVH---SPPPP--VASPPPPVH---SPPPPV---ASPPPPV 634

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPP--PKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
           +   SPPPPV+   SPPPPV+   SPPPP     P    SPPPPV+   SPPPP    SP
Sbjct: 635 H---SPPPPVH---SPPPPVH---SPPPPVASPPPALVFSPPPPVH---SPPPPAPVMSP 682

Query: 356 PPPPYKYPSPPPPVYK-YKSPPPPVYK 433
           PPP ++  + PP +   Y SPPPP+++
Sbjct: 683 PPPTFEDVALPPTLGSLYASPPPPIFQ 709

[73][TOP]
>UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S9_EHV86
          Length = 621

 Score =  185 bits (469), Expect = 3e-45
 Identities = 104/189 (55%), Positives = 104/189 (55%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   PSPPPP     SPPPP   P PPPP    PSPPPP     SPPPP   
Sbjct: 233 SPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 289

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
             SPPPP     SPPPP     SPPPPP  P   PSPPPP     SPPPP    SPPPP 
Sbjct: 290 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPP--PSPPPPSPPPPSPPPP----SPPPPS 343

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
              PSPPPP     SPPPP     SPPPP   P   PSPPPP     SPPPP  SPPPP 
Sbjct: 344 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPP--PSPPPPSPPPPSPPPP--SPPPPS 399

Query: 548 YKYKSPPPP 574
               SPPPP
Sbjct: 400 PPPPSPPPP 408

 Score =  184 bits (468), Expect = 3e-45
 Identities = 103/190 (54%), Positives = 104/190 (54%), Gaps = 1/190 (0%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           SPPPPP  P   P PPPP     SPPPP   P SPPPP    PSPPPP     SPPPP  
Sbjct: 148 SPPPPPSPP---PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 204

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
              SPPPP     SPPPP     SPPPP   P   PSPPPP     SPPPP   P  PPP
Sbjct: 205 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPP 261

Query: 365 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPP 544
           P   PSPPPP     SPPPP     SPPPP+  P   PSPPPP     SPPPP   PPPP
Sbjct: 262 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPP-SPPPPP 317

Query: 545 VYKYKSPPPP 574
                SPPPP
Sbjct: 318 PSPPPSPPPP 327

 Score =  184 bits (467), Expect = 4e-45
 Identities = 105/194 (54%), Positives = 106/194 (54%), Gaps = 5/194 (2%)
 Frame = +2

Query: 8   SPPPPPKKPYKYP-SPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPV 181
           SPPPPP  P   P SPPPP     SPPPP   P SPPPP    PSPPPP     SPPPP 
Sbjct: 154 SPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 213

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
               SPPPP     SPPPP     SPPPP   P   PSPPPP     SPPPP   PSPPP
Sbjct: 214 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPPPPPSPPP 270

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSP---PPPVYKYKSPPPPVYS 532
           P    PSPPPP     SPPPP     SPPPP+  P   P P   PPP     SPPPP  S
Sbjct: 271 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPP--S 328

Query: 533 PPPPVYKYKSPPPP 574
           PPPP     SPPPP
Sbjct: 329 PPPPSPPPPSPPPP 342

 Score =  184 bits (467), Expect = 4e-45
 Identities = 104/190 (54%), Positives = 105/190 (55%), Gaps = 1/190 (0%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   PSPPPP     SPPPP   P P PPP   PSPPPP     SPPPP   
Sbjct: 292 SPPPPSPPP---PSPPPPSPPPPSPPPPPPSPPPSPPP---PSPPPPSPPPPSPPPPSPP 345

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPP 364
             SPPPP     SPPPP     SPPPPP  P   PSPPPP     SPPPP   P SPPPP
Sbjct: 346 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPP--PSPPPPSPPPPSPPPPSPPPPSPPPP 403

Query: 365 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPP 544
               PSPPPP      PPPP     SPPPP+  P   PSPPPP     SPPPP  SPPPP
Sbjct: 404 SPPPPSPPPP----SPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPP--SPPPP 457

Query: 545 VYKYKSPPPP 574
                SPPPP
Sbjct: 458 SPPPPSPPPP 467

 Score =  183 bits (464), Expect = 1e-44
 Identities = 100/188 (53%), Positives = 102/188 (54%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           P PPP  P   PSPPPP    + PPP    PSPPPP    PSPPPP     SPPPP    
Sbjct: 142 PSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 201

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
            SPPPP     SPPPP     SPPPP   P   PSPPPP     SPPPP   P  PPPP 
Sbjct: 202 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPS 258

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP     SPPPP     SPPPP+  P   PSPPPP     SPPPP  SPPPP  
Sbjct: 259 PPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPP-----SPPPP--SPPPPSP 308

Query: 551 KYKSPPPP 574
              SPPPP
Sbjct: 309 PPPSPPPP 316

 Score =  183 bits (464), Expect = 1e-44
 Identities = 106/191 (55%), Positives = 107/191 (56%), Gaps = 2/191 (1%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPS--PPPPPYKYPSPPPPVYKYKSPPPPV 181
           SPPPP   P   PSPPPP     SPPPP   P   PPPPP   PSPPPP     SPPPP 
Sbjct: 338 SPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPS 394

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
               SPPPP     SPPPP     SPPPPP  P   PSPPPP     SPPPP   PSPPP
Sbjct: 395 PPPPSPPPPSPPPPSPPPP-----SPPPPPSPPP--PSPPPP-----SPPPPSP-PSPPP 441

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPP 541
           P    PSPPPP     SPPPP     SPPPP+  P   PSPPPP     SPPPP  SPPP
Sbjct: 442 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPP--SPPP 496

Query: 542 PVYKYKSPPPP 574
           P     SPPPP
Sbjct: 497 PSPPPPSPPPP 507

 Score =  181 bits (458), Expect = 5e-44
 Identities = 103/192 (53%), Positives = 104/192 (54%), Gaps = 3/192 (1%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           +PPP P      PSPPPP     SPPPP   P SPPPPP   P PPPP     SPPPP  
Sbjct: 115 TPPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSP 174

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY-KYPSPPP 361
              SPPPP     SPPPP     SPPPP   P   PSPPPP     SPPPP    PSPPP
Sbjct: 175 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPP 231

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPY-KYPSPPPPVYKYKSPPPPVYSPP 538
           P    PSPPPP     SPPPP     SPPPP   P    PSPPPP     SPPPP  SPP
Sbjct: 232 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPP--SPP 289

Query: 539 PPVYKYKSPPPP 574
           PP     SPPPP
Sbjct: 290 PPSPPPPSPPPP 301

 Score =  181 bits (458), Expect = 5e-44
 Identities = 101/189 (53%), Positives = 102/189 (53%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   PSPPPP     SPPPP   PSPPPP    PSPPPP     SPPPP   
Sbjct: 138 SPPPPSPPP---PSPPPPP----SPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 190

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
             SPPPP     SPPPP     SPPPP   P   PSPPPP     SPPPP   P  PPPP
Sbjct: 191 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPP 247

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
              P  PPP      PPPP     SPPPP+  P   PSPPPP     SPPPP  SPPPP 
Sbjct: 248 SPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPP--SPPPPS 302

Query: 548 YKYKSPPPP 574
               SPPPP
Sbjct: 303 PPPPSPPPP 311

 Score =  181 bits (458), Expect = 5e-44
 Identities = 105/191 (54%), Positives = 105/191 (54%), Gaps = 2/191 (1%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           SPPPP   P   PSPPPP     SPPPP   P SPPPP    PSPPPP     SPPPP  
Sbjct: 173 SPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 229

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPP-PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
              SPPPP     SPPPP     SPPPP P  P   PSPPPP     SPPP    PSPPP
Sbjct: 230 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPP----PSPPP 285

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPP 541
           P    PSPPPP     SPPPP     SPPPP   P   PSPPPP     SPPPP  SPPP
Sbjct: 286 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSP--PPSPPPPSPPPPSPPPP--SPPP 341

Query: 542 PVYKYKSPPPP 574
           P     SPPPP
Sbjct: 342 PSPPPPSPPPP 352

 Score =  180 bits (457), Expect = 6e-44
 Identities = 105/191 (54%), Positives = 106/191 (55%), Gaps = 2/191 (1%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYP-SPPPPVYKYKSPPPPVY 184
           SPPPP   P   PSPPPP     SPPPP   P PPPPP   P SPPPP     SPPPP  
Sbjct: 128 SPPPPSPPP---PSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 184

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPP 361
              SPPPP     SPPPP     SPPPP   P   PSPPPP     SPPPP   P SPPP
Sbjct: 185 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPP 241

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPP 541
           P    PSPPPP     SPPPP     SPPPP+  P   PSPPPP     SPPPP  SPPP
Sbjct: 242 PSPPPPSPPPPSPPPPSPPPPPPP-PSPPPPSPPP---PSPPPPSPPPPSPPPP--SPPP 295

Query: 542 PVYKYKSPPPP 574
           P     SPPPP
Sbjct: 296 PSPPPPSPPPP 306

 Score =  180 bits (456), Expect = 8e-44
 Identities = 102/190 (53%), Positives = 103/190 (54%), Gaps = 1/190 (0%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           SPPPPP  P   PSPPPP     SPPPP   P SPPPP    PSPPPP     SPPPP  
Sbjct: 312 SPPPPPPSPP--PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP-- 367

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
               PPPP     SPPPP     SPPPP   P   PSPPPP     SPPPP   P P PP
Sbjct: 368 --SPPPPPPSPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPPSPP 422

Query: 365 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPP 544
           P   P P PP     SPPPP     SPPPP+  P   PSPPPP     SPPPP  SPPPP
Sbjct: 423 PPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPP--SPPPP 477

Query: 545 VYKYKSPPPP 574
                SPPPP
Sbjct: 478 SPPPPSPPPP 487

 Score =  179 bits (455), Expect = 1e-43
 Identities = 106/193 (54%), Positives = 107/193 (55%), Gaps = 4/193 (2%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           SPPPP   P   PSPPPP     SPPPP   P SPPPP    PSPPPP     SPPPP  
Sbjct: 178 SPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 234

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYP-SPPPPVYKYNSPPPPYKYP-SPP 358
              SPPPP     SPPPP     SPPPPP  P   P SPPPP     SPPPP   P SPP
Sbjct: 235 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 294

Query: 359 PPPYKYPSPPPPVYKYKSPPPPVYKYK-SPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
           PP    PSPPPP     SPPPP      SPPPP+  P   PSPPPP     SPPPP  SP
Sbjct: 295 PPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPP---PSPPPPSPPPPSPPPP--SP 349

Query: 536 PPPVYKYKSPPPP 574
           PPP     SPPPP
Sbjct: 350 PPPSPPPPSPPPP 362

 Score =  178 bits (452), Expect = 2e-43
 Identities = 99/187 (52%), Positives = 100/187 (53%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 193
           PPPP  P   P PP P      PPPP   PSPPPP    PSPPPP     SPPPP     
Sbjct: 349 PPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 408

Query: 194 SPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYK 373
           SPPPP      PPPP     SPPPP   P   PSPPPP     SPPP    PSPPPP   
Sbjct: 409 SPPPP----SPPPPPSPPPPSPPPPSPPPPSPPSPPPP-----SPPP----PSPPPPSPP 455

Query: 374 YPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYK 553
            PSPPPP     SPPPP     SPPPP+  P   PSPPPP     SPPPP  SPPPP   
Sbjct: 456 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPP--SPPPPSPP 510

Query: 554 YKSPPPP 574
             SPPPP
Sbjct: 511 PPSPPPP 517

 Score =  177 bits (450), Expect = 4e-43
 Identities = 100/189 (52%), Positives = 101/189 (53%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   PSPPPP     SPPPP   P  PPPP   P PPPP     SPPPP   
Sbjct: 223 SPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPP 279

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
             SPPPP     SPPPP     SPPPP   P   PSPPPP     SPPP    PSPPPP 
Sbjct: 280 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPP---PSPPPSPPPPSPPPPS 333

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
              PSPPPP     SPPPP     SPPPP+  P   PSPPPP      PP P  SPPPP 
Sbjct: 334 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPP------PPSPPPSPPPPS 384

Query: 548 YKYKSPPPP 574
               SPPPP
Sbjct: 385 PPPPSPPPP 393

 Score =  177 bits (449), Expect = 5e-43
 Identities = 103/192 (53%), Positives = 104/192 (54%), Gaps = 3/192 (1%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           SPPPP   P   PSPPPP     SPPPP   P SPPPP    PSPPPP     SPPPP  
Sbjct: 208 SPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP-- 262

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPS--PP 358
               PPPP     SPPPP     SPPPP   P   PSPPPP     SPPPP   P   PP
Sbjct: 263 ----PPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPP 315

Query: 359 PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP 538
           PPP   PSPPPP     SPPPP     SPPPP+  P   PSPPPP     SPPPP   PP
Sbjct: 316 PPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPS-PPP 371

Query: 539 PPVYKYKSPPPP 574
           PP     SPPPP
Sbjct: 372 PPPSPPPSPPPP 383

 Score =  174 bits (441), Expect = 5e-42
 Identities = 102/190 (53%), Positives = 103/190 (54%), Gaps = 1/190 (0%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           SPPPP   P   PSPPPP     SPPPP   P SPPPP    PSPPPP     SPPPP  
Sbjct: 198 SPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 254

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
              SPPPP     SPPPP     SPPPP   P   PSPPPP     SPPPP   P  PPP
Sbjct: 255 PPPSPPPPPPP-PSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPP 310

Query: 365 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPP 544
           P   P PP P     SPPPP     SPPPP+  P   PSPPPP     SPPPP  SPPPP
Sbjct: 311 PSPPPPPPSPP---PSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPP--SPPPP 362

Query: 545 VYKYKSPPPP 574
                SPPPP
Sbjct: 363 SPPPPSPPPP 372

 Score =  166 bits (421), Expect = 9e-40
 Identities = 95/181 (52%), Positives = 97/181 (53%), Gaps = 1/181 (0%)
 Frame = +2

Query: 35  YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVY 214
           Y  P+ PPP     SPPP    PSPPPP    PSPPPP     SPPPP      PPPP  
Sbjct: 110 YIPPTTPPP-----SPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSP 164

Query: 215 KYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY-KYPSPPPPPYKYPSPPP 391
              SPPPP     SPPPP   P   PSPPPP     SPPPP    PSPPPP    PSPPP
Sbjct: 165 PPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 221

Query: 392 PVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPP 571
           P     SPPPP     SPPPP+  P   PSPPPP     SPPPP   PPPP     SPPP
Sbjct: 222 PSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPP---PPPPSPPPPSPPP 275

Query: 572 P 574
           P
Sbjct: 276 P 276

 Score =  125 bits (314), Expect = 2e-27
 Identities = 87/176 (49%), Positives = 89/176 (50%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PP PP  P   PSPPPP     SPPP    PSPPP     PSPPPP     SPPPP    
Sbjct: 433 PPSPPSPP--PPSPPPP-----SPPP----PSPPP-----PSPPPP-----SPPPP---- 467

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
            SPPPP     SPPPP     SPPPP   P   PSPPPP     SPPP    PSPPPP  
Sbjct: 468 -SPPPP-----SPPPP-----SPPPPSPPP---PSPPPP-----SPPP----PSPPPP-- 502

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP 538
              SPPPP     SPPPP     SPPPP+  P   PS PP       P  P + PP
Sbjct: 503 ---SPPPP-----SPPPP-----SPPPPSPPPSPPPSHPPSHPPMHPPMHPPFLPP 545

 Score =  112 bits (281), Expect = 2e-23
 Identities = 68/139 (48%), Positives = 71/139 (51%), Gaps = 2/139 (1%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   PSPPPP     SPPPP    SPPPP    PSPPPP     SPPPP   
Sbjct: 425 SPPPPSPPPPSPPSPPPPSPPPPSPPPP----SPPPPSPPPPSPPPPSPPPPSPPPPSPP 480

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPP-PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
             SPPPP     SPPPP     SPPPP P        PPP      SPPPP   PSPPP 
Sbjct: 481 PPSPPPPSPPPPSPPPPSPPPPSPPPPSP--------PPP------SPPPPSPPPSPPPS 526

Query: 365 -PYKYPSPPPPVYKYKSPP 418
            P  +P   PP++    PP
Sbjct: 527 HPPSHPPMHPPMHPPFLPP 545

[74][TOP]
>UniRef100_Q9LJ64 Extensin protein-like n=1 Tax=Arabidopsis thaliana RepID=Q9LJ64_ARATH
          Length = 956

 Score =  185 bits (469), Expect = 3e-45
 Identities = 112/197 (56%), Positives = 123/197 (62%), Gaps = 5/197 (2%)
 Frame = +2

Query: 8    SPPPPP-KKPYKYPSPPPPVYKYNSPPPPYKYPSPPP---PPYKYPSPPPPVYKYKSPPP 175
            SPPPP    P    SPPPPVY   SPPPP   P PPP   PP    SPPPPV+   SPPP
Sbjct: 655  SPPPPVFSPPPPMHSPPPPVY---SPPPPVHSPPPPPVHSPPPPVHSPPPPVH---SPPP 708

Query: 176  PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
            PV+   SPPPPV+   SPPPPV+   SPPPP + P     PPPPV+   SPPPP    SP
Sbjct: 709  PVH---SPPPPVH---SPPPPVH---SPPPPVQSP-----PPPPVF---SPPPPAPIYSP 751

Query: 356  PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPA-KKPYKYPSPPPPVYKYKSPPPPVYS 532
            PPPP    SPPPPV  +  PPPPV+   SPPPP    P    SPPPPV+   SPPPPV+S
Sbjct: 752  PPPPVH--SPPPPV--HSPPPPPVH---SPPPPVHSPPPPVHSPPPPVH---SPPPPVHS 801

Query: 533  PPPPVYKYKSPPPPVYS 583
            PPPP   Y SPPPPV+S
Sbjct: 802  PPPPSPIY-SPPPPVFS 817

 Score =  177 bits (449), Expect = 5e-43
 Identities = 110/208 (52%), Positives = 123/208 (59%), Gaps = 17/208 (8%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPP-PPVYKYNSPPPPYKYPSPPPPPYKYP----SPPPPVYKYKSPPP 175
            PP P  +  K  SP  PPV+   SPPPP    SPPPP +  P    SPPPPVY   SPPP
Sbjct: 626  PPSPSTEETKTTSPQSPPVH---SPPPPPPVHSPPPPVFSPPPPMHSPPPPVY---SPPP 679

Query: 176  PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
            PV+    PPPPV+   SPPPPV+   SPPPP        SPPPPV+   SPPPP   P P
Sbjct: 680  PVHS--PPPPPVH---SPPPPVH---SPPPPVH------SPPPPVH---SPPPPVHSPPP 722

Query: 356  ----PPPPYKYP------SPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYP--SPPPPVY 499
                PPPP + P      SPPPP   Y  PPPPV+   SPPPP   P   P  SPPPPV+
Sbjct: 723  PVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVH---SPPPPVHSPPPPPVHSPPPPVH 779

Query: 500  KYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
               SPPPPV+SPPPPV+   SPPPPV+S
Sbjct: 780  ---SPPPPVHSPPPPVH---SPPPPVHS 801

 Score =  162 bits (411), Expect = 1e-38
 Identities = 105/196 (53%), Positives = 116/196 (59%), Gaps = 4/196 (2%)
 Frame = +2

Query: 8    SPPPPPKKPYKYP--SPPPPVYKYNSPPPPYKYPSPP--PPPYKYPSPPPPVYKYKSPPP 175
            SPPPP   P   P  SPPPPV+   SPPPP   P PP   PP    SPPPPV+   SPPP
Sbjct: 676  SPPPPVHSPPPPPVHSPPPPVH---SPPPPVHSPPPPVHSPPPPVHSPPPPVH---SPPP 729

Query: 176  PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
            PV     PPPPV+   SPPPP   Y SPPPPP       SPPPPV+   SPPPP  + SP
Sbjct: 730  PV--QSPPPPPVF---SPPPPAPIY-SPPPPP-----VHSPPPPVH---SPPPPPVH-SP 774

Query: 356  PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
            PPP +   SPPPPV+   SPPPPV+   SPPPP       P PP P+Y   SPPPPV+SP
Sbjct: 775  PPPVH---SPPPPVH---SPPPPVH---SPPPPVHS----PPPPSPIY---SPPPPVFSP 818

Query: 536  PPPVYKYKSPPPPVYS 583
            PP   K  +P PP  S
Sbjct: 819  PP---KPVTPLPPATS 831

 Score =  155 bits (391), Expect = 3e-36
 Identities = 103/225 (45%), Positives = 113/225 (50%), Gaps = 35/225 (15%)
 Frame = +2

Query: 14   PPPPK----KPYKYPSPPPPVYKYNSPP---------PPYKYPSPPPP----PYKYPSPP 142
            P PPK    KP + P P PP  K   PP         PP + P P  P    P K   P 
Sbjct: 568  PQPPKQETPKPEESPKPQPP--KQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQ 625

Query: 143  PPV-----YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPP 307
            PP       K  SP  P      PPPPV+   SPPPPV+   SPPPP        SPPPP
Sbjct: 626  PPSPSTEETKTTSPQSPPVHSPPPPPPVH---SPPPPVF---SPPPPMH------SPPPP 673

Query: 308  VYKYNSPPPPYKYPSPPP---PPYKYPSPPPPVYK----YKSPPPPVYK----YKSPPPP 454
            VY   SPPPP   P PPP   PP    SPPPPV+       SPPPPV+       SPPPP
Sbjct: 674  VY---SPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 730

Query: 455  AKKPYKYP--SPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
             + P   P  SPPPP   Y  PPPPV+SPPPPV  +  PPPPV+S
Sbjct: 731  VQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPV--HSPPPPPVHS 773

 Score =  137 bits (345), Expect = 6e-31
 Identities = 94/208 (45%), Positives = 105/208 (50%), Gaps = 19/208 (9%)
 Frame = +2

Query: 8    SPPPPPKKPYK-YPSPPPPVYKYNSPPPPYKYPSPP---PPPYKYPSPPPPVYKYKSPPP 175
            SPPPP   P     SPPPPV+   SPPPP   P PP   PPP    SPPPP   Y  PPP
Sbjct: 698  SPPPPVHSPPPPVHSPPPPVH---SPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPP 754

Query: 176  PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP-PKKPYKYPSPPPPVYKYNSPPPPYKYPS 352
            PV+   SPPPPV  +  PPPPV+   SPPPP    P    SPPPPV+   SPPPP   P 
Sbjct: 755  PVH---SPPPPV--HSPPPPPVH---SPPPPVHSPPPPVHSPPPPVH---SPPPPVHSPP 803

Query: 353  PPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYS 532
            PP P Y   SPPPPV+   SPPP   K  +P PPA  P    +P P   +      PV +
Sbjct: 804  PPSPIY---SPPPPVF---SPPP---KPVTPLPPATSPMA-NAPTPSSSESGEISTPVQA 853

Query: 533  PPP--------------PVYKYKSPPPP 574
            P P              PV+K    P P
Sbjct: 854  PTPDSEDIEAPSDSNHSPVFKSSPAPSP 881

 Score =  120 bits (300), Expect = 1e-25
 Identities = 83/210 (39%), Positives = 100/210 (47%), Gaps = 17/210 (8%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP------PYKYPSPPPPVYKYKS 166
            +SP P P KP + P P PP  +    P P + P P PP      P + P P PP  K ++
Sbjct: 521  ESPKPEPPKPEESPKPQPPKQE---TPKPEESPKPQPPKQETPKPEESPKPQPP--KQET 575

Query: 167  PPPPVYKYKSPPPPVYKYKSPPPP-VYKYKSPP---PPPKKPY-------KYPSPPPPVY 313
            P P     +SP P   K + PP     K  SPP   P P  PY       + P PP P  
Sbjct: 576  PKPE----ESPKPQPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQPPSPST 631

Query: 314  KYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPP 493
            +        K  SP  PP   P PPPPV+   SPPPPV+                SPPPP
Sbjct: 632  EET------KTTSPQSPPVHSPPPPPPVH---SPPPPVF----------------SPPPP 666

Query: 494  VYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
            ++   SPPPPVYSPPPPV  +  PPPPV+S
Sbjct: 667  MH---SPPPPVYSPPPPV--HSPPPPPVHS 691

 Score =  116 bits (290), Expect = 1e-24
 Identities = 94/248 (37%), Positives = 112/248 (45%), Gaps = 57/248 (22%)
 Frame = +2

Query: 8    SPPPPPKKPYKYP--SPPPPVYKYNSPPPPYKYPSPP----PPPYKYPSPPPPVYKYKSP 169
            SPPPP + P   P  SPPPP   Y+ PPPP  +  PP    PPP    SPPPPV+   SP
Sbjct: 726  SPPPPVQSPPPPPVFSPPPPAPIYSPPPPPV-HSPPPPVHSPPPPPVHSPPPPVH---SP 781

Query: 170  PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP 349
            PPPV+   SPPPPV+   SPPPPV+     PPPP   Y   SPPPPV+   SPPP    P
Sbjct: 782  PPPVH---SPPPPVH---SPPPPVHS----PPPPSPIY---SPPPPVF---SPPPKPVTP 825

Query: 350  SPP--------PPPYKYPS---------PPPPVYKYKSPP----PPVYKYKSPPPPAKKP 466
             PP        P P    S         P P     ++P      PV+K    P P  +P
Sbjct: 826  LPPATSPMANAPTPSSSESGEISTPVQAPTPDSEDIEAPSDSNHSPVFKSSPAPSPDSEP 885

Query: 467  ---YKYPSPPPPVYKYK-------------SPPPPVYSPP------------PP--VYKY 556
                  PS  P V   K             +P P V +PP            PP   ++Y
Sbjct: 886  EVEAPVPSSEPEVEAPKQSEATPSSSPPSSNPSPDVTAPPSEDNDDGDNFILPPNIGHQY 945

Query: 557  KSPPPPVY 580
             SPPPP++
Sbjct: 946  ASPPPPMF 953

 Score =  108 bits (271), Expect = 2e-22
 Identities = 82/239 (34%), Positives = 97/239 (40%), Gaps = 46/239 (19%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYPS----PPPPVYKYNSPPPPYKYPSPPPPPYKYP---SPPPPVYKYK 163
            + P P P+ P   PS    P P   K  SP      P P  P  + P   +P P   K K
Sbjct: 444  QQPSPKPETPSHEPSNPKEPKPESPKQESPKTEQPKPKPESPKQESPKQEAPKPEQPKPK 503

Query: 164  SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPK----KPYKYPSPPPPVYKYNSP- 328
               P     K  PP   +   P PP  +    P PPK    KP + P P PP  +   P 
Sbjct: 504  PESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPE 563

Query: 329  ----PPPYKYPSPPPPPYKYPSPP----PP---VYKYKSPP------------PPVYKYK 439
                P P K  +P P     P PP    PP     K  SPP             P+ K +
Sbjct: 564  ESPKPQPPKQETPKPEESPKPQPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRR 623

Query: 440  SPPP-----------PAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
              PP           P   P   P PPPPV+   SPPPPV+SPPPP++   SPPPPVYS
Sbjct: 624  PQPPSPSTEETKTTSPQSPPVHSPPPPPPVH---SPPPPVFSPPPPMH---SPPPPVYS 676

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 61/188 (32%), Positives = 74/188 (39%), Gaps = 2/188 (1%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           P P PK P       PP  +  S P P + P P  P  K  +P       K P P   K 
Sbjct: 411 PTPTPKAPEPKKEINPPNLEEPSKPKPEESPKPQQPSPKPETPSHEPSNPKEPKPESPKQ 470

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP-P 367
           +SP     K K   P     K   P P++P   P  P        PP P + P P PP P
Sbjct: 471 ESPKTEQPKPKPESPKQESPKQEAPKPEQPKPKPESPKQESSKQEPPKPEESPKPEPPKP 530

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPP-AKKPYKYPSPPPPVYKYKSPPPPVYSPPPP 544
            + P P PP  K ++P P       PP     KP + P P PP    +  P P  SP P 
Sbjct: 531 EESPKPQPP--KQETPKPEESPKPQPPKQETPKPEESPKPQPP---KQETPKPEESPKPQ 585

Query: 545 VYKYKSPP 568
             K + PP
Sbjct: 586 PPKQEQPP 593

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 47/158 (29%), Positives = 59/158 (37%), Gaps = 5/158 (3%)
 Frame = +2

Query: 113 PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYP 292
           P P   P+P  P  K +  PP + +   P P     +SP P     + P P P+ P   P
Sbjct: 407 PSPKPTPTPKAPEPKKEINPPNLEEPSKPKPE----ESPKP-----QQPSPKPETPSHEP 457

Query: 293 S----PPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK 460
           S    P P   K  SP      P P  P  + P    P  +   P P   K +S      
Sbjct: 458 SNPKEPKPESPKQESPKTEQPKPKPESPKQESPKQEAPKPEQPKPKPESPKQESSKQEPP 517

Query: 461 KPYKYPSP-PPPVYKYKSPPPPVYSPPPPVYKYKSPPP 571
           KP + P P PP   +   P PP    P P    K  PP
Sbjct: 518 KPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPP 555

[75][TOP]
>UniRef100_A3KD22 Leucine-rich repeat/extensin 1 n=1 Tax=Nicotiana tabacum
            RepID=A3KD22_TOBAC
          Length = 723

 Score =  184 bits (467), Expect = 4e-45
 Identities = 110/250 (44%), Positives = 124/250 (49%), Gaps = 60/250 (24%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYPSPPPPVY------KYNSPPPPYKY--------PSPPPPP----YKY 130
            +SPPPP   P   P PPPPVY      ++ SPPPP           P PPPPP    Y +
Sbjct: 436  RSPPPPQSTPPPSPPPPPPVYSSSPSHQHRSPPPPTHKISPVTRHAPPPPPPPSPVYYHH 495

Query: 131  PSPPPP--------VYKYKSPPPP---------VYKYKSPPPPVYKYKSPPPPVYKYKSP 259
            PSPPPP         YK +SPPPP          Y  +SPPPP   +  PPP  Y  +SP
Sbjct: 496  PSPPPPQPVYYAPPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPP--YTPQSP 553

Query: 260  PPPP----KKPYKYPSPPPPVYKYNSPPPP--YKYPSP----PPPPYKY--------PSP 385
            PPPP       Y   SPPPPVY   S PPP  Y++P P    P PP  Y        P+P
Sbjct: 554  PPPPVHYEPPTYTPQSPPPPVYVTPSSPPPPVYEHPKPPTPTPSPPAGYTPPQEPSHPAP 613

Query: 386  PPPVYKYKSPPPPV---YKYKSPPPPAKKP----YKYPSPPPPVYKYKSPPPPVYSPPPP 544
            P P      PPPP    ++ K  PPP   P     + P PPPP Y Y SPPPP  SPPPP
Sbjct: 614  PTPPCNETPPPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPSSSPPPP 673

Query: 545  VYKYKSPPPP 574
             Y Y SPPPP
Sbjct: 674  TYYYSSPPPP 683

 Score =  181 bits (458), Expect = 5e-44
 Identities = 107/234 (45%), Positives = 121/234 (51%), Gaps = 44/234 (18%)
 Frame = +2

Query: 11   PPPPPKKP--YKYPSPPPPVYKYNSPPPPYKYPSPPPPP----YKYPS------PPPPVY 154
            PPPPP  P  Y +PSPPPP   Y +PP  YK  SPPPPP    Y+ P+      PPPP  
Sbjct: 483  PPPPPPSPVYYHHPSPPPPQPVYYAPPT-YKPQSPPPPPPPVHYEPPTYTPQSPPPPPPV 541

Query: 155  KYKSPP--------------PPVYKYKSPPPPVYKY-KSPPPPVYKYKSPPPP------- 268
             Y+ PP              PP Y  +SPPPPVY    SPPPPVY++  PP P       
Sbjct: 542  HYEPPPYTPQSPPPPPVHYEPPTYTPQSPPPPVYVTPSSPPPPVYEHPKPPTPTPSPPAG 601

Query: 269  ---PKKPYKYPSPPPPVYKYNSPPPP---YKYPSPPPPPYKYPSPP----PPVYKYKSPP 418
               P++P  +P+PP P      PPPP   +  P P PPP   PSP     PP      PP
Sbjct: 602  YTPPQEP-SHPAPPTPPCNETPPPPPSTPHWQPKPSPPPTYNPSPSYTQSPP------PP 654

Query: 419  PPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
            PP Y Y SPPPP+       SPPPP Y Y SPPPP  SPPPP     SPPPP Y
Sbjct: 655  PPTYTYSSPPPPSS------SPPPPTYYYSSPPPPPPSPPPPS---PSPPPPSY 699

 Score =  163 bits (413), Expect = 8e-39
 Identities = 99/209 (47%), Positives = 111/209 (53%), Gaps = 18/209 (8%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYP-----SPPPPVYKYN-------SPPPP-YKYPSPPPPP-YKYPSPP 142
            +SPPPPP   Y+ P     SPPPP   Y        SPPPP Y  PS PPPP Y++P PP
Sbjct: 533  QSPPPPPPVHYEPPPYTPQSPPPPPVHYEPPTYTPQSPPPPVYVTPSSPPPPVYEHPKPP 592

Query: 143  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYN 322
             P     +P PP   Y  P  P   + +PP P    ++PPPPP  P+  P P PP   YN
Sbjct: 593  TP-----TPSPPA-GYTPPQEP--SHPAPPTPPCN-ETPPPPPSTPHWQPKPSPPP-TYN 642

Query: 323  SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYK 502
              P   + P PPPP Y Y SPPPP     SPPPP Y Y SPPPP       PSPPPP   
Sbjct: 643  PSPSYTQSPPPPPPTYTYSSPPPP---SSSPPPPTYYYSSPPPPP------PSPPPP--- 690

Query: 503  YKSPPPPVYS--PPPPV--YKYKSPPPPV 577
              SPPPP Y   P PP+    Y SPPPPV
Sbjct: 691  SPSPPPPSYEHVPLPPIVGVSYASPPPPV 719

 Score =  154 bits (389), Expect = 5e-36
 Identities = 92/207 (44%), Positives = 106/207 (51%), Gaps = 15/207 (7%)
 Frame = +2

Query: 5   KSPPPPPKKPYKYPSPPP-PVYKYNSPPPPYKYPS------PPPPPYKYPSPPPPVYKYK 163
           K PP   K P   PSPP  P+    SPPPP    S       PPPP   P P PP     
Sbjct: 396 KRPPVQNKPPAPKPSPPTKPIVPIESPPPPSSKSSGSHFKRSPPPPQSTPPPSPP----- 450

Query: 164 SPPPPVY------KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKP--YKYPSPPPPVYKY 319
            PPPPVY      +++SPPPP +K      PV ++  PPPPP  P  Y +PSPPPP   Y
Sbjct: 451 -PPPPVYSSSPSHQHRSPPPPTHKIS----PVTRHAPPPPPPPSPVYYHHPSPPPPQPVY 505

Query: 320 NSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVY 499
            +PP  YK  SPPPPP       PPV+      PP Y  +SPPPP    Y+     PP Y
Sbjct: 506 YAPPT-YKPQSPPPPP-------PPVHY----EPPTYTPQSPPPPPPVHYE-----PPPY 548

Query: 500 KYKSPPPPVYSPPPPVYKYKSPPPPVY 580
             +SPPPP     PP Y  +SPPPPVY
Sbjct: 549 TPQSPPPPPVHYEPPTYTPQSPPPPVY 575

 Score =  133 bits (335), Expect = 9e-30
 Identities = 74/161 (45%), Positives = 86/161 (53%), Gaps = 10/161 (6%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY------KYPSPPPPPYKYPSPPPPV---Y 154
            Y +P  PP   Y++P PP P     SPP  Y       +P+PP PP     PPPP    +
Sbjct: 575  YVTPSSPPPPVYEHPKPPTPT---PSPPAGYTPPQEPSHPAPPTPPCNETPPPPPSTPHW 631

Query: 155  KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPP 334
            + K  PPP Y   +P P   +   PPPP Y Y SPPPP        SPPPP Y Y+SPPP
Sbjct: 632  QPKPSPPPTY---NPSPSYTQSPPPPPPTYTYSSPPPPSS------SPPPPTYYYSSPPP 682

Query: 335  PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV-YKYKSPPPP 454
            P   PSPPPP    PSPPPP Y++   PP V   Y SPPPP
Sbjct: 683  P--PPSPPPPS---PSPPPPSYEHVPLPPIVGVSYASPPPP 718

 Score =  128 bits (322), Expect = 3e-28
 Identities = 76/169 (44%), Positives = 85/169 (50%), Gaps = 25/169 (14%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYPS-PPPPVYKYNSPPPPY-------------KYPSPPPPPYKYPSPP 142
            +SPPPP    Y  PS PPPPVY++  PP P               +P+PP PP     PP
Sbjct: 568  QSPPPPV---YVTPSSPPPPVYEHPKPPTPTPSPPAGYTPPQEPSHPAPPTPPCNETPPP 624

Query: 143  PPVYKYKSP---PPPVY-------KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYP 292
            PP   +  P   PPP Y       +   PPPP Y Y SPPPP     S PPPP   Y  P
Sbjct: 625  PPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPP----SSSPPPPTYYYSSP 680

Query: 293  SPPPPVYKYNSPPPPYKYPSPPPPPYKY-PSPPPPVYKYKSPPPPVYKY 436
             PPPP     SPPPP   PSPPPP Y++ P PP     Y SPPPPV  Y
Sbjct: 681  PPPPP-----SPPPP--SPSPPPPSYEHVPLPPIVGVSYASPPPPVIPY 722

 Score =  110 bits (274), Expect = 1e-22
 Identities = 71/165 (43%), Positives = 83/165 (50%), Gaps = 27/165 (16%)
 Frame = +2

Query: 161 KSPPPPVYKYKSPP----PPVYKYKSPPPPVYKYKSPPPPPKKP---YKYPSPPPPVYKY 319
           K  P P  K K PP    PP  K   P  P+   +SPPPP  K    +   SPPPP    
Sbjct: 386 KPRPKPTPKPKRPPVQNKPPAPKPSPPTKPIVPIESPPPPSSKSSGSHFKRSPPPP---- 441

Query: 320 NSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK------YKSPPPPAKKP--YKY 475
            S PPP    SPPPPP  Y S P   ++++SPPPP +K      +  PPPP   P  Y +
Sbjct: 442 QSTPPP----SPPPPPPVYSSSPS--HQHRSPPPPTHKISPVTRHAPPPPPPPSPVYYHH 495

Query: 476 PSPP--------PPVYKYKSPPPPVYSPP----PPVYKYKSPPPP 574
           PSPP        PP YK +SPPPP   PP    PP Y  +SPPPP
Sbjct: 496 PSPPPPQPVYYAPPTYKPQSPPPP--PPPVHYEPPTYTPQSPPPP 538

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 46/84 (54%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           Y   PPPP   Y Y SPPPP    + PPP Y Y SPPPPP   PSPPPP     SPPPP 
Sbjct: 647 YTQSPPPPPPTYTYSSPPPP--SSSPPPPTYYYSSPPPPP---PSPPPP---SPSPPPPS 698

Query: 182 YKYKSPPPPV-YKYKSPPPPVYKY 250
           Y++   PP V   Y SPPPPV  Y
Sbjct: 699 YEHVPLPPIVGVSYASPPPPVIPY 722

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 59/142 (41%), Positives = 68/142 (47%), Gaps = 14/142 (9%)
 Frame = +2

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPP-PVYKYNSPPPPYKYPS----- 352
           +S   PV K +  P P  K K PP   K P   PSPP  P+    SPPPP    S     
Sbjct: 378 RSAISPVVKPRPKPTP--KPKRPPVQNKPPAPKPSPPTKPIVPIESPPPPSSKSSGSHFK 435

Query: 353 -PPPPPYKYPSPPPPVYKYKSPPPPVY------KYKSPPPPAKKPYKYPSPPPPVYKYKS 511
             PPPP   P P PP      PPPPVY      +++SPPPP  K         PV ++  
Sbjct: 436 RSPPPPQSTPPPSPP------PPPPVYSSSPSHQHRSPPPPTHKI-------SPVTRHAP 482

Query: 512 PPPPVYSPPPPV-YKYKSPPPP 574
           PPPP   PP PV Y + SPPPP
Sbjct: 483 PPPP---PPSPVYYHHPSPPPP 501

[76][TOP]
>UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis
            thaliana RepID=Q9XIL9_ARATH
          Length = 727

 Score =  184 bits (466), Expect = 6e-45
 Identities = 112/239 (46%), Positives = 129/239 (53%), Gaps = 45/239 (18%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKY--------PSPP--PPVYK----YNSPPPPYKYP------------ 103
            ++  PPPP++P+ +         SPP  PPV+      + P PP + P            
Sbjct: 429  FRRSPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVK 488

Query: 104  ---SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP- 271
               SPPPPP   P PP P+  +  PPPPVY    PPPPVY   SPPPP   Y  PPPPP 
Sbjct: 489  FRRSPPPPPVHSPPPPSPI--HSPPPPPVYS-PPPPPPVY---SPPPPPPVYSPPPPPPV 542

Query: 272  -KKPYKYPSPPPPVYK----YNSPPPPYKYPSPP---PPPYKYPSPPPPVYKYKSPPPPV 427
               P    SPPPPV+      +SPPPP   P PP   PPP  Y  PPPPV+   SPPPPV
Sbjct: 543  HSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVH---SPPPPV 599

Query: 428  YK----YKSPPPPAKKPYKYP---SPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
            +       SPPPP   P   P   SPPPPV+   SPPPPV+SPPPPVY   SPPPPVYS
Sbjct: 600  HSPPPPVHSPPPPVYSPPPPPPVHSPPPPVF---SPPPPVHSPPPPVY---SPPPPVYS 652

 Score =  184 bits (466), Expect = 6e-45
 Identities = 111/215 (51%), Positives = 121/215 (56%), Gaps = 22/215 (10%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYPSP---PPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 175
            +SPPPPP      PSP   PPP   Y+ PPPP  Y  PPPPP   P PPPPV+   SPPP
Sbjct: 491  RSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVH---SPPP 547

Query: 176  PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYK-YPSPPPPVYK-----YNSPPPP 337
            PV+   SPPPPV+   SPPPPV+   SPPPP   P     SPPPPVY       +SPPPP
Sbjct: 548  PVH---SPPPPVH---SPPPPVH---SPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPP 598

Query: 338  YKYPSPP----PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKY 505
               P PP    PPP   P PPPPV+   SPPPPV+   SPPPP        SPPPPVY  
Sbjct: 599  VHSPPPPVHSPPPPVYSPPPPPPVH---SPPPPVF---SPPPPVH------SPPPPVY-- 644

Query: 506  KSPPPPVY---------SPPPPVYKYKSPPPPVYS 583
             SPPPPVY          PPPPVY     PP + S
Sbjct: 645  -SPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSS 678

 Score =  151 bits (381), Expect = 4e-35
 Identities = 98/212 (46%), Positives = 109/212 (51%), Gaps = 28/212 (13%)
 Frame = +2

Query: 32  PYKYPSPPP--PVYKYNSPPPPYKYPSPPPP----PYKYPSPPPPVYKYKSPPPPVYKYK 193
           P K PSP P  PV+K   P PP + P P  P    P K+   PPP      P  P +   
Sbjct: 394 PSKSPSPVPTRPVHK---PQPPKESPQPNDPYNQSPVKFRRSPPP------PQQPHHHVV 444

Query: 194 SPPPPVYKYKSPP--PPVYKYKSP---PPPPKK------PY-------KYPSPPPPVYKY 319
             PPP     SPP  PPV+   SP   P PPK+      PY       +   PPPPV+  
Sbjct: 445 HSPPPA---SSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVH-- 499

Query: 320 NSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVY 499
            SPPPP    SPPPPP   P PPPPVY    PPPPVY    PPP    P    SPPPPV+
Sbjct: 500 -SPPPPSPIHSPPPPPVYSPPPPPPVYS-PPPPPPVYSPPPPPPVHSPPPPVHSPPPPVH 557

Query: 500 KYKSPPPPVYSPPPPVYK----YKSPPPPVYS 583
              SPPPPV+SPPPPV+       SPPPPVYS
Sbjct: 558 ---SPPPPVHSPPPPVHSPPPPVHSPPPPVYS 586

 Score =  137 bits (345), Expect = 6e-31
 Identities = 89/182 (48%), Positives = 101/182 (55%), Gaps = 8/182 (4%)
 Frame = +2

Query: 8    SPPPPPKKPYK--YPSPPPPVYKYNSPPPPYKYPSPP----PPPYKYPSPPPPVYKYKSP 169
            SPPPP   P    Y  PPPPV+   SPPPP   P PP    PPP   P PPPPV+   SP
Sbjct: 572  SPPPPVHSPPPPVYSPPPPPVH---SPPPPVHSPPPPVHSPPPPVYSPPPPPPVH---SP 625

Query: 170  PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP 349
            PPPV+   SPPPPV+   SPPPPVY   SPPPP      Y  PPPPV    SPPPP  Y 
Sbjct: 626  PPPVF---SPPPPVH---SPPPPVY---SPPPPV-----YSPPPPPV---KSPPPPPVY- 667

Query: 350  SPPPPPYKYPSPPPPVYKYKSPPP--PVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPP 523
            SPP  P K  SPP       SPPP  P    ++PPP      ++  PP   ++Y SPPPP
Sbjct: 668  SPPLLPPKMSSPPTQT-PVNSPPPRTPSQTVEAPPPSE----EFIIPPFIGHQYASPPPP 722

Query: 524  VY 529
            ++
Sbjct: 723  MF 724

 Score =  108 bits (270), Expect = 3e-22
 Identities = 62/134 (46%), Positives = 73/134 (54%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           Y  PPPPP       SPPPPV+   SPPPP    SPPPP Y   SPPPPVY   SPPPP 
Sbjct: 614 YSPPPPPP-----VHSPPPPVF---SPPPPVH--SPPPPVY---SPPPPVY---SPPPPP 657

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
            K   PPPPVY      PP+   K   PP + P   P P  P     +PPP  ++  PP 
Sbjct: 658 VK-SPPPPPVYS-----PPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPSEEFIIPPF 711

Query: 362 PPYKYPSPPPPVYK 403
             ++Y SPPPP+++
Sbjct: 712 IGHQYASPPPPMFQ 725

[77][TOP]
>UniRef100_A3KD20 Leucine-rich repeat/extensin n=1 Tax=Nicotiana plumbaginifolia
            RepID=A3KD20_NICPL
          Length = 725

 Score =  183 bits (465), Expect = 7e-45
 Identities = 113/252 (44%), Positives = 132/252 (52%), Gaps = 61/252 (24%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPPPVY------KYNSPPPP-------YKYPSPPPPP-----YK 127
            +K  PPPP+     PSPPPPVY      K+ SPPPP        ++ SPPPPP     Y 
Sbjct: 434  FKRSPPPPQST-PPPSPPPPVYSSSPSHKHRSPPPPTHKISPVTRHASPPPPPPSPVYYH 492

Query: 128  YPS---PPPPVYKYKSPPPPVYKYKSPP---------PPVYKYKSPP--------PPVYK 247
            +PS   PPPPVY      PP YK +SPP         PP Y  +SPP        PP Y 
Sbjct: 493  HPSPSPPPPPVYY----APPTYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYT 548

Query: 248  YKSPPPPPKKPYKYP-----SPPPPVYKYNSPPPP----YKYPSPPPP----PYKYPS-- 382
             +SPPPPP   Y+ P     SPPPPVY   S PPP    Y++P+P PP    P + PS  
Sbjct: 549  PQSPPPPPPVHYEPPTYTPHSPPPPVYVTPSSPPPPTPVYEHPTPSPPAGYTPPQEPSHP 608

Query: 383  --PPPPVYKYKSPPP--PVYKYKSPPPPAKKP----YKYPSPPPPVYKYKSPPPPVYSPP 538
              P PP  +  +PPP  P ++ K  PPP   P     + P PPPP Y Y SPPPP  SPP
Sbjct: 609  APPTPPCNEPPTPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPSPSPP 668

Query: 539  PPVYKYKSPPPP 574
            PP Y Y SPPPP
Sbjct: 669  PPTYYYSSPPPP 680

 Score =  177 bits (450), Expect = 4e-43
 Identities = 109/239 (45%), Positives = 120/239 (50%), Gaps = 46/239 (19%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKY----PSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPP----PPVYK 157
            + SPPPPP  P  Y    PSPPPP   Y   PP YK  SPPPPP     PP    PP Y 
Sbjct: 478  HASPPPPPPSPVYYHHPSPSPPPPPVYY--APPTYKPQSPPPPP-----PPVHYEPPTYT 530

Query: 158  YKSPPPP--------VYKYKSPPPP--------VYKYKSPPPPVYKYKSPPPPPKKPYKY 289
             +SPPPP         Y  +SPPPP         Y   SPPPPVY   S PPPP   Y++
Sbjct: 531  PQSPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPHSPPPPVYVTPSSPPPPTPVYEH 590

Query: 290  PSPPPPVY-------KYNSPP-PPYKYPSPPPP--PYKYPSP-PPPVY-------KYKSP 415
            P+P PP          + +PP PP   P  PPP  P+  P P PPP Y       +   P
Sbjct: 591  PTPSPPAGYTPPQEPSHPAPPTPPCNEPPTPPPSTPHWQPKPSPPPTYNPSPSYTQSPPP 650

Query: 416  PPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYK----YKSPPPPVY 580
            PPP Y Y SPPPP+      PSPPPP Y Y SPPPP  SPPPP         SPPPP Y
Sbjct: 651  PPPTYTYSSPPPPS------PSPPPPTYYYSSPPPP--SPPPPSPSPPPPSPSPPPPSY 701

 Score =  149 bits (376), Expect = 2e-34
 Identities = 89/193 (46%), Positives = 104/193 (53%), Gaps = 26/193 (13%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYP-----SPPPPVYKYNSPPPP----YKYPSPPPPPY-------KYPS 136
            +SPPPPP   Y+ P     SPPPPVY   S PPP    Y++P+P PP          +P+
Sbjct: 550  QSPPPPPPVHYEPPTYTPHSPPPPVYVTPSSPPPPTPVYEHPTPSPPAGYTPPQEPSHPA 609

Query: 137  PP-PPVYKYKSPPP--PVYKYKSPPPPVY-------KYKSPPPPVYKYKSPPPPPKKPYK 286
            PP PP  +  +PPP  P ++ K  PPP Y       +   PPPP Y Y SPPPP      
Sbjct: 610  PPTPPCNEPPTPPPSTPHWQPKPSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPS----- 664

Query: 287  YPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP 466
             PSPPPP Y Y+SPPP    PSPPPP    PSPPPP     SPPPP Y++   PP     
Sbjct: 665  -PSPPPPTYYYSSPPP----PSPPPPS---PSPPPP---SPSPPPPSYEHVPLPPVV--G 711

Query: 467  YKYPSPPPPVYKY 505
              Y SPPPPV  Y
Sbjct: 712  VSYASPPPPVIPY 724

 Score =  105 bits (263), Expect = 2e-21
 Identities = 68/154 (44%), Positives = 75/154 (48%), Gaps = 36/154 (23%)
 Frame = +2

Query: 221 KSPPPPVYKYKSPPPPPKKPYKYPSPPP-PVYKYNSPPPP--------YKYPSPPPPPYK 373
           K  P P  K K PP   K P   PS P  PV    SPPPP        +K   PPP    
Sbjct: 386 KPRPKPTPKPKRPPVQNKPPAPKPSTPSRPVAPIESPPPPSSKSSGSHFKRSPPPPQSTP 445

Query: 374 YPSPPPPVY------KYKSPPPPVYK------YKSPPPPAKKPYKY----PSPP------ 487
            PSPPPPVY      K++SPPPP +K      + SPPPP   P  Y    PSPP      
Sbjct: 446 PPSPPPPVYSSSPSHKHRSPPPPTHKISPVTRHASPPPPPPSPVYYHHPSPSPPPPPVYY 505

Query: 488 -PPVYKYKSPPPPVYSPP----PPVYKYKSPPPP 574
            PP YK +SPPPP   PP    PP Y  +SPPPP
Sbjct: 506 APPTYKPQSPPPP--PPPVHYEPPTYTPQSPPPP 537

 Score = 84.0 bits (206), Expect = 8e-15
 Identities = 45/85 (52%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSP-PPPVYKYKSPPPP 178
           Y   PPPP   Y Y SPPPP    + PPP Y Y SPPPP    PSP PPP     SPPPP
Sbjct: 644 YTQSPPPPPPTYTYSSPPPP--SPSPPPPTYYYSSPPPPSPPPPSPSPPPPSP--SPPPP 699

Query: 179 VYKYKSPPPPV-YKYKSPPPPVYKY 250
            Y++   PP V   Y SPPPPV  Y
Sbjct: 700 SYEHVPLPPVVGVSYASPPPPVIPY 724

 Score = 67.4 bits (163), Expect = 8e-10
 Identities = 37/88 (42%), Positives = 46/88 (52%), Gaps = 4/88 (4%)
 Frame = +2

Query: 329 PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP----YKYPSPPPPV 496
           P P   P  PP   K P+P P      +P  PV   +SPPPP+ K     +K   PPP  
Sbjct: 389 PKPTPKPKRPPVQNKPPAPKP-----STPSRPVAPIESPPPPSSKSSGSHFKRSPPPPQS 443

Query: 497 YKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
               SPPPPVYS  P  +K++SPPPP +
Sbjct: 444 TPPPSPPPPVYSSSPS-HKHRSPPPPTH 470

[78][TOP]
>UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK5_CHLRE
          Length = 853

 Score =  183 bits (464), Expect = 1e-44
 Identities = 101/189 (53%), Positives = 102/189 (53%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   PSPPPP     SPPPP   PSPPPP    PSPPPP      PPPP   
Sbjct: 231 SPPPPSPPPPPPPSPPPPSPPPPSPPPPPP-PSPPPPSPPPPSPPPPPPPSPPPPPP--- 286

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
             SPPPP     SPPPP     SPPPPP      PSPPPP     SPPPP     PPPPP
Sbjct: 287 -PSPPPP--PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 343

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
              P PPPP     SPPPP     SPPPP+  P   PSPPPP      PPPP  SPPPP 
Sbjct: 344 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP-SPPPPS 402

Query: 548 YKYKSPPPP 574
               SPPPP
Sbjct: 403 PPPPSPPPP 411

 Score =  182 bits (463), Expect = 1e-44
 Identities = 102/193 (52%), Positives = 103/193 (53%), Gaps = 4/193 (2%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP----SPPPPPYKYPSPPPPVYKYKSPPP 175
           SPPPPP      PSPPPP     SPPPP   P    SPPPPP   P PPPP     SPPP
Sbjct: 345 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP----PSPPP 400

Query: 176 PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
           P     SPPPP     SPPPP     SPPPPP  P   P PPPP     SPPPP     P
Sbjct: 401 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP--PPSPPPPPPP-----SPPPPPPPSPP 453

Query: 356 PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
           PPPP   P PPPP     SPPPP     SPPPP+  P   PSPPPP      PPPP  SP
Sbjct: 454 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP-SP 512

Query: 536 PPPVYKYKSPPPP 574
           PPP     SPPPP
Sbjct: 513 PPPSPPPPSPPPP 525

 Score =  181 bits (459), Expect = 4e-44
 Identities = 103/190 (54%), Positives = 104/190 (54%), Gaps = 1/190 (0%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   PSPPPP     SPPPP   PSPPPPP   P PPPP     SPPPP   
Sbjct: 249 SPPPPSPPPPPPPSPPPPSPPPPSPPPPPP-PSPPPPPPPSPPPPPP----PSPPPPSPP 303

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
             SPPPP     SPPPP     SPPPP   P   PSPPPP      PPPP   PSPPPP 
Sbjct: 304 PPSPPPP--PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP---PSPPPPS 358

Query: 368 YKYPSPPPPVYKYKS-PPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPP 544
              PSPPPP     S PPPP      PPPP+  P   PSPPPP     SPPPP  SPPPP
Sbjct: 359 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP--SPPPP 416

Query: 545 VYKYKSPPPP 574
                SPPPP
Sbjct: 417 SPPPPSPPPP 426

 Score =  180 bits (456), Expect = 8e-44
 Identities = 98/199 (49%), Positives = 99/199 (49%), Gaps = 10/199 (5%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   PSPPPP      PPPP   P P PPP   P PPPP     SPPPP   
Sbjct: 267 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 326

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP-- 361
             SPPPP      PPPP     SPPPPP      PSPPPP     SPPPP   P PPP  
Sbjct: 327 PPSPPPPPPPSPPPPPP----PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 382

Query: 362 --------PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPP 517
                   PP   PSPPPP     SPPPP     SPPPP+  P   P PPPP      PP
Sbjct: 383 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP----SPPP 438

Query: 518 PPVYSPPPPVYKYKSPPPP 574
           PP  SPPPP      PPPP
Sbjct: 439 PPPPSPPPPPPPSPPPPPP 457

 Score =  179 bits (455), Expect = 1e-43
 Identities = 101/189 (53%), Positives = 102/189 (53%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPPP      PSPPPP     SPPPP   PSPPPPP   P PPPP     SPPPP   
Sbjct: 306 SPPPPPPPSPPPPSPPPPSPPPPSPPPPPP-PSPPPPPPPSPPPPPP----PSPPPP--- 357

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
             SPPPP     SPPPP     SPPPP   P   PSPPPP      PPPP   PSPPPP 
Sbjct: 358 --SPPPP-----SPPPP-----SPPPPSPPPPPPPSPPPPPPPSPPPPPP---PSPPPPS 402

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
              PSPPPP     SPPPP     SPPPP+  P   PSPPPP      PPPP   PPPP 
Sbjct: 403 PPPPSPPPPSPPPPSPPPP-----SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 457

Query: 548 YKYKSPPPP 574
                PPPP
Sbjct: 458 PSPPPPPPP 466

 Score =  178 bits (452), Expect = 2e-43
 Identities = 103/191 (53%), Positives = 104/191 (54%), Gaps = 2/191 (1%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   P PPPP     SPPPP   PSPPPPP   PSPPPP     SPPPP   
Sbjct: 363 SPPPPSPPPPSPPPPPPP-----SPPPPPP-PSPPPPP--PPSPPPPSPPPPSPPPPSPP 414

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPK-KPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
             SPPPP     SPPPP      PPPPP   P   PSPPPP      PPPP   PSPPPP
Sbjct: 415 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP---PSPPPP 471

Query: 365 PYKYPSPPPPVYKYKS-PPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPP 541
               PSPPPP     S PPPP      PPPP+  P   PSPPPP     SPPPP  SPPP
Sbjct: 472 SPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP--SPPP 529

Query: 542 PVYKYKSPPPP 574
           P     SPPPP
Sbjct: 530 PSPPPPSPPPP 540

 Score =  176 bits (445), Expect = 2e-42
 Identities = 101/193 (52%), Positives = 102/193 (52%), Gaps = 5/193 (2%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           PPPP   P   PSPPPP     SPPPP   P SPPPP    PSPPPP      PPPP   
Sbjct: 385 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP--- 441

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP----SP 355
             SPPPP      PPPP     SPPPPP      PSPPPP     SPPPP   P    SP
Sbjct: 442 -PSPPPPPPPSPPPPPP----PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 496

Query: 356 PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
           PPPP   P PPPP     SPPPP     SPPPP+  P   PSPPPP      PPPP  SP
Sbjct: 497 PPPPPPSPPPPPP----PSPPPPSPPPPSPPPPSPPP---PSPPPP----SPPPPPPPSP 545

Query: 536 PPPVYKYKSPPPP 574
           PPP     SPPPP
Sbjct: 546 PPPSPPPPSPPPP 558

 Score =  175 bits (443), Expect = 3e-42
 Identities = 102/195 (52%), Positives = 103/195 (52%), Gaps = 6/195 (3%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   P PPPP     SPPPP   PSPPPPP   PSPPPP     SPPPP   
Sbjct: 319 SPPPPSPPPPSPPPPPPP-----SPPPPPP-PSPPPPP--PPSPPPPSPPPPSPPPPSPP 370

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY------KYP 349
             SPPPP      PPPP     SPPPPP      PSPPPP     SPPPP         P
Sbjct: 371 PPSPPPPPPPSPPPPPP----PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 426

Query: 350 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY 529
           SPPPPP   P PPPP      PPPP      PPPP+  P   PSPPPP     SPPPP  
Sbjct: 427 SPPPPPPPSPPPPPPP---SPPPPPPPSPPPPPPPSPPPPPPPSPPPP-----SPPPP-- 476

Query: 530 SPPPPVYKYKSPPPP 574
           SPPPP     SPPPP
Sbjct: 477 SPPPPSPPPPSPPPP 491

 Score =  174 bits (442), Expect = 3e-42
 Identities = 101/190 (53%), Positives = 102/190 (53%), Gaps = 1/190 (0%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           SPPPP   P   PSPPPP     SPPPP   P SPPPP    PSPPPP     SPPPP  
Sbjct: 196 SPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP--PPPSPPPPSP 250

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
              SPPPP     SPPPP     SPPPP   P   PSPPPP      PPPP   P P PP
Sbjct: 251 PPPSPPPP--PPPSPPPP-----SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 303

Query: 365 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPP 544
           P   P PPPP     SPPPP     SPPPP+  P   PSPPPP      PPPP  SPPPP
Sbjct: 304 PPSPPPPPPPSPPPPSPPPP-----SPPPPSPPPPPPPSPPPPPPPSPPPPPPP-SPPPP 357

Query: 545 VYKYKSPPPP 574
                SPPPP
Sbjct: 358 SPPPPSPPPP 367

 Score =  174 bits (442), Expect = 3e-42
 Identities = 104/191 (54%), Positives = 105/191 (54%), Gaps = 2/191 (1%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           SPPPP   P   PSPPPP     SPPPP   P SPPPPP   PSPPPP     SPPPP  
Sbjct: 206 SPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPPP--PSPPPPSPPPPSPPPP-- 258

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYP-SPPPPVYKYNSPPPPYKYPSPPP 361
              SPPPP     SPPPP      PPPPP  P   P SPPPP     SPPPP   PSPPP
Sbjct: 259 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP-PSPPP 317

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPP 541
           P    PSPPPP      PPPP      PPPP+  P   PSPPPP     SPPPP  SPPP
Sbjct: 318 PSPPPPSPPPP----SPPPPPPPSPPPPPPPSPPPPPPPSPPPP-----SPPPP--SPPP 366

Query: 542 PVYKYKSPPPP 574
           P     SPPPP
Sbjct: 367 PSPPPPSPPPP 377

 Score =  174 bits (441), Expect = 5e-42
 Identities = 101/193 (52%), Positives = 101/193 (52%), Gaps = 4/193 (2%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   PSPPPP      PPPP   PSPPPP    PSPPPP     SPPPP   
Sbjct: 324 SPPPPSPPPPPPPSPPPPPPPSPPPPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPPPP 380

Query: 188 YKSPPPPVYKYK----SPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
              PPPP         SPPPP     SPPPP   P   PSPPPP     SPPPP   PSP
Sbjct: 381 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPPP-PSP 436

Query: 356 PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
           PPPP   P PPPP     SPPPP      PPPP   P   PSPPPP     SPPPP   P
Sbjct: 437 PPPPPPSPPPPPP----PSPPPPPPPSPPPPPPPSPPP--PSPPPPSPPPPSPPPPSPPP 490

Query: 536 PPPVYKYKSPPPP 574
           PPP     SPPPP
Sbjct: 491 PPP----PSPPPP 499

 Score =  173 bits (439), Expect = 8e-42
 Identities = 103/189 (54%), Positives = 104/189 (55%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   PSPPPP     SPPPP    SPPPP    PSPPPP     SPPPP   
Sbjct: 191 SPPPPSPPP---PSPPPP-----SPPPP----SPPPPSPPPPSPPPPSPPPPSPPPP--- 235

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
             SPPPP     SPPPP     SPPPPP      PSPPPP     SPPPP   PSPPPPP
Sbjct: 236 --SPPPP--PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP-----SPPPPPP-PSPPPPP 285

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
              P PPPP     SPPPP     SPPPP+  P   PSPPPP     SPPPP   PPPP 
Sbjct: 286 PPSPPPPPP----PSPPPP-----SPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPP- 335

Query: 548 YKYKSPPPP 574
               SPPPP
Sbjct: 336 ---PSPPPP 341

 Score =  160 bits (404), Expect = 9e-38
 Identities = 99/188 (52%), Positives = 99/188 (52%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           P PPP      PSPPPP     SPPPP    SPPPP    PSPPPP     SPPPP    
Sbjct: 190 PSPPP------PSPPPP-----SPPPP----SPPPPSPPPPSPPPP-----SPPPP---- 225

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
            SPPPP     SPPPP     SPPPPP      PSPPPP     SPPPP   PSPPPP  
Sbjct: 226 -SPPPP-----SPPPP-----SPPPPPP-----PSPPPPSPPPPSPPPP-PPPSPPPPSP 268

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             PSPPPP      PPPP     SPPPP       PSPPPP      PPPP  SPPPP  
Sbjct: 269 PPPSPPPPPPPSPPPPPP----PSPPPPPPPSPPPPSPPPP----SPPPPPPPSPPPPSP 320

Query: 551 KYKSPPPP 574
              SPPPP
Sbjct: 321 PPPSPPPP 328

 Score =  159 bits (401), Expect = 2e-37
 Identities = 95/179 (53%), Positives = 96/179 (53%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   PSPPPP      PPPP   PSPPPPP   P PPPP     SPPPP   
Sbjct: 422 SPPPPSPPPPPPPSPPPPPPPSPPPPPP---PSPPPPPPPSPPPPPP----PSPPPPSPP 474

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
             SPPPP     SPPPP      PPPPP      P PPPP     SPPP    PSPPP  
Sbjct: 475 PPSPPPPSPPPPSPPPPPPPSPPPPPPPS-----PPPPPP----PSPPP----PSPPP-- 519

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPP 544
              PSPPPP     SPPPP     SPPPP+  P   PSPPPP     SPPPP  SPPPP
Sbjct: 520 ---PSPPPP-----SPPPP-----SPPPPSPPPPPPPSPPPP-----SPPPP--SPPPP 558

[79][TOP]
>UniRef100_B9RZI2 Protein binding protein, putative n=1 Tax=Ricinus communis
            RepID=B9RZI2_RICCO
          Length = 829

 Score =  182 bits (462), Expect = 2e-44
 Identities = 110/198 (55%), Positives = 121/198 (61%), Gaps = 6/198 (3%)
 Frame = +2

Query: 8    SPP---PPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
            SPP   PPP  P + PSPP       SPPPP +  SPPPP     SPPPPVY   SPPPP
Sbjct: 627  SPPGQSPPPTTPEQSPSPPG-----QSPPPPTQ--SPPPP---VNSPPPPVY---SPPPP 673

Query: 179  VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
                 SPPPPV+   SPPPPVY     PPPP  P    SPPPPV+   SPPPP   P PP
Sbjct: 674  -----SPPPPVH---SPPPPVYS----PPPPSPPPPVHSPPPPVH---SPPPPVHSPPPP 718

Query: 359  ---PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY 529
               PPP   PSPPPP++   SPPPPVY   SPPPP  +     SPPPPV+   SPPPPV+
Sbjct: 719  VYSPPPPSPPSPPPPMH---SPPPPVY---SPPPPPVR-----SPPPPVH---SPPPPVH 764

Query: 530  SPPPPVYKYKSPPPPVYS 583
            SPPPP+Y   SPPPP +S
Sbjct: 765  SPPPPIY---SPPPPRFS 779

 Score =  176 bits (447), Expect = 9e-43
 Identities = 102/201 (50%), Positives = 118/201 (58%), Gaps = 9/201 (4%)
 Frame = +2

Query: 5    KSPPPPPKKPYK-YPSPPPPVYKYNSPPPPYKYPSPPPPPYKYP--SPPPPVYKYKSPPP 175
            +SPPPP + P     SPPPPVY    P PP    SPPPP Y  P  SPPPPV+   SPPP
Sbjct: 647  QSPPPPTQSPPPPVNSPPPPVYSPPPPSPPPPVHSPPPPVYSPPPPSPPPPVH---SPPP 703

Query: 176  PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYP---SPPPPVYKYNSPPPPYKY 346
            PV+   SPPPPV+   SPPPPVY     PPPP  P   P   SPPPPV  Y+ PPPP + 
Sbjct: 704  PVH---SPPPPVH---SPPPPVYS----PPPPSPPSPPPPMHSPPPPV--YSPPPPPVRS 751

Query: 347  PSPP--PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP 520
            P PP   PP    SPPPP+Y   SPPPP +   SPPPP   P    S PPP     +PPP
Sbjct: 752  PPPPVHSPPPPVHSPPPPIY---SPPPPRF---SPPPPRFSPPPPTSSPPPTPTVAAPPP 805

Query: 521  PVYSPPPPV-YKYKSPPPPVY 580
              +  PP + ++Y SPPPP++
Sbjct: 806  EDFILPPNIGFQYSSPPPPMF 826

 Score =  146 bits (369), Expect = 1e-33
 Identities = 92/192 (47%), Positives = 104/192 (54%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
            SP P P +P    + P P Y  + P P     S P  P   PSP  P+    SP  P  +
Sbjct: 567  SPSPEPSEPTSPTTSPSPEYNSSEPSPTPSPESEPQSPTSTPSPESPL---SSPTSPTLE 623

Query: 188  YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
             +SP PP    +SPPP   +    PP    P    SPPPPV   NSPPPP    SPPPP 
Sbjct: 624  -QSPSPPG---QSPPPTTPEQSPSPPGQSPPPPTQSPPPPV---NSPPPPVY--SPPPP- 673

Query: 368  YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
                SPPPPV+   SPPPPVY   SPPPP        SPPPPV+   SPPPPV+SPPPPV
Sbjct: 674  ----SPPPPVH---SPPPPVY---SPPPP--------SPPPPVH---SPPPPVHSPPPPV 712

Query: 548  YKYKSPPPPVYS 583
            +   SPPPPVYS
Sbjct: 713  H---SPPPPVYS 721

 Score =  129 bits (324), Expect = 2e-28
 Identities = 85/188 (45%), Positives = 97/188 (51%), Gaps = 12/188 (6%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYP------------SPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPP 145
            Y  PPP P  P   P            SPPPPVY   SPPPP   PSPPPP +   SPPP
Sbjct: 687  YSPPPPSPPPPVHSPPPPVHSPPPPVHSPPPPVY---SPPPP-SPPSPPPPMH---SPPP 739

Query: 146  PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS 325
            PV  Y  PPPPV   +SPPPPV+   SPPPPV+                SPPPP+Y   S
Sbjct: 740  PV--YSPPPPPV---RSPPPPVH---SPPPPVH----------------SPPPPIY---S 772

Query: 326  PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKY 505
            PPPP    SPPPP +   SPPPP     S PPP     +PPP       +  PP   ++Y
Sbjct: 773  PPPPRF--SPPPPRF---SPPPPT----SSPPPTPTVAAPPPE-----DFILPPNIGFQY 818

Query: 506  KSPPPPVY 529
             SPPPP++
Sbjct: 819  SSPPPPMF 826

 Score =  117 bits (294), Expect = 5e-25
 Identities = 87/228 (38%), Positives = 99/228 (43%), Gaps = 36/228 (15%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSP--------PP 145
            +P P P KP    + P P  + + P PP   PSP      P  P   PSP        PP
Sbjct: 487  TPSPEPSKPTSPTTSPSPSPEPSEPTPPATSPSPSSEPSEPTSPTTSPSPSSEPLESTPP 546

Query: 146  PVYKYKSPPP--PVYKYKSPPP------PVYKYKSPPPPVYKYKSPPPP-----PKKPYK 286
                  SP P  P     SP P      P     SP P     +  P P     P+ P  
Sbjct: 547  TTSPSLSPEPSEPTSPTTSPSPSPEPSEPTSPTTSPSPEYNSSEPSPTPSPESEPQSPTS 606

Query: 287  YPSPPPPVYKYNSP-----PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 451
             PSP  P+    SP     P P     PP  P + PSPP      +SPPPP    +SPPP
Sbjct: 607  TPSPESPLSSPTSPTLEQSPSPPGQSPPPTTPEQSPSPPG-----QSPPPPT---QSPPP 658

Query: 452  PAKKPYKYPSPPPPVYKYK--SPPPPVYSPPPPVYK--YKSPPPPVYS 583
            P        SPPPPVY     SPPPPV+SPPPPVY     SPPPPV+S
Sbjct: 659  PVN------SPPPPVYSPPPPSPPPPVHSPPPPVYSPPPPSPPPPVHS 700

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 85/269 (31%), Positives = 95/269 (35%), Gaps = 80/269 (29%)
 Frame = +2

Query: 17   PPPKKPYKYPSPPPPVYKYNSPPPPYKY--------------PSPPPPPYKYPSPPPPVY 154
            P P  PY  P+P  P      P P   Y              PSP PP  + P+P  P  
Sbjct: 414  PTPSTPY-VPTPSTPPSTSYGPTPSTPYVPTPSTPYVPTPSTPSPSPPQQEVPTPQTPSS 472

Query: 155  KYKSPPP---------------PVYKYKSPPP----------------------PVYKYK 223
            +  +P P               P     SP P                      P     
Sbjct: 473  EPYNPSPGGHRESPTPSPEPSKPTSPTTSPSPSPEPSEPTPPATSPSPSSEPSEPTSPTT 532

Query: 224  SPPPPVYKYKSPPP-----------PPKKPYKYPSPPP----PVYKYNSPPPPY--KYPS 352
            SP P     +S PP            P  P   PSP P    P     SP P Y    PS
Sbjct: 533  SPSPSSEPLESTPPTTSPSLSPEPSEPTSPTTSPSPSPEPSEPTSPTTSPSPEYNSSEPS 592

Query: 353  PPPPPYKYP----SPPPPVYKYKSPPPPVYKYK-SPP---PPAKKPYKYPSPP--PPVYK 502
            P P P   P    S P P     SP  P  +   SPP   PP   P + PSPP   P   
Sbjct: 593  PTPSPESEPQSPTSTPSPESPLSSPTSPTLEQSPSPPGQSPPPTTPEQSPSPPGQSPPPP 652

Query: 503  YKSPPPPVYSPPPPVYK--YKSPPPPVYS 583
             +SPPPPV SPPPPVY     SPPPPV+S
Sbjct: 653  TQSPPPPVNSPPPPVYSPPPPSPPPPVHS 681

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 61/191 (31%), Positives = 70/191 (36%), Gaps = 6/191 (3%)
 Frame = +2

Query: 17  PPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKS 196
           P P  P   P+P  P     S PP   Y   P  PY  P+P  P     S P       S
Sbjct: 406 PRPSTP-SVPTPSTPYVPTPSTPPSTSYGPTPSTPY-VPTPSTPYVPTPSTP-------S 456

Query: 197 PPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSP---PPPYKYPSPPPPP 367
           P PP  +  +P  P  +  +P P   +    PSP P   K  SP   P P   PS P PP
Sbjct: 457 PSPPQQEVPTPQTPSSEPYNPSPGGHRESPTPSPEPS--KPTSPTTSPSPSPEPSEPTPP 514

Query: 368 YKYPSPPPPVYKYKSP---PPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP 538
              PSP     +  SP   P P  +     PP   P   P P  P     SP P    P 
Sbjct: 515 ATSPSPSSEPSEPTSPTTSPSPSSEPLESTPPTTSPSLSPEPSEPTSPTTSPSPSP-EPS 573

Query: 539 PPVYKYKSPPP 571
            P     SP P
Sbjct: 574 EPTSPTTSPSP 584

 Score = 63.9 bits (154), Expect = 9e-09
 Identities = 52/178 (29%), Positives = 66/178 (37%), Gaps = 3/178 (1%)
 Frame = +2

Query: 47  SPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKS 226
           SP P      +P  PY  P+P  PP     P P      +P  P     S P       S
Sbjct: 405 SPRPSTPSVPTPSTPY-VPTPSTPPSTSYGPTPSTPYVPTPSTPYVPTPSTP-------S 456

Query: 227 PPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKY 406
           P PP  +  +P  P  +PY   +P P  ++ +        P+P P P K  SP       
Sbjct: 457 PSPPQQEVPTPQTPSSEPY---NPSPGGHRES--------PTPSPEPSKPTSP------- 498

Query: 407 KSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP---PVYSPPPPVYKYKSPPP 571
            + P P  +   P PPA  P     P  P     SP P   P+ S PP      SP P
Sbjct: 499 TTSPSPSPEPSEPTPPATSPSPSSEPSEPTSPTTSPSPSSEPLESTPPTTSPSLSPEP 556

[80][TOP]
>UniRef100_Q9ZWT0 Extensin n=1 Tax=Adiantum capillus-veneris RepID=Q9ZWT0_ADICA
          Length = 207

 Score =  181 bits (460), Expect = 3e-44
 Identities = 105/177 (59%), Positives = 108/177 (61%), Gaps = 1/177 (0%)
 Frame = +2

Query: 2   YKSPPPPPKKP-YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           +KSPPP P  P YKY SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPPPP
Sbjct: 72  HKSPPPSPSSPPYKYKSPPPPS---PSPPPPYIYKSPPPPS---PSPPPP-YIYKSPPPP 124

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
                SPPPP Y YKSPPPP     SP PPP  PY Y SPPPP       PPPY Y SPP
Sbjct: 125 ---SPSPPPP-YLYKSPPPP-----SPSPPP--PYIYKSPPPP--PCTPSPPPYFYSSPP 171

Query: 359 PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY 529
           PP    PSPPPP Y+YKSPPPP                +PSPPP  Y YKSPPPP Y
Sbjct: 172 PPS---PSPPPP-YQYKSPPPP---------------SHPSPPP--YVYKSPPPPPY 207

 Score =  181 bits (458), Expect = 5e-44
 Identities = 105/179 (58%), Positives = 111/179 (62%), Gaps = 7/179 (3%)
 Frame = +2

Query: 65  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 244
           +K  +P  P+ YP   PPP    SP  P YKYKSPPPP     SPPPP Y YKSPPPP  
Sbjct: 60  HKQRTPWHPH-YPHKSPPP----SPSSPPYKYKSPPPPS---PSPPPP-YIYKSPPPP-- 108

Query: 245 KYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 424
              SP PPP  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPPPP
Sbjct: 109 ---SPSPPP--PYIYKSPPPPS---PSPPPPYLYKSPPPPS---PSPPPP-YIYKSPPPP 156

Query: 425 V-------YKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
                   Y Y SPPPP+      PSPPPP Y+YKSPPPP +  PPP Y YKSPPPP Y
Sbjct: 157 PCTPSPPPYFYSSPPPPS------PSPPPP-YQYKSPPPPSHPSPPP-YVYKSPPPPPY 207

[81][TOP]
>UniRef100_Q40415 Extensin (Fragment) n=1 Tax=Nicotiana sylvestris RepID=Q40415_NICSY
          Length = 131

 Score =  181 bits (460), Expect = 3e-44
 Identities = 89/124 (71%), Positives = 92/124 (74%), Gaps = 3/124 (2%)
 Frame = +2

Query: 92  YKYPSPPPPP--YKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP 265
           Y Y SPPPP   Y Y SPPPPVYKYKSPPPP+  Y+SPPPPVYKYKSPPPP+YKYKSPPP
Sbjct: 20  YYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPIYKYKSPPP 79

Query: 266 PPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV-YKYKS 442
           PP     Y SPPPPVYKY SPP       PPPP YK  SPPPPV  YKSPPPP  Y Y S
Sbjct: 80  PPP---VYKSPPPPVYKYKSPP-------PPPPVYK--SPPPPV--YKSPPPPYHYYYTS 125

Query: 443 PPPP 454
           PPPP
Sbjct: 126 PPPP 129

 Score =  181 bits (458), Expect = 5e-44
 Identities = 88/120 (73%), Positives = 90/120 (75%), Gaps = 5/120 (4%)
 Frame = +2

Query: 26  KKPYKYPSPPPPV--YKYNSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKS 196
           K  Y Y SPPPP   Y Y+SPPPP YKY SPPPP   Y SPPPPVYKYKSPPPP+YKYKS
Sbjct: 17  KANYYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPIYKYKS 76

Query: 197 PPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYK--YPSPPPPPY 370
           PPPP   YKSPPPPVYKYKSPPPPP     Y SPPPPVYK  SPPPPY   Y SPPPP Y
Sbjct: 77  PPPPPPVYKSPPPPVYKYKSPPPPPP---VYKSPPPPVYK--SPPPPYHYYYTSPPPPHY 131

 Score =  179 bits (454), Expect = 1e-43
 Identities = 83/115 (72%), Positives = 85/115 (73%), Gaps = 2/115 (1%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYK-YPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           Y S PPPP K Y Y SPPPPVYKY SPPPP   Y SPPPP YKY SPPPP+YKYKSPPPP
Sbjct: 21  YYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPIYKYKSPPPP 80

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPV-YKYNSPPPPY 340
              YKSPPPPVYKYKSPPPP   YKSPPPP      Y SPPPP  Y Y SPPPP+
Sbjct: 81  PPVYKSPPPPVYKYKSPPPPPPVYKSPPPP-----VYKSPPPPYHYYYTSPPPPH 130

 Score =  175 bits (444), Expect = 2e-42
 Identities = 85/116 (73%), Positives = 86/116 (74%), Gaps = 3/116 (2%)
 Frame = +2

Query: 242 YKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYK-YPSPPPPPYKYPSPPPPVYKYKSPP 418
           Y Y SPPPP KK Y Y SPPPPVYKY SPPPP   Y SPPPP YKY SPPPP+YKYKSPP
Sbjct: 20  YYYSSPPPPTKK-YVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPIYKYKSPP 78

Query: 419 PPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY-SPPPPV-YKYKSPPPPVY 580
           PP   YKSPPPP    YKY SPPPP   YKSPPPPVY SPPPP  Y Y SPPPP Y
Sbjct: 79  PPPPVYKSPPPPV---YKYKSPPPPPPVYKSPPPPVYKSPPPPYHYYYTSPPPPHY 131

 Score =  172 bits (437), Expect = 1e-41
 Identities = 85/120 (70%), Positives = 85/120 (70%), Gaps = 4/120 (3%)
 Frame = +2

Query: 182 YKYKSPPPPV--YKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP-YKYPS 352
           Y Y SPPPP   Y Y SPPPPVYKYKSPPPP      Y SPPPPVYKY SPPPP YKY S
Sbjct: 20  YYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPI---YRSPPPPVYKYKSPPPPIYKYKS 76

Query: 353 PPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPV-YKYKSPPPPVY 529
           PPPPP  Y SPPPPVYKYKSPPPP   YKSPPPP      Y SPPPP  Y Y SPPPP Y
Sbjct: 77  PPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPPV-----YKSPPPPYHYYYTSPPPPHY 131

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 35/60 (58%), Positives = 37/60 (61%), Gaps = 15/60 (25%)
 Frame = +2

Query: 446 PPPAKKPYKYPSPPP------------PVYKYKSPPPPV---YSPPPPVYKYKSPPPPVY 580
           P   K  Y Y SPPP            PVYKYKSPPPP+    SPPPPVYKYKSPPPP+Y
Sbjct: 13  PLECKANYYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPIY 72

[82][TOP]
>UniRef100_B9H7Q5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H7Q5_POPTR
          Length = 173

 Score =  180 bits (457), Expect = 6e-44
 Identities = 91/146 (62%), Positives = 96/146 (65%), Gaps = 4/146 (2%)
 Frame = +2

Query: 44  PSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP-VYKYKSPPPPVYKY 220
           PS     Y+Y+SPPPP K P PPPPPY Y SPPPP   +  PPPP  YKYKSPPPP    
Sbjct: 22  PSQTTANYEYSSPPPPKKSPPPPPPPYHYKSPPPPPPVHSPPPPPHPYKYKSPPPP---- 77

Query: 221 KSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP---YKYPSPPPPPYKYPSPPP 391
               PPV+K    PPPPKKPYKY SPPPP    +SPPPP   YKY SPP        PPP
Sbjct: 78  ----PPVHK---SPPPPKKPYKYKSPPPP--PVHSPPPPSHPYKYKSPP--------PPP 120

Query: 392 PVYKYKSPPPPVYKYKSPPPPAKKPY 469
           PVYKYKSPPPP   YKSPPPP KKPY
Sbjct: 121 PVYKYKSPPPPPPVYKSPPPPPKKPY 146

 Score =  158 bits (399), Expect = 3e-37
 Identities = 81/125 (64%), Positives = 85/125 (68%), Gaps = 4/125 (3%)
 Frame = +2

Query: 212 YKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPP 391
           Y+Y SPPPP  K   PPPPP   YK P PPPPV+    PP PYKY SPPPPP  + SPPP
Sbjct: 29  YEYSSPPPP--KKSPPPPPPPYHYKSPPPPPPVHSPPPPPHPYKYKSPPPPPPVHKSPPP 86

Query: 392 P--VYKYKSPPPPVYKYKSPPPPAKKPYKY--PSPPPPVYKYKSPPPPVYSPPPPVYKYK 559
           P   YKYKSPPPP     SPPPP+  PYKY  P PPPPVYKYKSPP     PPPPV  YK
Sbjct: 87  PKKPYKYKSPPPP--PVHSPPPPS-HPYKYKSPPPPPPVYKYKSPP-----PPPPV--YK 136

Query: 560 SPPPP 574
           SPPPP
Sbjct: 137 SPPPP 141

 Score =  157 bits (398), Expect = 4e-37
 Identities = 87/150 (58%), Positives = 90/150 (60%), Gaps = 5/150 (3%)
 Frame = +2

Query: 101 PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKP 280
           PS     Y+Y SPPPP  K   PPPP Y YKSPPPP        PPV+   SPPPPP  P
Sbjct: 22  PSQTTANYEYSSPPPPK-KSPPPPPPPYHYKSPPPP--------PPVH---SPPPPPH-P 68

Query: 281 YKYPSPPPPVYKYNSPPPP---YKYPSPPPPPYKYPSPPPPVYKYKSPPPP--VYKYKSP 445
           YKY SPPPP   + SPPPP   YKY SPPPPP   P PP   YKYKSPPPP  VYKYKSP
Sbjct: 69  YKYKSPPPPPPVHKSPPPPKKPYKYKSPPPPPVHSPPPPSHPYKYKSPPPPPPVYKYKSP 128

Query: 446 PPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
           P           PPPPV  YKSPPPP   P
Sbjct: 129 P-----------PPPPV--YKSPPPPPKKP 145

 Score =  152 bits (385), Expect = 1e-35
 Identities = 76/120 (63%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP--YKYPSPPPPVYKYKSPPP 175
           Y SPPPP K P     PPPP Y Y SPPPP    SPPPPP  YKY SPPPP   +KSPPP
Sbjct: 31  YSSPPPPKKSP----PPPPPPYHYKSPPPPPPVHSPPPPPHPYKYKSPPPPPPVHKSPPP 86

Query: 176 PV--YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP 349
           P   YKYKSPPPP      PP   YKYKSPPPPP   YKY SPPPP   Y SPPPP K P
Sbjct: 87  PKKPYKYKSPPPPPVHSPPPPSHPYKYKSPPPPPPV-YKYKSPPPPPPVYKSPPPPPKKP 145

 Score =  140 bits (353), Expect = 7e-32
 Identities = 67/99 (67%), Positives = 68/99 (68%), Gaps = 5/99 (5%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP---YKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           YKSPPPPP  P   P PPP  YKY SPPPP   +K P PP  PYKY SPPPP      PP
Sbjct: 50  YKSPPPPP--PVHSPPPPPHPYKYKSPPPPPPVHKSPPPPKKPYKYKSPPPPPVHSPPPP 107

Query: 173 PPVYKYKS--PPPPVYKYKSPPPPVYKYKSPPPPPKKPY 283
              YKYKS  PPPPVYKYKSPPPP   YKSPPPPPKKPY
Sbjct: 108 SHPYKYKSPPPPPPVYKYKSPPPPPPVYKSPPPPPKKPY 146

 Score = 90.9 bits (224), Expect = 7e-17
 Identities = 49/80 (61%), Positives = 51/80 (63%), Gaps = 15/80 (18%)
 Frame = +2

Query: 2   YKSPPPPP---------KKPYKYPSPPPPVYKYNSPPPP---YKYPSPPPPP--YKYPSP 139
           YKSPPPPP         KKPYKY SPPPP    +SPPPP   YKY SPPPPP  YKY SP
Sbjct: 71  YKSPPPPPPVHKSPPPPKKPYKYKSPPPP--PVHSPPPPSHPYKYKSPPPPPPVYKYKSP 128

Query: 140 PPPVYKYKSPPPPV-YKYKS 196
           PPP   YKSPPPP    Y +
Sbjct: 129 PPPPPVYKSPPPPPKKPYNT 148

 Score = 87.0 bits (214), Expect = 1e-15
 Identities = 47/86 (54%), Positives = 49/86 (56%), Gaps = 10/86 (11%)
 Frame = +2

Query: 347 PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV 526
           PS     Y+Y SPPPP  K   PPPP Y YKSPPPP   P   P PPP  YKYKSPPPP 
Sbjct: 22  PSQTTANYEYSSPPPPK-KSPPPPPPPYHYKSPPPPP--PVHSPPPPPHPYKYKSPPPP- 77

Query: 527 YSPPPPVY----------KYKSPPPP 574
               PPV+          KYKSPPPP
Sbjct: 78  ----PPVHKSPPPPKKPYKYKSPPPP 99

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 37/57 (64%), Positives = 40/57 (70%), Gaps = 6/57 (10%)
 Frame = +2

Query: 428 YKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPP--VYSPPPPV--YKYKSP--PPPVY 580
           Y+Y SPPPP K P     PPPP Y YKSPPPP  V+SPPPP   YKYKSP  PPPV+
Sbjct: 29  YEYSSPPPPKKSP----PPPPPPYHYKSPPPPPPVHSPPPPPHPYKYKSPPPPPPVH 81

[83][TOP]
>UniRef100_B9HRV2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HRV2_POPTR
          Length = 711

 Score =  179 bits (454), Expect = 1e-43
 Identities = 113/229 (49%), Positives = 126/229 (55%), Gaps = 37/229 (16%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYK-----YNSPPPPYKYP----SPPPPPYKYP----SPPPP 148
            SPPPPP       SPPPP+Y      Y+ PPP +  P    SPPPP   +P    SPPPP
Sbjct: 436  SPPPPPVH-----SPPPPIYSPPPLVYSPPPPVHSPPPPVHSPPPPVQSFPPPVHSPPPP 490

Query: 149  VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYK----YKSPPPP---PKKPYKYPSPPPP 307
            V+    PPPPVY   SPPPPV+   SPPPPVY      +SPPPP   P  P   P PPPP
Sbjct: 491  VHS--PPPPPVY---SPPPPVH---SPPPPVYSPPPLVQSPPPPVHSPPPPLHSP-PPPP 541

Query: 308  VYK----YNSPPPPYKYPSPP---PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP 466
            VY      +SPPPP   P PP   PPP  +  PPPP++   SPPPPV     PPPP   P
Sbjct: 542  VYSPPPPVHSPPPPVHSPPPPIQSPPPPVHSPPPPPIH---SPPPPVQSL--PPPPVNSP 596

Query: 467  YK-YPSPPPPVYKYKSP----PPPVYSPPPPVYKY-----KSPPPPVYS 583
                 SPPPPV+   SP    PPPV SPPPPV         SPPPPV+S
Sbjct: 597  LPPVHSPPPPVHSPTSPIHSHPPPVNSPPPPVQSLPPPPVNSPPPPVHS 645

 Score =  178 bits (452), Expect = 2e-43
 Identities = 111/213 (52%), Positives = 122/213 (57%), Gaps = 22/213 (10%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP---PPPYKYPSPPPPVYKYKSPPPPV 181
           PPP    P     PPPPV+  + PPPP   P PP   PPP  Y SPPPPV+   SPPPPV
Sbjct: 417 PPPAHSPPPSIHFPPPPVH--SPPPPPVHSPPPPIYSPPPLVY-SPPPPVH---SPPPPV 470

Query: 182 YKYKSPPPPVYKY----KSPPPPVYKYKSPPPPP--KKPYKYPSPPPPVYK----YNSPP 331
           +   SPPPPV  +     SPPPPV+   SPPPPP    P    SPPPPVY       SPP
Sbjct: 471 H---SPPPPVQSFPPPVHSPPPPVH---SPPPPPVYSPPPPVHSPPPPVYSPPPLVQSPP 524

Query: 332 PPYKYPSPP---PPPYKYPSPPPPVYKYKSPPPPVYK----YKSPPPPAKKPYKYP--SP 484
           PP   P PP   PPP    SPPPPV+   SPPPPV+      +SPPPP   P   P  SP
Sbjct: 525 PPVHSPPPPLHSPPPPPVYSPPPPVH---SPPPPVHSPPPPIQSPPPPVHSPPPPPIHSP 581

Query: 485 PPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           PPPV     PPPPV SP PPV+   SPPPPV+S
Sbjct: 582 PPPVQSL--PPPPVNSPLPPVH---SPPPPVHS 609

 Score =  173 bits (438), Expect = 1e-41
 Identities = 110/204 (53%), Positives = 126/204 (61%), Gaps = 12/204 (5%)
 Frame = +2

Query: 8   SPPPPPKK--PYKYPSPPP---PVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           SPPP  +   P  +  PPP   P    + PPPP    SPPPPP    SPPPP+Y   SPP
Sbjct: 401 SPPPSSQSLPPLVHSLPPPAHSPPPSIHFPPPPVH--SPPPPPVH--SPPPPIY---SPP 453

Query: 173 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKK-PYKYPSPPPPVYKYNSPPPPYKYP 349
           P VY   SPPPPV+   SPPPPV+   SPPPP +  P    SPPPPV+   SPPPP  Y 
Sbjct: 454 PLVY---SPPPPVH---SPPPPVH---SPPPPVQSFPPPVHSPPPPVH---SPPPPPVY- 500

Query: 350 SPPPPPYKYPSPPPPVYK----YKSPPPPVYKYKSPPPPAKKPYKYP--SPPPPVYKYKS 511
           SPPPP +   SPPPPVY      +SPPPPV+   SPPPP   P   P  SPPPPV+   S
Sbjct: 501 SPPPPVH---SPPPPVYSPPPLVQSPPPPVH---SPPPPLHSPPPPPVYSPPPPVH---S 551

Query: 512 PPPPVYSPPPPVYKYKSPPPPVYS 583
           PPPPV+SPPPP+   +SPPPPV+S
Sbjct: 552 PPPPVHSPPPPI---QSPPPPVHS 572

 Score =  173 bits (438), Expect = 1e-41
 Identities = 110/222 (49%), Positives = 128/222 (57%), Gaps = 32/222 (14%)
 Frame = +2

Query: 14   PPPPKKPYKYP--SPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYK----YKSPPP 175
            PPPP + +  P  SPPPPV+   SPPPP  Y SPPPP +   SPPPPVY      +SPPP
Sbjct: 473  PPPPVQSFPPPVHSPPPPVH---SPPPPPVY-SPPPPVH---SPPPPVYSPPPLVQSPPP 525

Query: 176  PVYK-----YKSPPPPVYKYKSPPPPVYKYKSPPPP-PKKPYKYPSPPPPVYKYNSPPPP 337
            PV+      +  PPPPVY   SPPPPV+   SPPPP    P    SPPPPV  ++ PPPP
Sbjct: 526  PVHSPPPPLHSPPPPPVY---SPPPPVH---SPPPPVHSPPPPIQSPPPPV--HSPPPPP 577

Query: 338  YKYPSP-----PPPPYKYP-----SPPPPVYKYKSP----PPPVYKYKSPPPPAKK--PY 469
               P P     PPPP   P     SPPPPV+   SP    PPPV    SPPPP +   P 
Sbjct: 578  IHSPPPPVQSLPPPPVNSPLPPVHSPPPPVHSPTSPIHSHPPPV---NSPPPPVQSLPPP 634

Query: 470  KYPSPPPPVYK----YKSPPPPVYSPPPPVYKYKSPPPPVYS 583
               SPPPPV+       SP PP++SPPPP+   +SPPPPV+S
Sbjct: 635  PVNSPPPPVHSPTPPIHSPSPPLHSPPPPI---RSPPPPVFS 673

 Score =  154 bits (389), Expect = 5e-36
 Identities = 100/219 (45%), Positives = 119/219 (54%), Gaps = 27/219 (12%)
 Frame = +2

Query: 5    KSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 175
            +SPPPP   P  P   P PPPPV  Y+ PPP +   SPPPP +   SPPPP+   +SPPP
Sbjct: 521  QSPPPPVHSPPPPLHSP-PPPPV--YSPPPPVH---SPPPPVH---SPPPPI---QSPPP 568

Query: 176  PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPY-KYPSPPPPVYKYNSP----PPPY 340
            PV  +  PPPP++   SPPPPV     PPPP   P     SPPPPV+   SP    PPP 
Sbjct: 569  PV--HSPPPPPIH---SPPPPVQSL--PPPPVNSPLPPVHSPPPPVHSPTSPIHSHPPPV 621

Query: 341  KYPSPPP---PPYKYPSPPPPVYKYKSPPPPVYK----YKSPPPPAKKPYKYPSPPPPVY 499
              P PP    PP    SPPPPV+   SP PP++       SPPPP +      SPPPPV+
Sbjct: 622  NSPPPPVQSLPPPPVNSPPPPVH---SPTPPIHSPSPPLHSPPPPIR------SPPPPVF 672

Query: 500  KYKSPPPPVYSPPPPV------------YKYKSPPPPVY 580
               SPPP + SPPPP             ++Y SPPPP +
Sbjct: 673  ---SPPPVIVSPPPPPPEEDFILPPNLGFQYASPPPPTF 708

 Score = 87.0 bits (214), Expect = 1e-15
 Identities = 59/138 (42%), Positives = 71/138 (51%), Gaps = 24/138 (17%)
 Frame = +2

Query: 8   SPPPP----PKKPYKYP-----SPPPPVYKYNSP----PPPYKYPSPPP---PPYKYPSP 139
           SPPPP    P  P   P     SPPPPV+   SP    PPP   P PP    PP    SP
Sbjct: 580 SPPPPVQSLPPPPVNSPLPPVHSPPPPVHSPTSPIHSHPPPVNSPPPPVQSLPPPPVNSP 639

Query: 140 PPPVYKYKSPPPPVYK----YKSPPPPVYKYKSPPPPVYK----YKSPPPPPKKPYKYPS 295
           PPPV+   SP PP++       SPPPP+   +SPPPPV+       SPPPPP +   +  
Sbjct: 640 PPPVH---SPTPPIHSPSPPLHSPPPPI---RSPPPPVFSPPPVIVSPPPPPPEE-DFIL 692

Query: 296 PPPPVYKYNSPPPPYKYP 349
           PP   ++Y SPP P  +P
Sbjct: 693 PPNLGFQYASPP-PPTFP 709

[84][TOP]
>UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis
            RepID=Q8L685_VOLCA
          Length = 1009

 Score =  179 bits (453), Expect = 2e-43
 Identities = 91/188 (48%), Positives = 91/188 (48%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 495  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 555  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 615  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674

Query: 551  KYKSPPPP 574
               SPPPP
Sbjct: 675  LPPSPPPP 682

 Score =  179 bits (453), Expect = 2e-43
 Identities = 90/188 (47%), Positives = 91/188 (48%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 497  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 557  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP+ 
Sbjct: 617  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 677  PSPPPPPP 684

 Score =  179 bits (453), Expect = 2e-43
 Identities = 91/188 (48%), Positives = 91/188 (48%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 512  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 572  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP     SPPPP   PPPP  
Sbjct: 632  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 692  PPPPPPPP 699

 Score =  179 bits (453), Expect = 2e-43
 Identities = 90/188 (47%), Positives = 91/188 (48%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 514  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 574  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP+     PPPP   PPPP  
Sbjct: 634  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 694  PPPPPPPP 701

 Score =  178 bits (452), Expect = 2e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 410 PPPPPPPP 417

 Score =  178 bits (452), Expect = 2e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 496  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 556  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 616  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 675

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 676  PPSPPPPP 683

 Score =  178 bits (452), Expect = 2e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 513  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 573  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 633  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 693  PPPPPPPP 700

 Score =  178 bits (451), Expect = 3e-43
 Identities = 90/187 (48%), Positives = 91/187 (48%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 193
           PPPP  P   PSPPPP+     PPPP   P PPPPP   P PPPP      PPPP     
Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283

Query: 194 SPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYK 373
            PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP  
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

Query: 374 YPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYK 553
            P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP   
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 554 YKSPPPP 574
              PPPP
Sbjct: 404 PPPPPPP 410

 Score =  177 bits (450), Expect = 4e-43
 Identities = 90/189 (47%), Positives = 91/189 (48%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 487  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 547  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 607  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666

Query: 551  KYKSPPPPV 577
                PPPP+
Sbjct: 667  PPPPPPPPL 675

 Score =  177 bits (450), Expect = 4e-43
 Identities = 90/188 (47%), Positives = 91/188 (48%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 522  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 582  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   PSPPPP      PPPP   PPPP  
Sbjct: 642  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701

Query: 551  KYKSPPPP 574
             +  PP P
Sbjct: 702  PHPPPPSP 709

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 421 PPPPPPPP 428

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 422 PPPPPPPP 429

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 423 PPPPPPPP 430

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 424 PPPPPPPP 431

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 425 PPPPPPPP 432

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 426 PPPPPPPP 433

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 427 PPPPPPPP 434

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 428 PPPPPPPP 435

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 429 PPPPPPPP 436

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 430 PPPPPPPP 437

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 431 PPPPPPPP 438

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 432 PPPPPPPP 439

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 433 PPPPPPPP 440

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 434 PPPPPPPP 441

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 435 PPPPPPPP 442

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 436 PPPPPPPP 443

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 437 PPPPPPPP 444

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 438 PPPPPPPP 445

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 439 PPPPPPPP 446

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 440 PPPPPPPP 447

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 441 PPPPPPPP 448

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 442 PPPPPPPP 449

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 443 PPPPPPPP 450

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 444 PPPPPPPP 451

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 445 PPPPPPPP 452

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 446 PPPPPPPP 453

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 447 PPPPPPPP 454

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 448 PPPPPPPP 455

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 449 PPPPPPPP 456

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 450 PPPPPPPP 457

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 451 PPPPPPPP 458

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 452 PPPPPPPP 459

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 453 PPPPPPPP 460

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 454 PPPPPPPP 461

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 455 PPPPPPPP 462

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 456 PPPPPPPP 463

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 457 PPPPPPPP 464

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 458 PPPPPPPP 465

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 459 PPPPPPPP 466

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 460 PPPPPPPP 467

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 461 PPPPPPPP 468

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 462 PPPPPPPP 469

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 463 PPPPPPPP 470

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 464 PPPPPPPP 471

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 465 PPPPPPPP 472

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 466 PPPPPPPP 473

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 467 PPPPPPPP 474

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 468 PPPPPPPP 475

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 469 PPPPPPPP 476

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 470 PPPPPPPP 477

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 471 PPPPPPPP 478

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 472 PPPPPPPP 479

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 473 PPPPPPPP 480

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 474 PPPPPPPP 481

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 475 PPPPPPPP 482

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 476 PPPPPPPP 483

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 477 PPPPPPPP 484

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 478 PPPPPPPP 485

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 479 PPPPPPPP 486

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 480 PPPPPPPP 487

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 481 PPPPPPPP 488

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 482 PPPPPPPP 489

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 483 PPPPPPPP 490

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 484 PPPPPPPP 491

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 485 PPPPPPPP 492

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 486 PPPPPPPP 493

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 487 PPPPPPPP 494

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 488 PPPPPPPP 495

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 489 PPPPPPPP 496

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 490 PPPPPPPP 497

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 491 PPPPPPPP 498

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 492 PPPPPPPP 499

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 493 PPPPPPPP 500

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 494 PPPPPPPP 501

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 495 PPPPPPPP 502

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 496 PPPPPPPP 503

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 497 PPPPPPPP 504

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 498 PPPPPPPP 505

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 499 PPPPPPPP 506

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 500 PPPPPPPP 507

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 501 PPPPPPPP 508

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 502 PPPPPPPP 509

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 503 PPPPPPPP 510

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 504 PPPPPPPP 511

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 505 PPPPPPPP 512

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 506 PPPPPPPP 513

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 507 PPPPPPPP 514

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 508 PPPPPPPP 515

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 509 PPPPPPPP 516

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 510 PPPPPPPP 517

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 511 PPPPPPPP 518

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 512 PPPPPPPP 519

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 513 PPPPPPPP 520

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 514 PPPPPPPP 521

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 515 PPPPPPPP 522

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 516 PPPPPPPP 523

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 517 PPPPPPPP 524

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 518 PPPPPPPP 525

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 519 PPPPPPPP 526

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 520 PPPPPPPP 527

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 521 PPPPPPPP 528

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 522 PPPPPPPP 529

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 523 PPPPPPPP 530

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 524 PPPPPPPP 531

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 525 PPPPPPPP 532

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 526 PPPPPPPP 533

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 527 PPPPPPPP 534

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 528 PPPPPPPP 535

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 529 PPPPPPPP 536

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 530 PPPPPPPP 537

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 531 PPPPPPPP 538

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 532 PPPPPPPP 539

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 533 PPPPPPPP 540

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 534 PPPPPPPP 541

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 535 PPPPPPPP 542

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 536 PPPPPPPP 543

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 537 PPPPPPPP 544

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 538 PPPPPPPP 545

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 539 PPPPPPPP 546

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 540 PPPPPPPP 547

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 541 PPPPPPPP 548

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 542 PPPPPPPP 549

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 543 PPPPPPPP 550

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 544 PPPPPPPP 551

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 545 PPPPPPPP 552

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 546 PPPPPPPP 553

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 547 PPPPPPPP 554

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 548 PPPPPPPP 555

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 549 PPPPPPPP 556

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 550 PPPPPPPP 557

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 551 PPPPPPPP 558

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 552 PPPPPPPP 559

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 553 PPPPPPPP 560

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 554 PPPPPPPP 561

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 555 PPPPPPPP 562

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 556 PPPPPPPP 563

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 557 PPPPPPPP 564

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 558 PPPPPPPP 565

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 559 PPPPPPPP 566

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 560 PPPPPPPP 567

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 561 PPPPPPPP 568

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 562 PPPPPPPP 569

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 563 PPPPPPPP 570

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 564 PPPPPPPP 571

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 565 PPPPPPPP 572

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 566 PPPPPPPP 573

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 567 PPPPPPPP 574

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 568 PPPPPPPP 575

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 569 PPPPPPPP 576

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 570 PPPPPPPP 577

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 571 PPPPPPPP 578

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 572 PPPPPPPP 579

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 573 PPPPPPPP 580

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 574 PPPPPPPP 581

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 575 PPPPPPPP 582

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 576 PPPPPPPP 583

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 577 PPPPPPPP 584

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 578 PPPPPPPP 585

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 579 PPPPPPPP 586

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 580 PPPPPPPP 587

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 581 PPPPPPPP 588

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 582 PPPPPPPP 589

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 583 PPPPPPPP 590

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 584 PPPPPPPP 591

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 585 PPPPPPPP 592

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 586 PPPPPPPP 593

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 587 PPPPPPPP 594

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 588 PPPPPPPP 595

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 589 PPPPPPPP 596

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 590 PPPPPPPP 597

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 591 PPPPPPPP 598

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 592 PPPPPPPP 599

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 593 PPPPPPPP 600

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 594 PPPPPPPP 601

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 595 PPPPPPPP 602

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 596 PPPPPPPP 603

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 597 PPPPPPPP 604

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 598 PPPPPPPP 605

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 599 PPPPPPPP 606

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 600 PPPPPPPP 607

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 601 PPPPPPPP 608

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 602 PPPPPPPP 609

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 603 PPPPPPPP 610

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 604 PPPPPPPP 611

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 605 PPPPPPPP 612

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 606 PPPPPPPP 613

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 607 PPPPPPPP 614

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 608 PPPPPPPP 615

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 609 PPPPPPPP 616

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 610 PPPPPPPP 617

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 611 PPPPPPPP 618

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 612 PPPPPPPP 619

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 613 PPPPPPPP 620

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 614 PPPPPPPP 621

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 615 PPPPPPPP 622

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 616 PPPPPPPP 623

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 437  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 497  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 557  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 617  PPPPPPPP 624

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 438  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 498  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 558  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 618  PPPPPPPP 625

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 439  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 499  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 559  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 619  PPPPPPPP 626

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 440  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 500  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 560  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 620  PPPPPPPP 627

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 441  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 501  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 561  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 621  PPPPPPPP 628

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 442  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 502  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 562  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 622  PPPPPPPP 629

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 443  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 503  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 563  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 623  PPPPPPPP 630

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 444  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 504  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 564  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 624  PPPPPPPP 631

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 445  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 505  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 565  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 625  PPPPPPPP 632

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 446  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 506  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 566  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 626  PPPPPPPP 633

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 447  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 507  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 567  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 627  PPPPPPPP 634

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 448  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 508  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 568  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 628  PPPPPPPP 635

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 449  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 509  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 569  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 629  PPPPPPPP 636

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 450  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 510  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 570  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 630  PPPPPPPP 637

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 451  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 511  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 571  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 631  PPPPPPPP 638

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 452  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 512  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 572  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 632  PPPPPPPP 639

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 453  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 513  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 573  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 633  PPPPPPPP 640

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 454  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 514  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 574  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 634  PPPPPPPP 641

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 455  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 515  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 575  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 635  PPPPPPPP 642

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 456  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 516  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 576  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 636  PPPPPPPP 643

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 457  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 517  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 577  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 637  PPPPPPPP 644

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 458  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 518  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 578  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 638  PPPPPPPP 645

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 459  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 519  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 579  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 639  PPPPPPPP 646

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 460  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 520  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 580  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 640  PPPPPPPP 647

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 461  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 521  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 581  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 641  PPPPPPPP 648

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 462  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 522  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 582  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 642  PPPPPPPP 649

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 463  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 523  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 583  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 643  PPPPPPPP 650

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 464  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 524  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 584  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 644  PPPPPPPP 651

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 465  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 525  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 585  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 645  PPPPPPPP 652

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 466  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 526  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 586  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 646  PPPPPPPP 653

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 467  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 527  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 587  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 647  PPPPPPPP 654

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 468  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 528  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 588  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 648  PPPPPPPP 655

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 469  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 529  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 589  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 649  PPPPPPPP 656

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 470  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 530  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 590  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 650  PPPPPPPP 657

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 471  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 531  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 591  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 651  PPPPPPPP 658

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 472  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 532  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 592  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 652  PPPPPPPP 659

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 473  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 533  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 593  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 653  PPPPPPPP 660

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 474  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 534  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 594  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 654  PPPPPPPP 661

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 475  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 535  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 595  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 655  PPPPPPPP 662

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 476  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 536  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 596  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 656  PPPPPPPP 663

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 477  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 537  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 597  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 657  PPPPPPPP 664

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 478  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 538  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 598  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 658  PPPPPPPP 665

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 479  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 539  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 599  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 659  PPPPPPPP 666

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 480  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 540  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 600  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 660  PPPPPPPP 667

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 481  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 541  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 601  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 661  PPPPPPPP 668

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 482  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 542  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 602  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 662  PPPPPPPP 669

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 483  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 543  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 603  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 663  PPPPPPPP 670

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 484  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 544  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 604  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 664  PPPPPPPP 671

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 485  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 545  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 605  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 665  PPPPPPPP 672

 Score =  177 bits (449), Expect = 5e-43
 Identities = 90/188 (47%), Positives = 90/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 486  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 546  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 606  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 666  PPPPPPPP 673

 Score =  176 bits (447), Expect = 9e-43
 Identities = 91/189 (48%), Positives = 91/189 (48%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 525  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 585  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 645  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHP 704

Query: 551  KYKSPPPPV 577
               SPPP V
Sbjct: 705  PPPSPPPLV 713

 Score =  176 bits (445), Expect = 2e-42
 Identities = 93/191 (48%), Positives = 93/191 (48%), Gaps = 2/191 (1%)
 Frame = +2

Query: 8   SPPPPPKKPYKYP--SPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           SPPPPP  P   P  SPPPP     SPPPP   P PPPPP   P PPPP      PPPP 
Sbjct: 213 SPPPPPPLPPSPPPPSPPPPP---PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
                PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPP
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPP 541
           PP   P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPP
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 542 PVYKYKSPPPP 574
           P      PPPP
Sbjct: 390 PPPPPPPPPPP 400

 Score =  176 bits (445), Expect = 2e-42
 Identities = 91/189 (48%), Positives = 92/189 (48%), Gaps = 1/189 (0%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 504  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 564  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY-SPPPPV 547
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP+  SPPPP 
Sbjct: 624  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683

Query: 548  YKYKSPPPP 574
                 PPPP
Sbjct: 684  PPPPPPPPP 692

 Score =  175 bits (444), Expect = 2e-42
 Identities = 90/189 (47%), Positives = 90/189 (47%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPPP  P     PPPP      PPPP   P PPPPP   P PPPP      PPPP   
Sbjct: 228 SPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP 
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 548 YKYKSPPPP 574
                PPPP
Sbjct: 408 PPPPPPPPP 416

 Score =  175 bits (443), Expect = 3e-42
 Identities = 89/188 (47%), Positives = 89/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPP P  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 412 PPPPPPPP 419

 Score =  175 bits (443), Expect = 3e-42
 Identities = 89/188 (47%), Positives = 89/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 503  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 563  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PPPP   P PP  
Sbjct: 623  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 683  PPPPPPPP 690

 Score =  174 bits (440), Expect = 6e-42
 Identities = 89/188 (47%), Positives = 89/188 (47%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           P PPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP  
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 551 KYKSPPPP 574
               PPPP
Sbjct: 414 PPPPPPPP 421

 Score =  174 bits (440), Expect = 6e-42
 Identities = 89/188 (47%), Positives = 89/188 (47%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 509  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PPPPP 
Sbjct: 569  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
              P PPPP      PPPP      PPPP   P   P PPPP      PP P   PPPP  
Sbjct: 629  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688

Query: 551  KYKSPPPP 574
                PPPP
Sbjct: 689  PPPPPPPP 696

 Score =  155 bits (391), Expect = 3e-36
 Identities = 84/177 (47%), Positives = 85/177 (48%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 559  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   P PPPP      PPPP   P PP PP 
Sbjct: 619  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPP 541
              P PPPP      PPPP      PPPP   P   P PPPP     SPPP V + PP
Sbjct: 679  PPPPPPPP------PPPP------PPPPPPPPPPPPHPPPP-----SPPPLVPALPP 718

 Score =  135 bits (339), Expect = 3e-30
 Identities = 71/157 (45%), Positives = 76/157 (48%), Gaps = 2/157 (1%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP  P   P PPPP      PPPP   P PPPPP   P PPPP      PPPP    
Sbjct: 584  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP      PPPPP  P   PSPPPP      PPPP   P PPPPP+
Sbjct: 644  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPH 703

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPA--KKPYKY 475
              P  PPP+     P   V       PPA   +PY++
Sbjct: 704  PPPPSPPPLVPALPPSCEVCIVARLLPPAFDVRPYRF 740

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 61/126 (48%), Positives = 61/126 (48%)
 Frame = +2

Query: 197 PPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKY 376
           P   V  Y  PPP      SPPPPP  P   PSPPPP     SPPPP   PSPPPP    
Sbjct: 200 PVSTVIGYNPPPP------SPPPPPPLP---PSPPPP-----SPPPPP--PSPPPP---L 240

Query: 377 PSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKY 556
           P PPPP      PPPP      PPPP   P   P PPPP      PPPP   PPPP    
Sbjct: 241 PPPPPP------PPPP------PPPPPPPPPPPPPPPPP-----PPPPPPPPPPPPPPPP 283

Query: 557 KSPPPP 574
             PPPP
Sbjct: 284 PPPPPP 289

[85][TOP]
>UniRef100_Q76KW3 Hydroxyproline-rich glycoprotein-2 (Fragment) n=1 Tax=Pisum sativum
           RepID=Q76KW3_PEA
          Length = 155

 Score =  178 bits (452), Expect = 2e-43
 Identities = 91/142 (64%), Positives = 97/142 (68%), Gaps = 3/142 (2%)
 Frame = +2

Query: 65  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 244
           Y Y+SPPPP       P PY Y SPPPPV+   SPPPP Y Y SPPPPV+   SPPPP Y
Sbjct: 31  YLYSSPPPP-------PKPYYYQSPPPPVH---SPPPP-YHYSSPPPPVH---SPPPP-Y 75

Query: 245 KYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPV---YKYKSP 415
            Y SPPPPPKK YKY SPPPP+YKY SPPPP      PPPPY Y SPPPP    YKY SP
Sbjct: 76  HYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPVH---SPPPPYHYSSPPPPPKKSYKYSSP 132

Query: 416 PPPVYKYKSPPPPAKKPYKYPS 481
           PPPVYKYKS   P ++ YKY S
Sbjct: 133 PPPVYKYKS---PHQQVYKYKS 151

 Score =  172 bits (436), Expect = 2e-41
 Identities = 89/138 (64%), Positives = 93/138 (67%), Gaps = 11/138 (7%)
 Frame = +2

Query: 182 YKYKSPPPPV--YKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
           Y Y SPPPP   Y Y+SPPPPV+   SPPPP    Y Y SPPPPV+   SPPPPY Y SP
Sbjct: 31  YLYSSPPPPPKPYYYQSPPPPVH---SPPPP----YHYSSPPPPVH---SPPPPYHYSSP 80

Query: 356 PPPP---YKYPSPPPPVYKYKSPPPPV------YKYKSPPPPAKKPYKYPSPPPPVYKYK 508
           PPPP   YKY SPPPP+YKYKSPPPPV      Y Y SPPPP KK YKY SPPPPVYKYK
Sbjct: 81  PPPPKKSYKYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPVYKYK 140

Query: 509 SPPPPVYSPPPPVYKYKS 562
                  SP   VYKYKS
Sbjct: 141 -------SPHQQVYKYKS 151

 Score =  171 bits (432), Expect = 5e-41
 Identities = 87/127 (68%), Positives = 90/127 (70%), Gaps = 10/127 (7%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY--KYPSP----PPPPYKYPSPPPP---VY 154
           Y SPPPPPK PY Y SPPPPV+   SPPPPY    P P    PPPPY Y SPPPP    Y
Sbjct: 33  YSSPPPPPK-PYYYQSPPPPVH---SPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPKKSY 88

Query: 155 KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSP-P 331
           KY SPPPP+YKYKSPPPPV+   SPPPP Y Y SPPPPPKK YKY SPPPPVYKY SP  
Sbjct: 89  KYSSPPPPIYKYKSPPPPVH---SPPPP-YHYSSPPPPPKKSYKYSSPPPPVYKYKSPHQ 144

Query: 332 PPYKYPS 352
             YKY S
Sbjct: 145 QVYKYKS 151

 Score =  157 bits (398), Expect = 4e-37
 Identities = 77/125 (61%), Positives = 81/125 (64%), Gaps = 12/125 (9%)
 Frame = +2

Query: 242 YKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 421
           Y Y SPPPPPK PY Y SPPPPV+              PPPPY Y SPPPPV+   SPPP
Sbjct: 31  YLYSSPPPPPK-PYYYQSPPPPVHS-------------PPPPYHYSSPPPPVH---SPPP 73

Query: 422 PVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV------------YKYKSP 565
           P Y Y SPPPP KK YKY SPPPP+YKYKSPPPPV+SPPPP             YKY SP
Sbjct: 74  P-YHYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSP 132

Query: 566 PPPVY 580
           PPPVY
Sbjct: 133 PPPVY 137

 Score =  108 bits (271), Expect = 2e-22
 Identities = 60/104 (57%), Positives = 64/104 (61%), Gaps = 3/104 (2%)
 Frame = +2

Query: 281 YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK 460
           Y Y SPPPP       P PY Y SPPPP +   SPPPP Y Y SPPPPV+   SPPPP  
Sbjct: 31  YLYSSPPPP-------PKPYYYQSPPPPVH---SPPPP-YHYSSPPPPVH---SPPPP-- 74

Query: 461 KPYKYPSPPPPV---YKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
             Y Y SPPPP    YKY SPPPP+Y       KYKSPPPPV+S
Sbjct: 75  --YHYSSPPPPPKKSYKYSSPPPPIY-------KYKSPPPPVHS 109

[86][TOP]
>UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK6_CHLRE
          Length = 738

 Score =  176 bits (446), Expect = 1e-42
 Identities = 102/191 (53%), Positives = 103/191 (53%), Gaps = 2/191 (1%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP--PPYKYPSPPPPVYKYKSPPPPV 181
           SPPPP   P   PSPPPP     SPPPP   P PPP  PP   PSPPPP      PPPP 
Sbjct: 234 SPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPP- 289

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
               SPPPP     SPPPP     SPPPPP      PSPPPP     SPPPP   PSPPP
Sbjct: 290 ---PSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPP-----SPPPPPP-PSPPP 340

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPP 541
           PP   P PPPP     SPPPP     SPPPP+  P   PSPPPP      P PP  SPPP
Sbjct: 341 PP-SPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP----PPPRPPPPSPPP 395

Query: 542 PVYKYKSPPPP 574
           P     SPPPP
Sbjct: 396 PSPPPPSPPPP 406

 Score =  174 bits (441), Expect = 5e-42
 Identities = 100/189 (52%), Positives = 101/189 (53%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   PSPPPP     SPPPP    SPPPP    PSPPPP     SPPPP   
Sbjct: 189 SPPPPSPPP---PSPPPP-----SPPPP----SPPPPSPPPPSPPPPSPPPPSPPPPSPP 236

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
             SPPPP     SPPPP     SPPPP   P   PSPPPP      PPPP + P PPPP 
Sbjct: 237 PPSPPPPSPPPPSPPPP-----SPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPS 291

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
              PSPPPP     SPPPP     SPPPP       PSPPPP      PPPP  SPPPP 
Sbjct: 292 PPPPSPPPPSPPPPSPPPP-----SPPPPPPPRPPPPSPPPP----SPPPPPPPSPPPP- 341

Query: 548 YKYKSPPPP 574
               SPPPP
Sbjct: 342 ---PSPPPP 347

 Score =  173 bits (439), Expect = 8e-42
 Identities = 98/189 (51%), Positives = 100/189 (52%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   PSPPPP      PPPP + P PPPP    PSPPPP     SPPPP   
Sbjct: 254 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPP--S 311

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
              PPPP     SPPPP      PPPPP  P   PSPPPP      PPP    PSPPPP 
Sbjct: 312 PPPPPPPRPPPPSPPPP----SPPPPPPPSPPPPPSPPPP------PPPRPPPPSPPPPS 361

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
              PSPPPP     SPPPP      PPPP + P   PSPPPP     SPPPP   PPPP 
Sbjct: 362 PPPPSPPPP-----SPPPPPPPSPPPPPPPRPP--PPSPPPP-----SPPPPSPPPPPP- 408

Query: 548 YKYKSPPPP 574
               SPPPP
Sbjct: 409 ---PSPPPP 414

 Score =  171 bits (433), Expect = 4e-41
 Identities = 96/187 (51%), Positives = 98/187 (52%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 193
           PPPP  P   PSPPPP     SPPP    PSPPPP    PSPPPP     SPPPP     
Sbjct: 195 PPPPSPP--PPSPPPPSPPPPSPPP----PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 248

Query: 194 SPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYK 373
           SPPPP     SPPPP      PPPPP  P   P  PPP    + PPP    PSPPPP   
Sbjct: 249 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPP 308

Query: 374 YPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYK 553
            PSPPPP      PPPP     SPPPP+  P   PSPPPP      PPPP   PPPP   
Sbjct: 309 PPSPPPP--PPPRPPPP-----SPPPPSPPPPPPPSPPPPP---SPPPPPPPRPPPPSPP 358

Query: 554 YKSPPPP 574
             SPPPP
Sbjct: 359 PPSPPPP 365

 Score =  171 bits (433), Expect = 4e-41
 Identities = 103/192 (53%), Positives = 105/192 (54%), Gaps = 3/192 (1%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           SPPPP   P   PSPPPP     SPPPP   P SPPPP    PSPPPP     SPPPP  
Sbjct: 199 SPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 255

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYP-SPPPPVYKYNSPPPPYKYP-SPP 358
              SPPPP     SPPPP      PPPPP+ P   P SPPPP     SPPPP   P SPP
Sbjct: 256 PPPSPPPP--PPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 313

Query: 359 PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP 538
           PPP   P PPPP     SPPPP      PPPP+  P   P PPPP     SPPPP  SPP
Sbjct: 314 PPP--PPRPPPPSPPPPSPPPPP-PPSPPPPPSPPPPPPPRPPPP-----SPPPP--SPP 363

Query: 539 PPVYKYKSPPPP 574
           PP     SPPPP
Sbjct: 364 PPSPPPPSPPPP 375

 Score =  171 bits (432), Expect = 5e-41
 Identities = 100/192 (52%), Positives = 100/192 (52%), Gaps = 3/192 (1%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           SPPPP   P   PSPPPP     SPPPP   P SPPPP    PSPPPP     SPPPP  
Sbjct: 209 SPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 265

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP- 361
               PPPP     SPPPP      PPPPP  P   PSPPPP     SPPPP   P PPP 
Sbjct: 266 PSPPPPPP----PSPPPPPPPRPPPPPPPSPPP--PSPPPPSPPPPSPPPPSPPPPPPPR 319

Query: 362 -PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP 538
            PP   P P PP     SPPPP     SPPPP       PSPPPP     SPPPP   PP
Sbjct: 320 PPPPSPPPPSPPPPPPPSPPPP----PSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPP 375

Query: 539 PPVYKYKSPPPP 574
           PP     SPPPP
Sbjct: 376 PP----PSPPPP 383

 Score =  167 bits (423), Expect = 6e-40
 Identities = 97/188 (51%), Positives = 99/188 (52%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP +P   P PPPP     SPPPP   P  PPPP   P PPPP      PPPP    
Sbjct: 277 PPPPPPRP---PPPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPPP----PRPPPPSPPP 327

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
            SPPPP     SPPPP     SPPPPP      PSPPPP     SPPP    PSPPPPP 
Sbjct: 328 PSPPPP--PPPSPPPP----PSPPPPPPPRPPPPSPPPPSPPPPSPPP----PSPPPPPP 377

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
             P PPPP      PPPP     SPPPP+  P   PSPPPP      P PP  SPPPP  
Sbjct: 378 PSPPPPPP----PRPPPPSPPPPSPPPPSPPPPPPPSPPPP----PPPRPPPPSPPPPSP 429

Query: 551 KYKSPPPP 574
              SPPPP
Sbjct: 430 PPPSPPPP 437

 Score =  152 bits (384), Expect = 2e-35
 Identities = 89/176 (50%), Positives = 92/176 (52%), Gaps = 4/176 (2%)
 Frame = +2

Query: 59  PVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 238
           P+ + N P PP     P PPP   PSPPPP     SPPPP     SPPPP     SPPPP
Sbjct: 181 PLSQANVPSPP----PPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 233

Query: 239 VYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVY----KY 406
                SPPPP   P   PSPPPP     SPPPP   PSPPPPP   P PPPP        
Sbjct: 234 SPPPPSPPPPSPPP---PSPPPPSPPPPSPPPP-PPPSPPPPPPPSPPPPPPPRPPPPPP 289

Query: 407 KSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            SPPPP     SPPPP+  P   P PPPP     SPPPP   PPPP     SPPPP
Sbjct: 290 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPP----PSPPPP 341

 Score =  151 bits (381), Expect = 4e-35
 Identities = 91/177 (51%), Positives = 92/177 (51%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPP   P   P PPPP     SPPPP   P PPP P   PSPPPP      PPPP   
Sbjct: 301 SPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPP--PPPRPPPPSPP 358

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
             SPPPP     SPPPP      PPPPP+ P   PSPPPP     SPPPP    SPPPPP
Sbjct: 359 PPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPP--PSPPPP-----SPPPP----SPPPPP 407

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP 538
              P PPPP      PPPP     SPPP        PSPPPP     SPPPP  SPP
Sbjct: 408 PPSPPPPPP----PRPPPP-----SPPP--------PSPPPP-----SPPPP--SPP 440

[87][TOP]
>UniRef100_B9IKD0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IKD0_POPTR
          Length = 190

 Score =  176 bits (446), Expect = 1e-42
 Identities = 89/153 (58%), Positives = 103/153 (67%), Gaps = 4/153 (2%)
 Frame = +2

Query: 128 YPSPPPPVY-KYKSPPPPVYKYKSPPPPVYKYK-SPPPPVYKYKSPPPPPKKPYKYPSPP 301
           Y SPPPP + K+KSPPPP +KYKSPPPP +K K SPPPPVY Y+SPPPP    +K P P 
Sbjct: 38  YKSPPPPFHNKHKSPPPPPHKYKSPPPPHHKCKYSPPPPVYTYRSPPPPTPMHHKSPPPS 97

Query: 302 PPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS-PPPPVYKYKSPPPPA-KKPYKY 475
           P ++K + PPPPY+Y SPPPPP   P PP   YKY S PPPP YKY SPPPP     +K+
Sbjct: 98  PHMFK-SPPPPPYRYISPPPPP---PHPPCHAYKYLSPPPPPSYKYASPPPPKHHHHHKH 153

Query: 476 PSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
              P P   Y SPPPP ++ P   Y Y SPPPP
Sbjct: 154 KWSPYPFITYMSPPPPHHNYPD--YHYSSPPPP 184

 Score =  172 bits (437), Expect = 1e-41
 Identities = 94/189 (49%), Positives = 108/189 (57%), Gaps = 4/189 (2%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYP-SPPPPVYKYKSPPPP 178
           YKSPPPP    +K P           PPPP+KY SPPPP +K   SPPPPVY Y+SPPPP
Sbjct: 38  YKSPPPPFHNKHKSP-----------PPPPHKYKSPPPPHHKCKYSPPPPVYTYRSPPPP 86

Query: 179 V-YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP--YKYP 349
               +KSPPP  + +KSPPPP Y+Y SPPPPP      P PP   YKY SPPPP  YKY 
Sbjct: 87  TPMHHKSPPPSPHMFKSPPPPPYRYISPPPPP------PHPPCHAYKYLSPPPPPSYKYA 140

Query: 350 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY 529
           SPPPP + +       +K+K  P P   Y SPPPP    + YP      Y Y SPP    
Sbjct: 141 SPPPPKHHHH------HKHKWSPYPFITYMSPPPP---HHNYPD-----YHYSSPP---- 182

Query: 530 SPPPPVYKY 556
            PPPP+  Y
Sbjct: 183 -PPPPIVAY 190

 Score =  163 bits (412), Expect = 1e-38
 Identities = 80/149 (53%), Positives = 95/149 (63%), Gaps = 10/149 (6%)
 Frame = +2

Query: 158 YKSPPPPVY-KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPP 334
           YKSPPPP + K+KSPPPP +KYKSPPPP +K K  PPPP   Y+ P PP P++  + PP 
Sbjct: 38  YKSPPPPFHNKHKSPPPPPHKYKSPPPPHHKCKYSPPPPVYTYRSPPPPTPMHHKSPPPS 97

Query: 335 PYKYPSPPPPPYKYPSPPPP-------VYKYKSPPPPV-YKYKSPPPPAKKPY-KYPSPP 487
           P+ + SPPPPPY+Y SPPPP        YKY SPPPP  YKY SPPPP    + K+   P
Sbjct: 98  PHMFKSPPPPPYRYISPPPPPPHPPCHAYKYLSPPPPPSYKYASPPPPKHHHHHKHKWSP 157

Query: 488 PPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            P   Y SPPPP ++ P   Y    PPPP
Sbjct: 158 YPFITYMSPPPPHHNYPDYHYS-SPPPPP 185

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 48/74 (64%), Positives = 54/74 (72%), Gaps = 5/74 (6%)
 Frame = +2

Query: 374 YPSPPPPVY-KYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV----YSPP 538
           Y SPPPP + K+KSPPPP +KYKSPPPP  K  KY SPPPPVY Y+SPPPP      SPP
Sbjct: 38  YKSPPPPFHNKHKSPPPPPHKYKSPPPPHHK-CKY-SPPPPVYTYRSPPPPTPMHHKSPP 95

Query: 539 PPVYKYKSPPPPVY 580
           P  + +KSPPPP Y
Sbjct: 96  PSPHMFKSPPPPPY 109

 Score = 58.5 bits (140), Expect = 4e-07
 Identities = 30/50 (60%), Positives = 34/50 (68%)
 Frame = +2

Query: 434 YKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           YKSPPPP    +K  SPPPP +KYKSPPPP +       KY SPPPPVY+
Sbjct: 38  YKSPPPPFHNKHK--SPPPPPHKYKSPPPPHHK-----CKY-SPPPPVYT 79

[88][TOP]
>UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum bicolor
            RepID=C5XPK9_SORBI
          Length = 613

 Score =  176 bits (445), Expect = 2e-42
 Identities = 105/219 (47%), Positives = 109/219 (49%), Gaps = 30/219 (13%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
            SPP PP  P   PSPPPP     SP PP   P PP PP   PSPPPP     SPPPP   
Sbjct: 406  SPPLPPPSPPP-PSPPPP-----SPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPP 459

Query: 188  YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
              SPPPP     SPPPP       PPPP  P   PSPPPP     SPPPP   PSPPPP 
Sbjct: 460  PPSPPPP---SPSPPPP------SPPPPSPPPPSPSPPPPSPPPPSPPPP--SPSPPPPY 508

Query: 368  Y------KYPSPPPPVY---------------KYKSPPPPVYKYKSPPPP---AKKPYKY 475
            Y      +Y SPPPP Y               +Y SPPPP   +  PPPP        +Y
Sbjct: 509  YEVSPEERYLSPPPPAYTEVPPPPYYEVSPEDRYLSPPPPPVHHDPPPPPYYEVSPEDRY 568

Query: 476  PSPPP------PVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
             SPPP      P Y Y SPPPP   P  PVY Y SPPPP
Sbjct: 569  LSPPPPSPASLPKYDYSSPPPPRALPKLPVYDYSSPPPP 607

 Score =  145 bits (365), Expect = 3e-33
 Identities = 92/178 (51%), Positives = 96/178 (53%), Gaps = 6/178 (3%)
 Frame = +2

Query: 68  KYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYK 247
           K+  P PP   PSPPPP     SPPPP     SPPPP     SPPPP     SPPPP   
Sbjct: 401 KFVLPSPPLPPPSPPPP-----SPPPPS---PSPPPP-----SPPPP-----SPPPP--- 439

Query: 248 YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 427
             SP PPP      PSPPPP     SPPPP   P  PPPP   PSPPPP     SPPPP 
Sbjct: 440 --SPSPPP------PSPPPP-----SPPPPSPPPPSPPPPS--PSPPPP-----SPPPP- 478

Query: 428 YKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY------KYKSPPPPVYS 583
               SPPPP+  P   PSPPPP     SPPPP  SPPPP Y      +Y SPPPP Y+
Sbjct: 479 ----SPPPPSPSPPP-PSPPPP-----SPPPPSPSPPPPYYEVSPEERYLSPPPPAYT 526

 Score =  140 bits (354), Expect = 6e-32
 Identities = 91/176 (51%), Positives = 94/176 (53%), Gaps = 18/176 (10%)
 Frame = +2

Query: 101 PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKP 280
           PSPP PP   PSPPPP     SPPPP     SPPPP     SPPPP     SPPPP    
Sbjct: 405 PSPPLPP---PSPPPP-----SPPPPS---PSPPPP-----SPPPP-----SPPPPS--- 440

Query: 281 YKYPSPPPPVYKYNSPPPPYK-YPSPPP--PPYKYPSPPPPVYKYKSPPPPVYKYKSP-P 448
              PSPPPP     SPPPP    PSPPP  PP   PSPPPP     SPPPP      P P
Sbjct: 441 ---PSPPPP-----SPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 492

Query: 449 PPAKKPYKYPSPPPPVY------KYKSPPPPVYS--PPPPVY------KYKSPPPP 574
           PP   P   PSPPPP Y      +Y SPPPP Y+  PPPP Y      +Y SPPPP
Sbjct: 493 PPPSPPPPSPSPPPPYYEVSPEERYLSPPPPAYTEVPPPPYYEVSPEDRYLSPPPP 548

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 39/80 (48%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPP-PVYKYKSPPPP 178
           Y SPPPP   P  +  PPPP Y+ +   P  +Y SPPP     PSP   P Y Y SPPPP
Sbjct: 542 YLSPPPP---PVHHDPPPPPYYEVS---PEDRYLSPPP-----PSPASLPKYDYSSPPPP 590

Query: 179 VYKYKSPPPPVYKYKSPPPP 238
                 P  PVY Y SPPPP
Sbjct: 591 ---RALPKLPVYDYSSPPPP 607

[89][TOP]
>UniRef100_UPI00001631D5 LRX2 (LEUCINE-RICH REPEAT/EXTENSIN 2); protein binding / structural
            constituent of cell wall n=1 Tax=Arabidopsis thaliana
            RepID=UPI00001631D5
          Length = 826

 Score =  174 bits (441), Expect = 5e-42
 Identities = 115/236 (48%), Positives = 123/236 (52%), Gaps = 46/236 (19%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYPSPPPP-------VYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYK 163
            K+ PPPP  P   PSPPPP       V  Y  PPP    P  PPPPY Y SPPPP     
Sbjct: 498  KAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPP---SP 554

Query: 164  SPPPPVYKYKSPPPPVY---KYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPP 334
            SPPPP Y Y SPPP V      +SPPPP  KY+  P P +    YPSP PP Y+Y S PP
Sbjct: 555  SPPPP-YIYSSPPPVVNCPPTTQSPPPP--KYEQTPSPRE---YYPSPSPPYYQYTSSPP 608

Query: 335  PYKY-----PSPPPPPYKY----PSPPPPVY----KYKSPPPPVY---KYKSPPPPAKKP 466
            P  Y     P PPPPP  Y    P PPPPVY        PPPPVY     +SPPPP   P
Sbjct: 609  PPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPP---P 665

Query: 467  YKY------PSPPPPVY---KYKSPPP-PVY-------SPPPPVYKY---KSPPPP 574
              Y      P PPPPVY     +SPPP PVY        PPPPVY     +SPPPP
Sbjct: 666  VYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPP 721

 Score =  172 bits (437), Expect = 1e-41
 Identities = 108/236 (45%), Positives = 118/236 (50%), Gaps = 45/236 (19%)
 Frame = +2

Query: 8    SPPPPPKK--PYKYPSPPPPVYKYN-----SPPPPYK--------YPSPPPPPYKYPSPP 142
            +PPPP  K  P    +PPPP  K +     +PPPP          YP PPPPP   PSPP
Sbjct: 455  TPPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPP 514

Query: 143  PPVYKYKS------PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPP 304
            PP  +         PPPP+      PPP Y Y SPPPP     SP PPP  PY Y SPPP
Sbjct: 515  PPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPP-----SPSPPP--PYIYSSPPP 567

Query: 305  PVY---KYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS--PPPPVYKYKSPPPPAKKPY 469
             V       SPPPP KY   P P   YPSP PP Y+Y S  PPP  Y  +SPPPP    Y
Sbjct: 568  VVNCPPTTQSPPPP-KYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTY 626

Query: 470  ---KYPSPPPPVY----KYKSPPPPVY-------SPPPPVY-----KYKSPPPPVY 580
               + P PPPPVY        PPPPVY        PPPPVY     +   PPPPVY
Sbjct: 627  YAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVY 682

 Score =  172 bits (435), Expect = 2e-41
 Identities = 116/249 (46%), Positives = 126/249 (50%), Gaps = 62/249 (24%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPV------YKYNSPPPPYKYP----SPPPPPYK--------YPS 136
            PPP P  PY Y SPPPP       Y Y+SPPP    P    SPPPP Y+        YPS
Sbjct: 536  PPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPS 595

Query: 137  PPPPVYKYKS--PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYP-----S 295
            P PP Y+Y S  PPP  Y  +SPPPP      PPP  Y  +SPPPPP  P  YP      
Sbjct: 596  PSPPYYQYTSSPPPPTYYATQSPPPP------PPPTYYAVQSPPPPP--PVYYPPVTASP 647

Query: 296  PPPPVY---KYNSPPPPYKYPS------PPPPPYKYP----SPPP-PVY----KYKSPPP 421
            PPPPVY      SPPPP  Y S      PPPPP  YP    SPPP PVY        PPP
Sbjct: 648  PPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPP 707

Query: 422  PVYKY---KSPPPPAKKPY----KYPSPPPPVY---KYKSPPPP----VYSPP-----PP 544
            PVY     +SPPPP+   Y    K P PP PVY     +SPPPP     Y PP      P
Sbjct: 708  PVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSP 767

Query: 545  VYKYKSPPP 571
              +Y+SPPP
Sbjct: 768  PPEYQSPPP 776

 Score =  151 bits (382), Expect = 3e-35
 Identities = 101/219 (46%), Positives = 111/219 (50%), Gaps = 31/219 (14%)
 Frame = +2

Query: 11   PPPPPKK---PYKYPSPPPPVYKYN-----SPPPPYKYPSP-----PPPPYKYPSPPPPV 151
            PPPPP     P    +PPPP  K +     +PPPP    SP     PPPP    SP    
Sbjct: 440  PPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKA 499

Query: 152  YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPP 331
            Y    PPPP  +Y+  PPP     SP    Y    PPPPP       SPPPP     SPP
Sbjct: 500  YP---PPPPPPEYEPSPPPPSSEMSPSVRAY----PPPPPL------SPPPP-----SPP 541

Query: 332  PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY---KYKSPPP------PAKKPYKYPSP 484
            PPY Y SPPPP    PSPPPP Y Y SPPP V      +SPPP      P+ + Y YPSP
Sbjct: 542  PPYIYSSPPPPS---PSPPPP-YIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREY-YPSP 596

Query: 485  PPPVYKY-KSPPPPVY----SPPPP----VYKYKSPPPP 574
             PP Y+Y  SPPPP Y    SPPPP     Y  +SPPPP
Sbjct: 597  SPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPP 635

 Score =  141 bits (355), Expect = 4e-32
 Identities = 103/255 (40%), Positives = 115/255 (45%), Gaps = 65/255 (25%)
 Frame = +2

Query: 5    KSPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYPS------------------PPP 115
            +SPPPP     P     YPSP PP Y+Y S PPP  Y +                  PPP
Sbjct: 576  QSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPP 635

Query: 116  PPYKYP-----SPPPPVY---KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP 271
            PP  YP      PPPPVY     +SPPPP   Y     PV +   PPPPVY       PP
Sbjct: 636  PPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYS----PVTQSPPPPPPVYYPPVTQSPP 691

Query: 272  KKPYKYP-----SPPPPVYKY---NSPPP--PYKYP----SPPPP-PYKYP----SPPPP 394
              P  YP      PPPPVY      SPPP  P  YP    SPPPP P  YP    SPPPP
Sbjct: 692  PSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPP 751

Query: 395  VYKYKSPPP------PVYKYKSPPPPA-----KKPYKYPSPPPPVYKYKSPPPPVY--SP 535
                +  PP      P  +Y+SPPP          + Y +P PP     S PPP Y  +P
Sbjct: 752  STPVEYHPPASPNQSPPPEYQSPPPKGCNDSPSNDHHYQTPTPP-----SLPPPYYEDTP 806

Query: 536  PPPV--YKYKSPPPP 574
             PP+    Y SPPPP
Sbjct: 807  LPPIRGVSYASPPPP 821

 Score =  128 bits (322), Expect = 3e-28
 Identities = 90/206 (43%), Positives = 101/206 (49%), Gaps = 28/206 (13%)
 Frame = +2

Query: 47  SPPPPVYKYNS-----PPPPYKYPSPPPPPYKYPSPPPPVYKYK-----SPPPPVYK--- 187
           SPPPP +K +      PPPP   PS    P    +PPPP  K       +PPPP  K   
Sbjct: 424 SPPPPSFKMSPTVRVLPPPP---PSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSP 480

Query: 188 -YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
            +++ PPP     SP    Y    PPPPP   Y+ PSPPPP    +S   P     PPPP
Sbjct: 481 SFRATPPPPSSKMSPSVKAY----PPPPPPPEYE-PSPPPP----SSEMSPSVRAYPPPP 531

Query: 365 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV------ 526
           P    SPPPP     SPPPP Y Y SPPPP+      PSPPPP Y Y SPPP V      
Sbjct: 532 PL---SPPPP-----SPPPP-YIYSSPPPPS------PSPPPP-YIYSSPPPVVNCPPTT 575

Query: 527 YSPPPPVYK--------YKSPPPPVY 580
            SPPPP Y+        Y SP PP Y
Sbjct: 576 QSPPPPKYEQTPSPREYYPSPSPPYY 601

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 60/168 (35%), Positives = 68/168 (40%), Gaps = 63/168 (37%)
 Frame = +2

Query: 5    KSPPPPP---KKPYKYPSPPPPVY----KYNSPPPPYKYP----SPPPPPYKY------P 133
            +SPPPPP       + P PPPPVY      + PP P  YP    SPPPPP  Y      P
Sbjct: 659  QSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSP 718

Query: 134  SPPPPVYK---YKSPPPPVYKY-----KSPPPPVY----------------KYKSPPP-- 235
             PP PVY     KSPPPP   Y     +SPPPP                  +Y+SPPP  
Sbjct: 719  PPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPPKG 778

Query: 236  --------------------PVYKYKSPPPPPKKPYKYPSPPPPVYKY 319
                                P Y   + P PP +   Y SPPPP   Y
Sbjct: 779  CNDSPSNDHHYQTPTPPSLPPPYYEDT-PLPPIRGVSYASPPPPSIPY 825

[90][TOP]
>UniRef100_O48809 F24O1.18 n=1 Tax=Arabidopsis thaliana RepID=O48809_ARATH
          Length = 786

 Score =  174 bits (441), Expect = 5e-42
 Identities = 115/236 (48%), Positives = 123/236 (52%), Gaps = 46/236 (19%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYPSPPPP-------VYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYK 163
            K+ PPPP  P   PSPPPP       V  Y  PPP    P  PPPPY Y SPPPP     
Sbjct: 458  KAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPP---SP 514

Query: 164  SPPPPVYKYKSPPPPVY---KYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPP 334
            SPPPP Y Y SPPP V      +SPPPP  KY+  P P +    YPSP PP Y+Y S PP
Sbjct: 515  SPPPP-YIYSSPPPVVNCPPTTQSPPPP--KYEQTPSPRE---YYPSPSPPYYQYTSSPP 568

Query: 335  PYKY-----PSPPPPPYKY----PSPPPPVY----KYKSPPPPVY---KYKSPPPPAKKP 466
            P  Y     P PPPPP  Y    P PPPPVY        PPPPVY     +SPPPP   P
Sbjct: 569  PPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPP---P 625

Query: 467  YKY------PSPPPPVY---KYKSPPP-PVY-------SPPPPVYKY---KSPPPP 574
              Y      P PPPPVY     +SPPP PVY        PPPPVY     +SPPPP
Sbjct: 626  VYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPP 681

 Score =  172 bits (437), Expect = 1e-41
 Identities = 108/236 (45%), Positives = 118/236 (50%), Gaps = 45/236 (19%)
 Frame = +2

Query: 8    SPPPPPKK--PYKYPSPPPPVYKYN-----SPPPPYK--------YPSPPPPPYKYPSPP 142
            +PPPP  K  P    +PPPP  K +     +PPPP          YP PPPPP   PSPP
Sbjct: 415  TPPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPP 474

Query: 143  PPVYKYKS------PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPP 304
            PP  +         PPPP+      PPP Y Y SPPPP     SP PPP  PY Y SPPP
Sbjct: 475  PPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPP-----SPSPPP--PYIYSSPPP 527

Query: 305  PVY---KYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS--PPPPVYKYKSPPPPAKKPY 469
             V       SPPPP KY   P P   YPSP PP Y+Y S  PPP  Y  +SPPPP    Y
Sbjct: 528  VVNCPPTTQSPPPP-KYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTY 586

Query: 470  ---KYPSPPPPVY----KYKSPPPPVY-------SPPPPVY-----KYKSPPPPVY 580
               + P PPPPVY        PPPPVY        PPPPVY     +   PPPPVY
Sbjct: 587  YAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVY 642

 Score =  172 bits (435), Expect = 2e-41
 Identities = 116/249 (46%), Positives = 126/249 (50%), Gaps = 62/249 (24%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPV------YKYNSPPPPYKYP----SPPPPPYK--------YPS 136
            PPP P  PY Y SPPPP       Y Y+SPPP    P    SPPPP Y+        YPS
Sbjct: 496  PPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPS 555

Query: 137  PPPPVYKYKS--PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYP-----S 295
            P PP Y+Y S  PPP  Y  +SPPPP      PPP  Y  +SPPPPP  P  YP      
Sbjct: 556  PSPPYYQYTSSPPPPTYYATQSPPPP------PPPTYYAVQSPPPPP--PVYYPPVTASP 607

Query: 296  PPPPVY---KYNSPPPPYKYPS------PPPPPYKYP----SPPP-PVY----KYKSPPP 421
            PPPPVY      SPPPP  Y S      PPPPP  YP    SPPP PVY        PPP
Sbjct: 608  PPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPP 667

Query: 422  PVYKY---KSPPPPAKKPY----KYPSPPPPVY---KYKSPPPP----VYSPP-----PP 544
            PVY     +SPPPP+   Y    K P PP PVY     +SPPPP     Y PP      P
Sbjct: 668  PVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSP 727

Query: 545  VYKYKSPPP 571
              +Y+SPPP
Sbjct: 728  PPEYQSPPP 736

 Score =  151 bits (382), Expect = 3e-35
 Identities = 101/219 (46%), Positives = 111/219 (50%), Gaps = 31/219 (14%)
 Frame = +2

Query: 11  PPPPPKK---PYKYPSPPPPVYKYN-----SPPPPYKYPSP-----PPPPYKYPSPPPPV 151
           PPPPP     P    +PPPP  K +     +PPPP    SP     PPPP    SP    
Sbjct: 400 PPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKA 459

Query: 152 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPP 331
           Y    PPPP  +Y+  PPP     SP    Y    PPPPP       SPPPP     SPP
Sbjct: 460 YP---PPPPPPEYEPSPPPPSSEMSPSVRAY----PPPPPL------SPPPP-----SPP 501

Query: 332 PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY---KYKSPPP------PAKKPYKYPSP 484
           PPY Y SPPPP    PSPPPP Y Y SPPP V      +SPPP      P+ + Y YPSP
Sbjct: 502 PPYIYSSPPPPS---PSPPPP-YIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREY-YPSP 556

Query: 485 PPPVYKY-KSPPPPVY----SPPPP----VYKYKSPPPP 574
            PP Y+Y  SPPPP Y    SPPPP     Y  +SPPPP
Sbjct: 557 SPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPP 595

 Score =  141 bits (355), Expect = 4e-32
 Identities = 103/255 (40%), Positives = 115/255 (45%), Gaps = 65/255 (25%)
 Frame = +2

Query: 5    KSPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYPS------------------PPP 115
            +SPPPP     P     YPSP PP Y+Y S PPP  Y +                  PPP
Sbjct: 536  QSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPP 595

Query: 116  PPYKYP-----SPPPPVY---KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP 271
            PP  YP      PPPPVY     +SPPPP   Y     PV +   PPPPVY       PP
Sbjct: 596  PPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYS----PVTQSPPPPPPVYYPPVTQSPP 651

Query: 272  KKPYKYP-----SPPPPVYKY---NSPPP--PYKYP----SPPPP-PYKYP----SPPPP 394
              P  YP      PPPPVY      SPPP  P  YP    SPPPP P  YP    SPPPP
Sbjct: 652  PSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPP 711

Query: 395  VYKYKSPPP------PVYKYKSPPPPA-----KKPYKYPSPPPPVYKYKSPPPPVY--SP 535
                +  PP      P  +Y+SPPP          + Y +P PP     S PPP Y  +P
Sbjct: 712  STPVEYHPPASPNQSPPPEYQSPPPKGCNDSPSNDHHYQTPTPP-----SLPPPYYEDTP 766

Query: 536  PPPV--YKYKSPPPP 574
             PP+    Y SPPPP
Sbjct: 767  LPPIRGVSYASPPPP 781

 Score =  128 bits (322), Expect = 3e-28
 Identities = 90/206 (43%), Positives = 101/206 (49%), Gaps = 28/206 (13%)
 Frame = +2

Query: 47  SPPPPVYKYNS-----PPPPYKYPSPPPPPYKYPSPPPPVYKYK-----SPPPPVYK--- 187
           SPPPP +K +      PPPP   PS    P    +PPPP  K       +PPPP  K   
Sbjct: 384 SPPPPSFKMSPTVRVLPPPP---PSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSP 440

Query: 188 -YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
            +++ PPP     SP    Y    PPPPP   Y+ PSPPPP    +S   P     PPPP
Sbjct: 441 SFRATPPPPSSKMSPSVKAY----PPPPPPPEYE-PSPPPP----SSEMSPSVRAYPPPP 491

Query: 365 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV------ 526
           P    SPPPP     SPPPP Y Y SPPPP+      PSPPPP Y Y SPPP V      
Sbjct: 492 PL---SPPPP-----SPPPP-YIYSSPPPPS------PSPPPP-YIYSSPPPVVNCPPTT 535

Query: 527 YSPPPPVYK--------YKSPPPPVY 580
            SPPPP Y+        Y SP PP Y
Sbjct: 536 QSPPPPKYEQTPSPREYYPSPSPPYY 561

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 60/168 (35%), Positives = 68/168 (40%), Gaps = 63/168 (37%)
 Frame = +2

Query: 5    KSPPPPP---KKPYKYPSPPPPVY----KYNSPPPPYKYP----SPPPPPYKY------P 133
            +SPPPPP       + P PPPPVY      + PP P  YP    SPPPPP  Y      P
Sbjct: 619  QSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSP 678

Query: 134  SPPPPVYK---YKSPPPPVYKY-----KSPPPPVY----------------KYKSPPP-- 235
             PP PVY     KSPPPP   Y     +SPPPP                  +Y+SPPP  
Sbjct: 679  PPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPPKG 738

Query: 236  --------------------PVYKYKSPPPPPKKPYKYPSPPPPVYKY 319
                                P Y   + P PP +   Y SPPPP   Y
Sbjct: 739  CNDSPSNDHHYQTPTPPSLPPPYYEDT-PLPPIRGVSYASPPPPSIPY 785

[91][TOP]
>UniRef100_Q94ES9 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES9_PEA
          Length = 183

 Score =  173 bits (439), Expect = 8e-42
 Identities = 91/170 (53%), Positives = 97/170 (57%), Gaps = 5/170 (2%)
 Frame = +2

Query: 35  YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVY 214
           Y Y SPPPPV+    P  P+ Y SPPPPP       PPV+ Y  P P    Y SPPPPV+
Sbjct: 30  YSYSSPPPPVHSPPPPKDPHHYSSPPPPP-------PPVHTYPHPHPV---YHSPPPPVH 79

Query: 215 KYKSPPPPVYKYKSPPPPPKKPYKYPS-PPPPVYKYNSPPPPYKYPSPPP----PPYKYP 379
            Y   P PVY    PP P KKPYKYPS PPPPV+ Y  P P Y  P PPP     PYKYP
Sbjct: 80  TYPH-PHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYP 138

Query: 380 SPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY 529
           SPPPP      P  P   Y SPPPPA       SPPPP Y YKSPPPP +
Sbjct: 139 SPPPPPAHTYPPHVPTPVYHSPPPPAY------SPPPPAYYYKSPPPPYH 182

 Score =  160 bits (404), Expect = 9e-38
 Identities = 84/156 (53%), Positives = 91/156 (58%), Gaps = 23/156 (14%)
 Frame = +2

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYK-SPPPPPKKP-YKYP-------SPPPPVYKYNSPPP 334
           Y Y SPPPPV+   SPPPP   +  S PPPP  P + YP       SPPPPV+ Y  P P
Sbjct: 30  YSYSSPPPPVH---SPPPPKDPHHYSSPPPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHP 86

Query: 335 PYKYPSPPPP---PYKYPS-PPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPP---- 490
            Y  P PP P   PYKYPS PPPPV+ Y  P P  +    PP P KKPYKYPSPPP    
Sbjct: 87  VYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAH 146

Query: 491 ------PVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
                 P   Y SPPPP YSPPPP Y YKSPPPP +
Sbjct: 147 TYPPHVPTPVYHSPPPPAYSPPPPAYYYKSPPPPYH 182

 Score =  108 bits (269), Expect = 4e-22
 Identities = 58/104 (55%), Positives = 59/104 (56%), Gaps = 15/104 (14%)
 Frame = +2

Query: 2   YKSPPPPP--KKPYKYPSPPPPVYKYNSPPPPYKYP-------SPPPP------PYKYPS 136
           Y SPPPP   KKPYKYPSPPPP        P + YP       SPPPP      PYKYPS
Sbjct: 88  YHSPPPPTPHKKPYKYPSPPPP--------PVHTYPHPHPVYHSPPPPPTPHKKPYKYPS 139

Query: 137 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 268
           PPPP      P  P   Y SPPPP Y   SPPPP Y YKSPPPP
Sbjct: 140 PPPPPAHTYPPHVPTPVYHSPPPPAY---SPPPPAYYYKSPPPP 180

[92][TOP]
>UniRef100_Q94ES8 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES8_PEA
          Length = 195

 Score =  173 bits (439), Expect = 8e-42
 Identities = 99/178 (55%), Positives = 104/178 (58%), Gaps = 14/178 (7%)
 Frame = +2

Query: 2   YKSPPPP------PKKPYKYPSPPPP-VYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKY 160
           Y SPPPP      PK PY Y SPPPP V+ Y  P P Y   SPPPP + YP P P    Y
Sbjct: 32  YSSPPPPVHSPPPPKDPYHYSSPPPPPVHTYPHPHPVYH--SPPPPVHTYPHPHPV---Y 86

Query: 161 KSPPPPV-----YKYKSPPPP-VYKYKSPPPPVYKYKSPPPPPKKPYKYPS-PPPPVYKY 319
            SPPPP      YKY SPPPP V+ Y  P P    Y SPPPP KKPYKY S PPPPV+ Y
Sbjct: 87  HSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPV---YHSPPPPHKKPYKYSSPPPPPVHTY 143

Query: 320 NSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPP 493
             P P Y   SPPPP + YP P P    Y SPPP       PP P KKPYKYPSPPPP
Sbjct: 144 PHPHPVYH--SPPPPVHTYPHPHP---VYHSPPP-------PPTPHKKPYKYPSPPPP 189

 Score =  157 bits (397), Expect = 6e-37
 Identities = 84/150 (56%), Positives = 91/150 (60%), Gaps = 19/150 (12%)
 Frame = +2

Query: 182 YKYKSPPPPVYKYKSPPPPV--YKYKSPPPPPKKPYKYP-----SPPPPVYKYNSPPPPY 340
           Y Y SPPPPV+   SPPPP   Y Y SPPPPP   Y +P     SPPPPV+ Y  P P Y
Sbjct: 30  YSYSSPPPPVH---SPPPPKDPYHYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVY 86

Query: 341 KYPSPPPP---PYKYPSPPPP-VYKYKSPPPPVYKYKSPPPPAKKPYKYPS-PPPPVYKY 505
             P PP P   PYKYPSPPPP V+ Y  P P    Y SPPPP KKPYKY S PPPPV+ Y
Sbjct: 87  HSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPV---YHSPPPPHKKPYKYSSPPPPPVHTY 143

Query: 506 KSPPPPVYSPPPPVYK-------YKSPPPP 574
             P P  +SPPPPV+        Y SPPPP
Sbjct: 144 PHPHPVYHSPPPPVHTYPHPHPVYHSPPPP 173

 Score =  156 bits (394), Expect = 1e-36
 Identities = 92/175 (52%), Positives = 100/175 (57%), Gaps = 24/175 (13%)
 Frame = +2

Query: 122 YKYPSPPPPVYKYKSPPPPV--YKYKSPPPP-VYKYKSPPPPVYKYKSPPPPPKKPYKYP 292
           Y Y SPPPPV+   SPPPP   Y Y SPPPP V+ Y  P P    Y SPPPP    + YP
Sbjct: 30  YSYSSPPPPVH---SPPPPKDPYHYSSPPPPPVHTYPHPHPV---YHSPPPPV---HTYP 80

Query: 293 SPPPPVYKYNSPPP------PYKYPSPPPPP-YKYPSPPPPVYKYKSPPPP---VYKYKS 442
            P P    Y+SPPP      PYKYPSPPPPP + YP P P    Y SPPPP    YKY S
Sbjct: 81  HPHP---VYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHP---VYHSPPPPHKKPYKYSS 134

Query: 443 PPPPAKKPYKYP-----SPPPPVYKYKSPPPPVYSPPPP------VYKYKSPPPP 574
           PPPP    Y +P     SPPPPV+ Y  P P  +SPPPP       YKY SPPPP
Sbjct: 135 PPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPP 189

 Score =  127 bits (320), Expect = 5e-28
 Identities = 73/126 (57%), Positives = 77/126 (61%), Gaps = 10/126 (7%)
 Frame = +2

Query: 2   YKSPPPPP--KKPYKYPS-PPPPVYKYNSPPPPYKYPSPPPP---PYKYPS-PPPPVYKY 160
           Y SPPPP   KKPYKYPS PPPPV+ Y  P P Y   SPPPP   PYKY S PPPPV+ Y
Sbjct: 86  YHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYH--SPPPPHKKPYKYSSPPPPPVHTY 143

Query: 161 KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP---KKPYKYPSPPPPVYKYNSPP 331
             P P    Y SPPPPV+ Y  P P    Y SPPPPP   KKPYKYPSPP        PP
Sbjct: 144 PHPHP---VYHSPPPPVHTYPHPHP---VYHSPPPPPTPHKKPYKYPSPP--------PP 189

Query: 332 PPYKYP 349
           P + YP
Sbjct: 190 PAHTYP 195

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +2

Query: 398 YKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPV 577
           Y Y SPPPPV+   SPPPP K PY Y SPPPP       P   Y  P PVY   SPPPPV
Sbjct: 30  YSYSSPPPPVH---SPPPP-KDPYHYSSPPPP-------PVHTYPHPHPVYH--SPPPPV 76

Query: 578 YS 583
           ++
Sbjct: 77  HT 78

[93][TOP]
>UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1
           Tax=Homo sapiens RepID=C9J4Y2_HUMAN
          Length = 253

 Score =  173 bits (439), Expect = 8e-42
 Identities = 96/190 (50%), Positives = 103/190 (54%), Gaps = 2/190 (1%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   PS PPP    +SPPPP   PSPPPPP   PSPPPP+    SPPPP    
Sbjct: 50  PPPPPSPPPPPPSQPPP--PPSSPPPPPPPPSPPPPPP--PSPPPPL---PSPPPPPPLP 102

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP      PPPP     SPPPPP  P   P  PPP    + PPPP   PSPPPPP 
Sbjct: 103 SPPPPPPLPSSPPPPP----PSPPPPPLSPPPPPPSPPPPPLLSPPPPP---PSPPPPPP 155

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKS-PPPPAKKPYKYP-SPPPPVYKYKSPPPPVYSPPPP 544
             P PPPP     SPPPP+      PPPP   P+  P SPPPP      PPPP   PPPP
Sbjct: 156 PSPPPPPP-----SPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPP 210

Query: 545 VYKYKSPPPP 574
           +    +P PP
Sbjct: 211 LPSPPAPSPP 220

 Score =  172 bits (436), Expect = 2e-41
 Identities = 97/189 (51%), Positives = 99/189 (52%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPPP  P   P PPPP     SPPPP   P PPPPP   PSP PP     SPPPP   
Sbjct: 6   SPPPPPPPPSSPPPPPPP-----SPPPPPPSPPPPPPP-SPPSPLPP-----SPPPPPPP 54

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
              PPPP    + PPPP     SPPPPP  P   P PPP      SPPPP   P PPPPP
Sbjct: 55  SPPPPPP---SQPPPPP----SSPPPPPPPPSPPPPPPP------SPPPPLPSP-PPPPP 100

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
              P PPPP+     PPPP      PPPP   P   PSPPPP     SPPPP  SPPPP 
Sbjct: 101 LPSPPPPPPLPSSPPPPPP----SPPPPPLSPPPPPPSPPPP--PLLSPPPPPPSPPPPP 154

Query: 548 YKYKSPPPP 574
                PPPP
Sbjct: 155 PPSPPPPPP 163

 Score =  168 bits (425), Expect = 3e-40
 Identities = 97/193 (50%), Positives = 100/193 (51%), Gaps = 5/193 (2%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   PSPPPP     SPP P   PSPPPPP   P PPPP      PPPP    
Sbjct: 19  PPPPPSPPPPPPSPPPPPPP--SPPSPLP-PSPPPPPPPSPPPPPP----SQPPPPPSSP 71

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
             PPPP     SPPPP     SPPPP   P  P   PSPPPP    +SPPPP   P PPP
Sbjct: 72  PPPPPP----PSPPPP--PPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPP 125

Query: 362 --PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
             PP   PSPPPP      PPPP      PPPP   P   PSPPPP+      PPP  SP
Sbjct: 126 LSPPPPPPSPPPPPLLSPPPPPP---SPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSP 182

Query: 536 PPPVYKYKSPPPP 574
           P P+     PPPP
Sbjct: 183 PHPLPPSPPPPPP 195

 Score =  168 bits (425), Expect = 3e-40
 Identities = 97/194 (50%), Positives = 99/194 (51%), Gaps = 6/194 (3%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   PSPPPP     SPPPP   PS PPPP   P PPP      SPPPP    
Sbjct: 82  PPPPPSPPPPLPSPPPPP-PLPSPPPPPPLPSSPPPPPPSPPPPP-----LSPPPPP--- 132

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKY------PS 352
            SPPPP      PPPP      PPPPP  P   PSPPPP+   +  PPP         PS
Sbjct: 133 PSPPPPPLLSPPPPPP---SPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPS 189

Query: 353 PPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYS 532
           PPPPP   P PPPP     SPPPP      P PPA  P   P PPPP      PPPP  S
Sbjct: 190 PPPPPPPSPPPPPP----PSPPPP----PLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPS 241

Query: 533 PPPPVYKYKSPPPP 574
           PPPP     SPPPP
Sbjct: 242 PPPP-----SPPPP 250

 Score =  166 bits (420), Expect = 1e-39
 Identities = 94/194 (48%), Positives = 98/194 (50%), Gaps = 6/194 (3%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P  PPP    + PPPP   PS PPPP   P PPPP      PPPP    
Sbjct: 34  PPPPPSPPSPLPPSPPPPPPPSPPPPP---PSQPPPPPSSPPPPPPPPSPPPPPPP---- 86

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPP--PPVYKYNSPPPPYKYPSPPPP 364
            SPPPP+    SPPPP     SPPPPP  P   P PP  PP    + PPPP   PSPPPP
Sbjct: 87  -SPPPPL---PSPPPPP-PLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPP---PSPPPP 138

Query: 365 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPP----PVYKYKSPPPPVYS 532
           P   P PPPP      PP P     SPPPP   P   P PPP    P+     PPPP   
Sbjct: 139 PLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSP 198

Query: 533 PPPPVYKYKSPPPP 574
           PPPP     SPPPP
Sbjct: 199 PPPPP---PSPPPP 209

 Score =  160 bits (405), Expect = 7e-38
 Identities = 98/191 (51%), Positives = 104/191 (54%), Gaps = 3/191 (1%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP    +SPPPP   PSPPPPP   PSPPPP       PPP    
Sbjct: 1   PPPPPSPP---PPPPPP----SSPPPPPP-PSPPPPP---PSPPPP-------PPP---- 38

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
            SPP P+     PPPP      PPPPP +P     PPPP    +SPPPP   PSPPPPP 
Sbjct: 39  -SPPSPLPPSPPPPPPP---SPPPPPPSQP-----PPPP----SSPPPPPPPPSPPPPP- 84

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPP---PAKKPYKYPSPPPPVYKYKSPPPPVYSPPP 541
             PSPPPP+    SPPPP      PPP   P+  P   PSPPPP     SPPPP  SPPP
Sbjct: 85  -PPSPPPPL---PSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPL---SPPPPPPSPPP 137

Query: 542 PVYKYKSPPPP 574
           P      PPPP
Sbjct: 138 PPLLSPPPPPP 148

 Score =  154 bits (389), Expect = 5e-36
 Identities = 92/183 (50%), Positives = 96/183 (52%), Gaps = 4/183 (2%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPP--PVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           SPPPPP  P   P PPP  P    + PPPP   PSPPPPP   P PPPP     SPPPP 
Sbjct: 103 SPPPPPPLPSSPPPPPPSPPPPPLSPPPPP---PSPPPPPLLSPPPPPP-----SPPPPP 154

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKS-PPPPPKKPYKYP-SPPPPVYKYNSPPPPYKYPSP 355
                PPPP     SPPPP+      PPPPP  P+  P SPPPP      PPPP   PSP
Sbjct: 155 PPSPPPPPP-----SPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPP---PSP 206

Query: 356 PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
           PPPP   PSPP P     SPP P      PPPP+      P PPPP     SPPPP   P
Sbjct: 207 PPPP--LPSPPAP-----SPPSPPLPPPPPPPPS------PPPPPP----PSPPPPSPPP 249

Query: 536 PPP 544
           PPP
Sbjct: 250 PPP 252

 Score =  140 bits (354), Expect = 6e-32
 Identities = 90/190 (47%), Positives = 93/190 (48%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 193
           PPPP      PSPPPP      PPPP    SPPPPP   P PPPP     SPPPP     
Sbjct: 1   PPPP------PSPPPP------PPPP---SSPPPPPPPSPPPPPP-----SPPPP----- 35

Query: 194 SPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYK 373
             PPP     SPP P+     PPPPP  P     PPPP    + PPPP   P PPPPP  
Sbjct: 36  --PPP-----SPPSPLPPSPPPPPPPSPP-----PPPP----SQPPPPPSSPPPPPPP-- 77

Query: 374 YPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYK 553
            PSPPPP       PPP     SPPPP   P     PPPP      PPPP+ S PPP   
Sbjct: 78  -PSPPPP-------PPP-----SPPPPLPSP-----PPPPPLPSPPPPPPLPSSPPP--P 117

Query: 554 YKSPPPPVYS 583
             SPPPP  S
Sbjct: 118 PPSPPPPPLS 127

[94][TOP]
>UniRef100_Q43504 Extensin-like protein Dif10 (Fragment) n=1 Tax=Solanum lycopersicum
           RepID=Q43504_SOLLC
          Length = 396

 Score =  173 bits (438), Expect = 1e-41
 Identities = 114/239 (47%), Positives = 114/239 (47%), Gaps = 48/239 (20%)
 Frame = +2

Query: 2   YKSPPP-------PPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKY 160
           YKSP P       P    Y Y SP P  Y Y SP P   Y SP P  Y Y SP P  Y Y
Sbjct: 157 YKSPAPSKNYYKAPTPSKYYYKSPAPSKYYYKSPSPAKYYKSPAPSKYYYKSPSPRKY-Y 215

Query: 161 KSPPPPV-YKYKSPPPPVYKYKSPPPPVYKYKSPPPPP--KKPYKYPSPPPPV------- 310
           KSP P   Y YKSP P  Y YKSP P  Y YKSP P    K P  Y SPPPP        
Sbjct: 216 KSPAPSKHYYYKSPSPSKY-YKSPAPYKY-YKSPAPQKYYKSPVYYKSPPPPTTYYEKSP 273

Query: 311 --YKYNSPPPPYK-----YPSPPPPPY---KYPSPPPPVY------KYKSPPPPVY---- 430
             YK   PPP YK     Y SPPP PY    Y SPPPP Y       YKSPPPP Y    
Sbjct: 274 SYYKSPPPPPYYKESTPYYKSPPPSPYYKESYKSPPPPPYYEEFTPSYKSPPPPPYYKES 333

Query: 431 --KYKSPPPPAK----KPYKYPSPPPPVYKYKSPPPPVYSPPPP-----VYKYKSPPPP 574
              YKSPPPP K     P  Y SPPPP   Y    P   SPPPP        Y SPPPP
Sbjct: 334 TPSYKSPPPPPKHYDQSPTSYNSPPPPPPAYYKQTPTYASPPPPQKYEQSVTYASPPPP 392

 Score =  158 bits (399), Expect = 3e-37
 Identities = 106/219 (48%), Positives = 109/219 (49%), Gaps = 28/219 (12%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYK--YPSPPPPPYKYPSPPPPVYKYKSPPP 175
           YKSP P  K+ YK     P V KY   P P K  Y +P P  Y Y SP P  Y YKSP P
Sbjct: 138 YKSPAPS-KQYYK----APVVVKYYKSPAPSKNYYKAPTPSKYYYKSPAPSKYYYKSPSP 192

Query: 176 PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
             Y YKSP P  Y YKSP P  Y YKSP P     YK PSP     KY   P PYKY   
Sbjct: 193 AKY-YKSPAPSKYYYKSPSPRKY-YKSPAPSKHYYYKSPSPS----KYYKSPAPYKYYKS 246

Query: 356 PPP------PYKYPSPPPPV--YK-----YKSPPPPVYK------YKSPPPPAKKPYKYP 478
           P P      P  Y SPPPP   Y+     YKSPPPP Y       YKSPPP       Y 
Sbjct: 247 PAPQKYYKSPVYYKSPPPPTTYYEKSPSYYKSPPPPPYYKESTPYYKSPPPSPYYKESYK 306

Query: 479 SPPPPVY------KYKSPPPP-VYSPPPPVYKYKSPPPP 574
           SPPPP Y       YKSPPPP  Y    P   YKSPPPP
Sbjct: 307 SPPPPPYYEEFTPSYKSPPPPPYYKESTP--SYKSPPPP 343

 Score =  145 bits (366), Expect = 2e-33
 Identities = 99/206 (48%), Positives = 103/206 (50%), Gaps = 19/206 (9%)
 Frame = +2

Query: 20  PPKKPYK-------YPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           P K  YK       Y SP P    Y +P     Y SP P    Y +P P  Y YKSP P 
Sbjct: 124 PSKHYYKAPVVAKYYKSPAPSKQYYKAPVVVKYYKSPAPSKNYYKAPTPSKYYYKSPAPS 183

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
            Y YKSP P  Y YKSP P  Y YKSP P  +K YK P+P    Y Y SP P   Y SP 
Sbjct: 184 KYYYKSPSPAKY-YKSPAPSKYYYKSPSP--RKYYKSPAPSKHYY-YKSPSPSKYYKSPA 239

Query: 359 PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY--- 529
           P  YKY   P P   YKSP   VY YKSPPPP     K PS       YKSPPPP Y   
Sbjct: 240 P--YKYYKSPAPQKYYKSP---VY-YKSPPPPTTYYEKSPS------YYKSPPPPPYYKE 287

Query: 530 ------SPPP-PVYK--YKSPPPPVY 580
                 SPPP P YK  YKSPPPP Y
Sbjct: 288 STPYYKSPPPSPYYKESYKSPPPPPY 313

 Score =  126 bits (316), Expect = 1e-27
 Identities = 87/199 (43%), Positives = 91/199 (45%), Gaps = 6/199 (3%)
 Frame = +2

Query: 2   YKSPPPPP---KKPY--KYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           YKS  P     K P   KY     P   Y   P   KY   P P  +Y   P  V  YKS
Sbjct: 100 YKSHAPSKHYYKAPIVTKYYRSHAPSKHYYKAPVVAKYYKSPAPSKQYYKAPVVVKYYKS 159

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKY 346
           P P    YK+P P  Y YKSP P  Y YKSP P       Y SP P  Y Y SP P   Y
Sbjct: 160 PAPSKNYYKAPTPSKYYYKSPAPSKYYYKSPSPAKY----YKSPAPSKYYYKSPSPRKYY 215

Query: 347 PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV 526
            SP P  + Y   P P   YKSP P  Y YKSP P  +K YK      PVY YKSPPPP 
Sbjct: 216 KSPAPSKHYYYKSPSPSKYYKSPAPYKY-YKSPAP--QKYYK-----SPVY-YKSPPPPT 266

Query: 527 -YSPPPPVYKYKSPPPPVY 580
            Y    P Y    PPPP Y
Sbjct: 267 TYYEKSPSYYKSPPPPPYY 285

 Score =  107 bits (268), Expect = 5e-22
 Identities = 67/141 (47%), Positives = 68/141 (48%), Gaps = 35/141 (24%)
 Frame = +2

Query: 2   YKSPPPPP----KKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY---KYPSPPPPVY-- 154
           YKSPPPP     K P  Y SPPPP Y   S P    Y SPPP PY    Y SPPPP Y  
Sbjct: 259 YKSPPPPTTYYEKSPSYYKSPPPPPYYKESTP---YYKSPPPSPYYKESYKSPPPPPYYE 315

Query: 155 ----KYKSPPPPVY------KYKSPPPPVYKYKS---------PPPPVY-----KYKSPP 262
                YKSPPPP Y       YKSPPPP   Y           PPPP Y      Y SPP
Sbjct: 316 EFTPSYKSPPPPPYYKESTPSYKSPPPPPKHYDQSPTSYNSPPPPPPAYYKQTPTYASPP 375

Query: 263 PPPK--KPYKYPSPPPPVYKY 319
           PP K  +   Y SPPPP   Y
Sbjct: 376 PPQKYEQSVTYASPPPPSTNY 396

 Score =  102 bits (255), Expect = 2e-20
 Identities = 97/292 (33%), Positives = 100/292 (34%), Gaps = 120/292 (41%)
 Frame = +2

Query: 65  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYK-----------YKSPPPPVYKYKSP---- 199
           Y Y S  P Y          K    P P YK           YKS  P  + YK+P    
Sbjct: 46  YDYTSHSPSYNSK-------KDHESPSPYYKKPEKHVPSHYYYKSHAPSKHYYKAPIVAK 98

Query: 200 --------------------------------PPPVYK-YKSPPPPVYKYKSP------- 259
                                            P V K YKSP P    YK+P       
Sbjct: 99  YYKSHAPSKHYYKAPIVTKYYRSHAPSKHYYKAPVVAKYYKSPAPSKQYYKAPVVVKYYK 158

Query: 260 -PPPPKKPYK--------YPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSP--------- 385
            P P K  YK        Y SP P  Y Y SP P   Y SP P  Y Y SP         
Sbjct: 159 SPAPSKNYYKAPTPSKYYYKSPAPSKYYYKSPSPAKYYKSPAPSKYYYKSPSPRKYYKSP 218

Query: 386 -------------------PPPVYKYKSPPP------PVYKYKSPPPPA----KKPYKYP 478
                              P P   YKSP P      PVY YKSPPPP     K P  Y 
Sbjct: 219 APSKHYYYKSPSPSKYYKSPAPYKYYKSPAPQKYYKSPVY-YKSPPPPTTYYEKSPSYYK 277

Query: 479 SPPPPVY------KYKSPPPPVY------SPPPPVY------KYKSPPPPVY 580
           SPPPP Y       YKSPPP  Y      SPPPP Y       YKSPPPP Y
Sbjct: 278 SPPPPPYYKESTPYYKSPPPSPYYKESYKSPPPPPYYEEFTPSYKSPPPPPY 329

[95][TOP]
>UniRef100_UPI0001A7B0C1 protein binding / structural constituent of cell wall n=1
            Tax=Arabidopsis thaliana RepID=UPI0001A7B0C1
          Length = 857

 Score =  172 bits (436), Expect = 2e-41
 Identities = 102/226 (45%), Positives = 113/226 (50%), Gaps = 36/226 (15%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSP------PPPYKY----PSPPPPPYKY------PSPP 142
            PPPPP   Y  PSPPPP     SP      PPP  Y    P PPPPP  Y      PS P
Sbjct: 635  PPPPPFTGYSPPSPPPPPPPTFSPSPSIPPPPPQTYSPFPPPPPPPPQTYYPPQPSPSQP 694

Query: 143  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPV-YKYKS--PP-------PPPKKPYKYP 292
            P    Y +PPP    Y   PP   ++ SPPPP  Y Y S  PP       PPP   Y Y 
Sbjct: 695  PQSPIYGTPPPSPIPYLPSPP---QFASPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYI 751

Query: 293  SPPPPVYKYNSPPPP-----YKYPSPPPPPYKYPSPPPPVYKYKSPP--PPVYKYKSPPP 451
            SPPPP    +SPPP       +Y  PPPP   Y  PPPP   + SPP  PPVY Y SPPP
Sbjct: 752  SPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPP 811

Query: 452  PAKKPYKYPSPPPPVYKYKSPPPPVYS---PPPPVYKYKSPPPPVY 580
            P    Y  P PPP ++  + PPPP+Y    PP P   Y SPPPP +
Sbjct: 812  PPAVHYS-PPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPPPF 856

 Score =  159 bits (401), Expect = 2e-37
 Identities = 91/190 (47%), Positives = 99/190 (52%), Gaps = 14/190 (7%)
 Frame = +2

Query: 2    YKSPPPPPKKPYK--YPSPPPPVYKYNSP----PPPYKYPSPPPPPYKYPSPPPPV-YKY 160
            Y   PPPP  P +  YP  P P     SP    PPP   P  P PP ++ SPPPP  Y Y
Sbjct: 670  YSPFPPPPPPPPQTYYPPQPSPSQPPQSPIYGTPPPSPIPYLPSPP-QFASPPPPAPYYY 728

Query: 161  KSP-PPPVYKYKSPPP-PVYKYKSPPPPVYKYKSPPPPPKKP-YKYPSPPPPVYKYNSPP 331
             SP PPP   Y  PPP P Y Y SPPPP     SPPP    P  +Y  PPPP   YN PP
Sbjct: 729  SSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPP 788

Query: 332  PP---YKYPSPPPPPYKYPS-PPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVY 499
            PP   +  P P PP Y Y S PPPP   Y  PPPPV  +  PPPP    Y+ P PP P  
Sbjct: 789  PPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPP--PIYEGPLPPIPGI 846

Query: 500  KYKSPPPPVY 529
             Y SPPPP +
Sbjct: 847  SYASPPPPPF 856

 Score =  158 bits (400), Expect = 3e-37
 Identities = 102/247 (41%), Positives = 113/247 (45%), Gaps = 58/247 (23%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPP-------PPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
            SPP  P  P+  PSPP       PPV     P PP   P+P  PP   PS P PVY   S
Sbjct: 577  SPPIIPSPPFTGPSPPSSPSPPLPPVI----PSPPIVGPTPSSPP---PSTPTPVY---S 626

Query: 167  PPPPVYKYKSPPPPVYKYKSP---PPPVYKYKS----PPPPPKKPYKYPSPPP------- 304
            PPPP   Y  PPPP   Y  P   PPP   +      PPPPP+    +P PPP       
Sbjct: 627  PPPPSTGYP-PPPPFTGYSPPSPPPPPPPTFSPSPSIPPPPPQTYSPFPPPPPPPPQTYY 685

Query: 305  ------------PVY---------------KYNSPPPP----YKYPSPPPPPYKYPSPPP 391
                        P+Y               ++ SPPPP    Y  P PPPPP+    PP 
Sbjct: 686  PPQPSPSQPPQSPIYGTPPPSPIPYLPSPPQFASPPPPAPYYYSSPQPPPPPHYSLPPPT 745

Query: 392  PVYKYKSPPPPVYKYKSPPPPAKKP-YKYPSPPPPVYKYKSPPPPV---YSPP--PPVYK 553
            P Y Y SPPPP     SPPP +  P  +Y  PPPP   Y  PPPP    YSPP  PPVY 
Sbjct: 746  PTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYY 805

Query: 554  YKSPPPP 574
            Y SPPPP
Sbjct: 806  YNSPPPP 812

 Score =  119 bits (299), Expect = 1e-25
 Identities = 64/133 (48%), Positives = 68/133 (51%), Gaps = 18/133 (13%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPPPVYKYNSPPPP---------------YKYPSPPPPPYKYPS 136
            Y SP PPP   Y  P PP P Y Y SPPPP                +Y  PPPP   Y  
Sbjct: 728  YSSPQPPPPPHYSLP-PPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNP 786

Query: 137  PPPPVYKYKSPPP--PVYKYKSPPPP-VYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPP 307
            PPPP   + SPPP  PVY Y SPPPP    Y  PPPPV  +  PPPPP   Y+ P PP P
Sbjct: 787  PPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPP--IYEGPLPPIP 844

Query: 308  VYKYNSPPPPYKY 346
               Y SPPPP  Y
Sbjct: 845  GISYASPPPPPFY 857

 Score =  118 bits (296), Expect = 3e-25
 Identities = 84/221 (38%), Positives = 94/221 (42%), Gaps = 32/221 (14%)
 Frame = +2

Query: 8    SPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
            SPP P   P  P   PSPP       SPP P    S P P    PSPP P     +PP P
Sbjct: 519  SPPSPSISPSPPITVPSPPSTPTSPGSPPSP----SSPTPSSPIPSPPTP----STPPTP 570

Query: 179  VYKYKSPPP----PVYKYKSPP-------PPVYKYKSPP--------PPPKKPYKYPSPP 301
            +   ++ PP    P +   SPP       PPV    SPP        PPP  P    SPP
Sbjct: 571  ISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIP--SPPIVGPTPSSPPPSTPTPVYSPP 628

Query: 302  PPVYKYNSPPP--PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKY 475
            PP   Y  PPP   Y  PSPPPPP    SP P +     PPP  Y    PPPP      Y
Sbjct: 629  PPSTGYPPPPPFTGYSPPSPPPPPPPTFSPSPSI---PPPPPQTYSPFPPPPPPPPQTYY 685

Query: 476  PSPPPPVYKYKSPPPPVYSPPPP--------VYKYKSPPPP 574
            P  P P    + P  P+Y  PPP          ++ SPPPP
Sbjct: 686  PPQPSPS---QPPQSPIYGTPPPSPIPYLPSPPQFASPPPP 723

 Score =  101 bits (252), Expect = 4e-20
 Identities = 82/224 (36%), Positives = 85/224 (37%), Gaps = 36/224 (16%)
 Frame = +2

Query: 8    SPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
            SPP P   P  P   PSPP       SPP P   PSPP      PSP  P     +P P 
Sbjct: 422  SPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTT---PSPGSPPTSPTTPTPG 478

Query: 179  VYKYKSPPPPVYKYKSPPPPVYKYK--SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPS 352
                 SP  P      P  P       SPP  P  P    SPP P     SP PP   PS
Sbjct: 479  GSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSI---SPSPPITVPS 535

Query: 353  PPPPPYKYPSPPPPVYKYKS-----------PPPPVYK-YKSPPPPAKKPYKYPSPP--- 487
            PP  P    SPP P     S           PP P+     SPP     P+  PSPP   
Sbjct: 536  PPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSP 595

Query: 488  ----PPVYKY--------KSPPP----PVYSPPPPVYKYKSPPP 571
                PPV            SPPP    PVYSPPPP   Y  PPP
Sbjct: 596  SPPLPPVIPSPPIVGPTPSSPPPSTPTPVYSPPPPSTGYPPPPP 639

[96][TOP]
>UniRef100_Q94ES6 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES6_PEA
          Length = 181

 Score =  172 bits (435), Expect = 2e-41
 Identities = 89/161 (55%), Positives = 95/161 (59%), Gaps = 6/161 (3%)
 Frame = +2

Query: 65  YKYNSPPPPYKYPSPPPPPYKYPSPPPP-VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPV 241
           Y Y+SPPPP   P PP  P+ Y SPPPP V+ Y  P P    Y SPPPPV+ Y   P PV
Sbjct: 30  YSYSSPPPPVHSPPPPKDPHHYSSPPPPPVHTYPHPHPV---YHSPPPPVHTYPH-PHPV 85

Query: 242 YKYKSPPPPPKKPYKYPS-PPPPVYKYNSPPPPYKYPSPPP----PPYKYPSPPPPVYKY 406
           Y    PP P KKPYKYPS PPPPV+ Y  P P Y  P PPP     PYKYPSPPPP    
Sbjct: 86  YHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHT 145

Query: 407 KSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY 529
             P  P   Y SPPPPA       SPPPP Y YKSPPPP +
Sbjct: 146 YPPHVPTPVYHSPPPPAY------SPPPPAYYYKSPPPPYH 180

 Score =  169 bits (427), Expect = 2e-40
 Identities = 85/154 (55%), Positives = 92/154 (59%), Gaps = 21/154 (13%)
 Frame = +2

Query: 182 YKYKSPPPPVYKYKSPPPPV--YKYKSPPPPPKKPYKYP-----SPPPPVYKYNSPPPPY 340
           Y Y SPPPPV+   SPPPP   + Y SPPPPP   Y +P     SPPPPV+ Y  P P Y
Sbjct: 30  YSYSSPPPPVH---SPPPPKDPHHYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVY 86

Query: 341 KYPSPPPP---PYKYPSPPPP-VYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYK-- 502
             P PP P   PYKYPSPPPP V+ Y  P P  +    PP P KKPYKYPSPPPP     
Sbjct: 87  HSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTY 146

Query: 503 --------YKSPPPPVYSPPPPVYKYKSPPPPVY 580
                   Y SPPPP YSPPPP Y YKSPPPP +
Sbjct: 147 PPHVPTPVYHSPPPPAYSPPPPAYYYKSPPPPYH 180

 Score =  114 bits (286), Expect = 4e-24
 Identities = 65/143 (45%), Positives = 70/143 (48%), Gaps = 28/143 (19%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYP-----SPPPPVYKY-------NSPPPP------YKYPSPPPPP-- 121
           Y SPPPPP   Y +P     SPPPPV+ Y       +SPPPP      YKYPSPPPPP  
Sbjct: 51  YSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVH 110

Query: 122 --------YKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKK 277
                   Y  P PPP      +P    YKY SPPPP      P  P   Y SPPPP   
Sbjct: 111 TYPHPHPVYHSPPPPP------TPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPAYS 164

Query: 278 PYKYPSPPPPVYKYNSPPPPYKY 346
           P      PPP Y Y SPPPPY +
Sbjct: 165 P------PPPAYYYKSPPPPYHH 181

[97][TOP]
>UniRef100_B9SSV0 Cleavage and polyadenylation specificity factor, putative n=1
           Tax=Ricinus communis RepID=B9SSV0_RICCO
          Length = 210

 Score =  171 bits (434), Expect = 3e-41
 Identities = 105/197 (53%), Positives = 110/197 (55%), Gaps = 4/197 (2%)
 Frame = +2

Query: 2   YKSPPPPPK---KPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPV-YKYKSP 169
           YK PPP  K    PY Y SPPPP     SPPPPY Y SPPP   KYPSP P + Y Y SP
Sbjct: 37  YKLPPPHKKVYYPPYYYKSPPPPS---PSPPPPYYYTSPPPRK-KYPSPSPLLPYHYHSP 92

Query: 170 PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP 349
           PPP    K    P Y Y SPPPP Y Y SPPPP        S PPP+Y Y+SPPPP K  
Sbjct: 93  PPP----KKSTHPTYYYNSPPPPYY-YNSPPPPS-------SSPPPLYYYDSPPPPKKSL 140

Query: 350 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY 529
           S   PPY Y SP P      SPPPP Y Y SP P  KK       P P+  YKSPPPP  
Sbjct: 141 S---PPYHYQSPSP---LSPSPPPPYY-YASPSPTPKK------SPSPLSYYKSPPPPSL 187

Query: 530 SPPPPVYKYKSPPPPVY 580
           SPP   Y Y+S PPP Y
Sbjct: 188 SPPLSYY-YQSLPPPNY 203

 Score =  157 bits (396), Expect = 8e-37
 Identities = 93/181 (51%), Positives = 99/181 (54%), Gaps = 18/181 (9%)
 Frame = +2

Query: 95  KYPSPPPPPYKYPSPPP------PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKS 256
           KYPS     Y+Y  PPP      P Y YKSPPPP     SPPPP Y Y SPPP   + K 
Sbjct: 31  KYPS-----YEYKLPPPHKKVYYPPYYYKSPPPPS---PSPPPPYY-YTSPPP---RKKY 78

Query: 257 PPPPPKKPYKYPSPPPP------VYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 418
           P P P  PY Y SPPPP       Y YNSPPPPY Y SPPPP     S PPP+Y Y SPP
Sbjct: 79  PSPSPLLPYHYHSPPPPKKSTHPTYYYNSPPPPYYYNSPPPPS----SSPPPLYYYDSPP 134

Query: 419 PPV------YKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
           PP       Y Y+SP P +      PSPPPP Y Y SP P     P P+  YKSPPPP  
Sbjct: 135 PPKKSLSPPYHYQSPSPLS------PSPPPPYY-YASPSPTPKKSPSPLSYYKSPPPPSL 187

Query: 581 S 583
           S
Sbjct: 188 S 188

[98][TOP]
>UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2B5_EHV86
          Length = 2332

 Score =  171 bits (432), Expect = 5e-41
 Identities = 98/198 (49%), Positives = 106/198 (53%), Gaps = 10/198 (5%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP--PPYKYPSPPPPVYKYKSPPPPVYK 187
            PPPP  P   P PPPP+     PPPP   PSPPP  PP   PSPPPP     +PPPP   
Sbjct: 1008 PPPPSPPP--PLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPP 1065

Query: 188  YK---SPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
                 SPPPP     +PPPP     SPPPP   P   PSPPPP+     PPPP   P  P
Sbjct: 1066 PSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP-PSPPPPL-----PPPPLPPPPLP 1119

Query: 359  PPPYKYPSPP--PPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPP---PP 523
            PPP   PSPP  PP     SPPPP     +PPPPA  P   PSPPPP     +PP   PP
Sbjct: 1120 PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPP 1179

Query: 524  VYSPPPPVYKYKSPPPPV 577
              SPPPP+    SPPPP+
Sbjct: 1180 PPSPPPPLPPPPSPPPPL 1197

 Score =  170 bits (430), Expect = 9e-41
 Identities = 93/197 (47%), Positives = 101/197 (51%), Gaps = 9/197 (4%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 193
            PPP   P   PSPPPP     +PPPP   P+PPP P   P P PP     SPPPP     
Sbjct: 729  PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPP 788

Query: 194  SPPPPVYKYK---SPPPPVYKYKSPPPP----PKKPYKYPSPPPPVYKYNSPPPPYKYPS 352
            +PPPP        SPPPP     +PPPP    P  P   P PPPP      PPPP   P 
Sbjct: 789  APPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPP 848

Query: 353  PPPPPYKYPSPP--PPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV 526
             PPPP   PSPP  PP     SPPPP     +PPPPA  P   PSPPPP     +PPPP 
Sbjct: 849  LPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPP- 907

Query: 527  YSPPPPVYKYKSPPPPV 577
             +PPPP     SPPPP+
Sbjct: 908  -NPPPP-----SPPPPL 918

 Score =  169 bits (429), Expect = 1e-40
 Identities = 97/213 (45%), Positives = 106/213 (49%), Gaps = 24/213 (11%)
 Frame = +2

Query: 8    SPPPPPKKPYKYP-SPPPPVYKYNSPPPPYKYPSPPP--PPYKYPSPPPPVYKYKSPPPP 178
            SPPPP   P   P SPPPP+     PPPP   PSPPP  PP   PSPPPP     +PPPP
Sbjct: 695  SPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPP 754

Query: 179  VYKYKSPP---------PPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPP 331
                  PP         PP     SPPPP     +PPPP   P   PSPPPP     +PP
Sbjct: 755  APPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPP 814

Query: 332  PPYKYPSPPPPPYKY---PSPPPPVYKYKSPPPPVYKYKSP---PPPAKKPYKYPSPPPP 493
            PP   P  PPPP      PSPPPP+     PPPP+    SP   PPP+  P   PSPPPP
Sbjct: 815  PPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPP 874

Query: 494  VYKYKSPPPPV------YSPPPPVYKYKSPPPP 574
                 +PPPP        SPPPP     +PPPP
Sbjct: 875  TPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPP 907

 Score =  169 bits (428), Expect = 1e-40
 Identities = 102/198 (51%), Positives = 108/198 (54%), Gaps = 9/198 (4%)
 Frame = +2

Query: 8   SPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           SPPPP     P  P   PSPPPP     SPPPP   PSPPPP    PSPPPP     SPP
Sbjct: 225 SPPPPSLSPSPPPPSLSPSPPPPSIS-PSPPPPSLSPSPPPPSVS-PSPPPPSLS-PSPP 281

Query: 173 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKY-PSPPPPVYKYNSPPPPYKYP 349
           PP     SPPPP      PP P     SP PPP+ P    PSPPPP     SPPPP   P
Sbjct: 282 PPSLS-PSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLS-PSPPPPSLSP 339

Query: 350 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSP---PPPAKKPYKYPSPPPPVYKYKSPPP 520
           SPPPP    PSPPPP +   SPPPP      P   PPP+  P   PSPPPP+    SPPP
Sbjct: 340 SPPPPSL-SPSPPPPSFS-PSPPPPSLSPSPPPATPPPSPPP---PSPPPPLPPPPSPPP 394

Query: 521 PVYSPPPPVYKYKSPPPP 574
           P+  PPPP+    SPPPP
Sbjct: 395 PL--PPPPIPPPPSPPPP 410

 Score =  169 bits (427), Expect = 2e-40
 Identities = 94/208 (45%), Positives = 104/208 (50%), Gaps = 21/208 (10%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYP---SPPPPVYKYKSPPPPVY 184
            PPP   P   PSPPPP     +PPPP   P  PPPP   P   SPPPP+     PPPP+ 
Sbjct: 969  PPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLP 1028

Query: 185  KYKSPPP------PVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKY 346
               SPPP      P     SPPPP     +PPPP   P   PSPPPP     +PPPP   
Sbjct: 1029 PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPP 1088

Query: 347  PSPPPPPYKY---PSPPPPVYKYKSPPPPVYKYKSP---PPPAKKPYKYPSPPPPVYKYK 508
            P  PPPP      PSPPPP+     PPPP+    SP   PPP+  P   PSPPPP     
Sbjct: 1089 PPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPP 1148

Query: 509  SPPPPV------YSPPPPVYKYKSPPPP 574
            +PPPP        SPPPP     +PPPP
Sbjct: 1149 APPPPAPPPSPPPSPPPPTPPPPAPPPP 1176

 Score =  168 bits (425), Expect = 3e-40
 Identities = 103/192 (53%), Positives = 108/192 (56%), Gaps = 2/192 (1%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SP PPP  P   PSPPPP     SPPPP   PSPPPP    PSPPPP     SPPPP   
Sbjct: 223 SPSPPP--PSLSPSPPPPSLS-PSPPPPSISPSPPPPSLS-PSPPPPSVS-PSPPPPSLS 277

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPP--PVYKYNSPPPPYKYPSPPP 361
             SPPPP     SPPPP     SPPP P  P   PSPPP  P     SPPPP   PSPPP
Sbjct: 278 -PSPPPPSLS-PSPPPPSLS-PSPPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPP 334

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPP 541
           P    PSPPPP     SPPPP +   SPPPP+  P   P+ PPP     SPPPP  SPPP
Sbjct: 335 PSLS-PSPPPPSLS-PSPPPPSFS-PSPPPPSLSPSPPPATPPP-----SPPPP--SPPP 384

Query: 542 PVYKYKSPPPPV 577
           P+    SPPPP+
Sbjct: 385 PLPPPPSPPPPL 396

 Score =  168 bits (425), Expect = 3e-40
 Identities = 91/194 (46%), Positives = 95/194 (48%), Gaps = 7/194 (3%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 193
            PPPP  P   P PPPP      PPPP   P  PPPP   P PPPP+     PPPP     
Sbjct: 909  PPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPS 968

Query: 194  SPP-PPVYKYKSPPPPVYKYKSPPPP----PKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
             PP PP     SPPPP     +PPPP    P  P   P PPPP      PPPP   P  P
Sbjct: 969  PPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLP 1028

Query: 359  PPPYKYPSPPP--PVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYS 532
            PPP   PSPPP  P     SPPPP     +PPPPA  P   PSPPPP     +PPPP   
Sbjct: 1029 PPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPP 1088

Query: 533  PPPPVYKYKSPPPP 574
            PP P      PPPP
Sbjct: 1089 PPSPPPPLPLPPPP 1102

 Score =  167 bits (424), Expect = 4e-40
 Identities = 95/208 (45%), Positives = 103/208 (49%), Gaps = 19/208 (9%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKY---PSPPPPVYKYKSPPPP 178
            +PPPP   P   PSPPPP     +PPPP   P  PPPP      PSPPPP+     PPPP
Sbjct: 1058 APPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPP 1117

Query: 179  VYKYKSPP------PPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY 340
            +    SPP      PP     SPPPP     +PPPP   P   PSPPPP     +PPPP 
Sbjct: 1118 LPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPN 1177

Query: 341  -KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPP 517
               PSPPPP    PSPPPP+     PPPPV    SPPP    P   P  PPP     SPP
Sbjct: 1178 PPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPP 1237

Query: 518  P---------PVYSPPPPVYKYKSPPPP 574
            P         P  SPPPP     +PPPP
Sbjct: 1238 PSPPPSPPPSPPPSPPPPTPPPPAPPPP 1265

 Score =  167 bits (422), Expect = 7e-40
 Identities = 97/193 (50%), Positives = 106/193 (54%), Gaps = 4/193 (2%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP--PPPYKYPSPPPPVYKYKSPPPPVY 184
            PPP P  P   P PPPP+     PPPP   PSPP  PPP   PSPPPP     +PPPP  
Sbjct: 937  PPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNP 996

Query: 185  KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP-- 358
               SPPPP+     PPPP     SPPPP   P   P PPPP+     PPPP   PSPP  
Sbjct: 997  PPPSPPPPL---PLPPPP-----SPPPPLPPP---PLPPPPL-----PPPPSPPPSPPPS 1040

Query: 359  PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP 538
            PPP   PSPPPP     +PPPP     +PPPPA  P   PSPPPP     +PPPP  +PP
Sbjct: 1041 PPPSPPPSPPPP-----TPPPP-----APPPPAPPPSPPPSPPPPTPPPPAPPPP--NPP 1088

Query: 539  PPVYKYKSPPPPV 577
            PP     SPPPP+
Sbjct: 1089 PP-----SPPPPL 1096

 Score =  166 bits (421), Expect = 9e-40
 Identities = 94/213 (44%), Positives = 103/213 (48%), Gaps = 24/213 (11%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYP---SPPPPVYKYKSPPPP 178
            +PPPP   P   PSPPPP     +PPPP   P  PPPP   P   SPPPP+     PPPP
Sbjct: 789  APPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPP 848

Query: 179  VYKYKSPPP------PVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY 340
            +    SPPP      P     SPPPP     +PPPP   P   PSPPPP     +PPPP 
Sbjct: 849  LPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPN 908

Query: 341  KYPSPPPPPYKYP---SPPPPVYKYKSPPPPVYKYKSPPP------------PAKKPYKY 475
              P  PPPP   P   SPPPP+     PPPPV    SPPP            P   P   
Sbjct: 909  PPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPS 968

Query: 476  PSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            P P PP     SPPPP  +PPPP     +PPPP
Sbjct: 969  PPPSPPPSPPPSPPPP--TPPPPAPPPPNPPPP 999

 Score =  166 bits (419), Expect = 2e-39
 Identities = 95/192 (49%), Positives = 104/192 (54%), Gaps = 6/192 (3%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 193
            PPP   P   PSPPPP     +PPPP   PSPPP P   P+PPPP     +PPPP     
Sbjct: 859  PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPP-PTPPPPAPPPPNPPPP----- 912

Query: 194  SPPPPVY--KYKSPPPPVYKYKSPPPP-PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP- 361
            SPPPP+      SPPPP+     PPPP P  P   P PPPP+     PPPP   PSPPP 
Sbjct: 913  SPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPS 972

Query: 362  -PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP 538
             PP   PSPPPP     +PPPP     SPPPP   P   PSPPPP+     PPPP+  PP
Sbjct: 973  PPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLP-PPPSPPPPLPPPPLPPPPLPPPP 1031

Query: 539  -PPVYKYKSPPP 571
             PP     SPPP
Sbjct: 1032 SPPPSPPPSPPP 1043

 Score =  165 bits (417), Expect = 3e-39
 Identities = 95/192 (49%), Positives = 104/192 (54%), Gaps = 5/192 (2%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 193
            PPP   P   PSPPPP     +PPPP   PSPPP P   P+PPPP     +PPPP     
Sbjct: 1037 PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPP-PTPPPPAPPPPNPPPP----- 1090

Query: 194  SPPPPVY--KYKSPPPPVYKYKSPPPP-PKKPYKYPSPPP--PVYKYNSPPPPYKYPSPP 358
            SPPPP+      SPPPP+     PPPP P  P   PSPPP  P     SPPPP   P  P
Sbjct: 1091 SPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAP 1150

Query: 359  PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP 538
            PPP   PSPPP      SPPPP     +PPPP   P   PSPPPP+    SPPPP+  PP
Sbjct: 1151 PPPAPPPSPPP------SPPPPTPPPPAPPPPNPPP---PSPPPPLPPPPSPPPPL--PP 1199

Query: 539  PPVYKYKSPPPP 574
            PP+     PPPP
Sbjct: 1200 PPLPPPPVPPPP 1211

 Score =  164 bits (416), Expect = 4e-39
 Identities = 94/213 (44%), Positives = 105/213 (49%), Gaps = 24/213 (11%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYP---SPPPPVYKYKSPPPP 178
            +PPPP   P   PSPPPP     +PPPP   P  PPPP   P   SPPPP+     PPPP
Sbjct: 880  APPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPP 939

Query: 179  VYKYKSPPP----PVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKY 346
            V    SPPP    P+     PPPP      PP PP  P   PSPPPP     +PPPP   
Sbjct: 940  VPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPP--PSPPPPTPPPPAPPPPNPP 997

Query: 347  PSPPPPPYKYP---SPPPPVYKYKSPPPPVYKYKSPPP---PAKKPYKYPSPPPPVYKYK 508
            P  PPPP   P   SPPPP+     PPPP+    SPPP   P+  P   PSPPPP     
Sbjct: 998  PPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPP 1057

Query: 509  SPPPPVY-----------SPPPPVYKYKSPPPP 574
            +PPPP             +PPPP     +PPPP
Sbjct: 1058 APPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP 1090

 Score =  163 bits (413), Expect = 8e-39
 Identities = 95/199 (47%), Positives = 106/199 (53%), Gaps = 11/199 (5%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKY----PSPPPPPYKYPSPPPPVYKYKSPPP-- 175
            PPP   P   PSPPPP     +PPPP       PSPPPP    P+PPPP     SPPP  
Sbjct: 768  PPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPL 827

Query: 176  PVYKYKSPPPPVYKYKSPPPPVYKYKSP---PPPPKKPYKYPSPPPPVYKYNSPPPPYKY 346
            P+    SPPPP+     PPPP+    SP   PPP   P   PSPPPP     +PPPP   
Sbjct: 828  PLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPP 887

Query: 347  PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV 526
            PSPPP P   P+PPPP     +PPPP     SPPPP   P   PSPPPP+     PPPPV
Sbjct: 888  PSPPPSP-PPPTPPPPAPPPPNPPPP-----SPPPPLPLP-PPPSPPPPLPPPPLPPPPV 940

Query: 527  YSP--PPPVYKYKSPPPPV 577
              P  PPP+     PPPP+
Sbjct: 941  PPPPSPPPLPPPPLPPPPL 959

 Score =  162 bits (411), Expect = 1e-38
 Identities = 93/196 (47%), Positives = 102/196 (52%), Gaps = 8/196 (4%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP--PPYKYPSPPPPVYKYKSPPPPV-- 181
            PPPP  P   P PPPP+     PPPP   PSPPP  PP   PSPPPP     +PPPP   
Sbjct: 830  PPPPSPPP--PLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPP 887

Query: 182  -YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
                 SPPPP     +PPPP       PPPP  P   P PPPP     SPPPP   P  P
Sbjct: 888  PSPPPSPPPPTPPPPAPPPP------NPPPPSPPPPLPLPPPP-----SPPPPLPPPPLP 936

Query: 359  PPPYKYPSPPPPVYKYKSPPPPVYKYKSP---PPPAKKPYKYPSPPPPVYKYKSPPPPVY 529
            PPP   P  PPP+     PPPP+    SP   PPP+  P   PSPPPP     +PPPP  
Sbjct: 937  PPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPP-- 994

Query: 530  SPPPPVYKYKSPPPPV 577
            +PPPP     SPPPP+
Sbjct: 995  NPPPP-----SPPPPL 1005

 Score =  162 bits (410), Expect = 2e-38
 Identities = 95/195 (48%), Positives = 102/195 (52%), Gaps = 7/195 (3%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 193
            PPPP  P   PSPPP      SPPPP   PSPPPP    P PPPP+     PPPP+    
Sbjct: 680  PPPPSPPPPSPSPPP------SPPPPSPPPSPPPPSPPPPLPPPPL-----PPPPLPPPS 728

Query: 194  SPP-PPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPP------PPVYKYNSPPPPYKYPS 352
             PP PP     SPPPP     +PPPP   P   PSPP      PP     SPPPP   P 
Sbjct: 729  PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPP 788

Query: 353  PPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYS 532
             PPPP   PSPPP      SPPPP     +PPPPA  P   P+PPPP     SPPPP+  
Sbjct: 789  APPPPTPPPSPPP------SPPPP-----TPPPPAPPP---PNPPPP-----SPPPPLPL 829

Query: 533  PPPPVYKYKSPPPPV 577
            PPPP     SPPPP+
Sbjct: 830  PPPP-----SPPPPL 839

 Score =  162 bits (410), Expect = 2e-38
 Identities = 90/189 (47%), Positives = 95/189 (50%), Gaps = 2/189 (1%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP-PPVYK 187
            P PPP  P   PSPPPP     SPPP    PSPPPP    P PPPP+     PP PP   
Sbjct: 683  PSPPPPSPSPPPSPPPP-----SPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSP 737

Query: 188  YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
              SPPPP     +PPPP      PP PP  P   P P PP       PPP   P P PPP
Sbjct: 738  PPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPP 797

Query: 368  YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP-PP 544
               PSPPPP     +PPPP     SPPPP   P   PSPPPP+     PPPP+  PP PP
Sbjct: 798  SPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLP-PPPSPPPPLPPPPLPPPPLPPPPSPP 856

Query: 545  VYKYKSPPP 571
                 SPPP
Sbjct: 857  PSPPPSPPP 865

 Score =  162 bits (410), Expect = 2e-38
 Identities = 94/210 (44%), Positives = 101/210 (48%), Gaps = 23/210 (10%)
 Frame = +2

Query: 14   PPPPKK------PYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKY---PSPPPPVYKYKS 166
            PPPP        P   PSPPPP     +PPPP   P  PPPP      PSPPPP+     
Sbjct: 785  PPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPL 844

Query: 167  PPPPVYKYKSPP------PPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSP 328
            PPPP+    SPP      PP     SPPPP     +PPPP   P   PSPPPP     +P
Sbjct: 845  PPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAP 904

Query: 329  PPPYKYPSPPPPPYKY---PSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVY 499
            PPP   P  PPPP      PSPPPP+     PPPPV    SPPP    P   P  PPP  
Sbjct: 905  PPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPS 964

Query: 500  KYKSPPP-----PVYSPPPPVYKYKSPPPP 574
               SPPP     P  SPPPP     +PPPP
Sbjct: 965  PPPSPPPSPPPSPPPSPPPPTPPPPAPPPP 994

 Score =  162 bits (410), Expect = 2e-38
 Identities = 94/196 (47%), Positives = 102/196 (52%), Gaps = 9/196 (4%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP--PPYKYPSPPPPVYKYKSPPPPV-- 181
            PPPP  P   P PPPP+     PPPP   PSPPP  PP   PSPPPP     +PPPP   
Sbjct: 1099 PPPPSPPP--PLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPP 1156

Query: 182  -YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
                 SPPPP     +PPPP     SPPPP   P   PSPPPP+     PPPP   P  P
Sbjct: 1157 PSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPP---PSPPPPL-----PPPPLPPPPVP 1208

Query: 359  PPPYKYPSPPPPVYKYKSPPPPVYKYKSP--PPPAKKPYKYPSPPPPVYKYKSPPPPV-- 526
            PPP   P PPPP+     PPPP      P  PPP+  P   PSPPPP     +PPPP   
Sbjct: 1209 PPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPP 1268

Query: 527  YSPPPPVYKYKSPPPP 574
             SPPPP     +PPPP
Sbjct: 1269 PSPPPP-----TPPPP 1279

 Score =  161 bits (408), Expect = 3e-38
 Identities = 89/179 (49%), Positives = 98/179 (54%), Gaps = 1/179 (0%)
 Frame = +2

Query: 44   PSPPPPVYKYNSPPPPYKYPSP-PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKY 220
            PSPPPP     SPPPP   P P PPPP   PSPPPP     SPPPP+     PPPP+   
Sbjct: 678  PSPPPP-----SPPPPSPSPPPSPPPPSPPPSPPPP-----SPPPPL-----PPPPL--- 719

Query: 221  KSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVY 400
              PPPP+     PP PP  P   PSPPPP     +PPPP   P+PPP P   P P PP  
Sbjct: 720  --PPPPLPPPSPPPSPPPSPP--PSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPS 775

Query: 401  KYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPV 577
               SPPPP     +PPPP   P   PSPPPP     +PPPP  +PPPP     SPPPP+
Sbjct: 776  PPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPP--NPPPP-----SPPPPL 827

 Score =  161 bits (408), Expect = 3e-38
 Identities = 93/195 (47%), Positives = 101/195 (51%), Gaps = 5/195 (2%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
            SPPPP   P   P P PP     SPPPP   P PP PP   P PP P      PPPP   
Sbjct: 1048 SPPPPTPPPPAPPPPAPPPSPPPSPPPP--TPPPPAPPPPNPPPPSPPPPLPLPPPP--- 1102

Query: 188  YKSPPPPVYKYKSPPPPVYKYKSP---PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
              SPPPP+     PPPP+    SP   PPP   P   PSPPPP     +PPPP   PSPP
Sbjct: 1103 --SPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPP 1160

Query: 359  PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP- 535
            P P   P+PPPP     +PPPP     SPPPP   P   PSPPPP+     PPPPV  P 
Sbjct: 1161 PSP-PPPTPPPPAPPPPNPPPP-----SPPPPLPPP---PSPPPPLPPPPLPPPPVPPPP 1211

Query: 536  -PPPVYKYKSPPPPV 577
             PPP+     PPPP+
Sbjct: 1212 SPPPLPPPPLPPPPL 1226

 Score =  160 bits (406), Expect = 5e-38
 Identities = 92/190 (48%), Positives = 97/190 (51%), Gaps = 1/190 (0%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            P PPP  P   P P PP     SPPPP   P  PPPP   PSPPP      SPPPP    
Sbjct: 848  PLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPP------SPPPPTPPP 901

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             +PPPP     SPPPP+     P PPP  P   P PPPPV     PPPP   P PPPP  
Sbjct: 902  PAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPP-PLPPPPV-----PPPPSPPPLPPPPLP 955

Query: 371  KYPSPPPPVYKYKSPP-PPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
              P PPPP      PP PP     SPPPP   P   P+PPPP     SPPPP+  PPPP 
Sbjct: 956  PPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPP---PAPPPPNPPPPSPPPPLPLPPPP- 1011

Query: 548  YKYKSPPPPV 577
                SPPPP+
Sbjct: 1012 ----SPPPPL 1017

 Score =  160 bits (406), Expect = 5e-38
 Identities = 92/192 (47%), Positives = 101/192 (52%), Gaps = 6/192 (3%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP--PVYK 187
            PPPP  P   P PP P       PPP   PSPPPP    P+PPPP     SPPP  P+  
Sbjct: 950  PPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPP 1009

Query: 188  YKSPPPPVYKYKSPPPPVYKYKSP---PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
              SPPPP+     PPPP+    SP   PPP   P   PSPPPP     +PPPP   PSPP
Sbjct: 1010 PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPP 1069

Query: 359  PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP 538
            P P   P+PPPP     +PPPP     SPPPP   P   PSPPPP+     PPPP+  PP
Sbjct: 1070 PSP-PPPTPPPPAPPPPNPPPP-----SPPPPLPLP-PPPSPPPPLPPPPLPPPPLPPPP 1122

Query: 539  -PPVYKYKSPPP 571
             PP     SPPP
Sbjct: 1123 SPPPSPPPSPPP 1134

 Score =  159 bits (403), Expect = 1e-37
 Identities = 94/195 (48%), Positives = 99/195 (50%), Gaps = 8/195 (4%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 193
            PPPP  P   PSPPP      SPPPP   PSPPPP    P PPPPV     PPP      
Sbjct: 1536 PPPPSPPPPSPSPPP------SPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSP 1589

Query: 194  SPPPPVYKYKSPPPPVYKYKSP-PPPPKKPYKYPSPP--PPVYKYNSPPPPYKYPSPPP- 361
             P PP     SPPPP+     P PPPP  P   P PP  PP+     PPPP   PSPPP 
Sbjct: 1590 PPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPS 1649

Query: 362  -PPYKYPSPPP---PVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY 529
             PP   PSPPP   P+    +PPPP     SPP PA  P   PSPPPP     S  PP  
Sbjct: 1650 PPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPP---PSPPPPNAPSPSSMPPSQ 1706

Query: 530  SPPPPVYKYKSPPPP 574
            SPPPP+     PPPP
Sbjct: 1707 SPPPPLPPPPLPPPP 1721

 Score =  159 bits (401), Expect = 2e-37
 Identities = 88/179 (49%), Positives = 97/179 (54%), Gaps = 1/179 (0%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 193
            PPP   P   PSPPPP     +PPPP   PSPPP P   P+PPPP     +PPPP     
Sbjct: 1128 PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPP-PTPPPPAPPPPNPPPP----- 1181

Query: 194  SPPPPVYKYKSPPPPVYKYKSPPPP-PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
            SPPPP+    SPPPP+     PPPP P  P   P PPPP+     PPPP   PSPPP P 
Sbjct: 1182 SPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPP 1241

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
              P P PP     SPPPP     +PPPPA  P   P+PPP      SPPPP   PPPP+
Sbjct: 1242 PSPPPSPP----PSPPPP-----TPPPPAPPP---PTPPP------SPPPPTPPPPPPL 1282

 Score =  158 bits (399), Expect = 3e-37
 Identities = 93/207 (44%), Positives = 99/207 (47%), Gaps = 19/207 (9%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP---- 178
            PP PP  P   P P PP     SP P    P+PPPP    PSPP P     SPPPP    
Sbjct: 1639 PPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPS 1698

Query: 179  ---VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP 349
               +   +SPPPP+     PPPP+    +PPPP   P   PSPPPP     SPPPP   P
Sbjct: 1699 PSSMPPSQSPPPPL-----PPPPLPPPPNPPPPLPPPPSPPSPPPP-----SPPPPSPPP 1748

Query: 350  SP--------PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK----KPYKYPSPPPP 493
            SP        PPPP   PSPPPP     SPPPP      PPP A      P   PSPPPP
Sbjct: 1749 SPPPSPPPPSPPPPSLSPSPPPPSTS-PSPPPPSASPSPPPPSASPSPPPPSLSPSPPPP 1807

Query: 494  VYKYKSPPPPVYSPPPPVYKYKSPPPP 574
                  PPPP    PPP     SPPPP
Sbjct: 1808 STSPSPPPPPASPSPPPPSASPSPPPP 1834

 Score =  157 bits (396), Expect = 8e-37
 Identities = 100/213 (46%), Positives = 106/213 (49%), Gaps = 21/213 (9%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPP-PPYKYPSPPPPPYKYPS-------PPPPVYKYK 163
            SPPP P      P+PPPP     SPP P    PSPPPP    PS       PPPP+    
Sbjct: 1657 SPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPL---- 1712

Query: 164  SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYK 343
             PPPP+    +PPPP+    SPP P     SPPPP   P   PSPPPP     SPPPP  
Sbjct: 1713 -PPPPLPPPPNPPPPLPPPPSPPSP--PPPSPPPPSPPPSPPPSPPPP-----SPPPPSL 1764

Query: 344  YPSP--------PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSP----P 487
             PSP        PPPP   PSPPPP     SPPPP     SPPPP+  P   P P    P
Sbjct: 1765 SPSPPPPSTSPSPPPPSASPSPPPPSAS-PSPPPPSLS-PSPPPPSTSPSPPPPPASPSP 1822

Query: 488  PPVYKYKSPPPPVYSP-PPPVYKYKSPPPPVYS 583
            PP     SPPPP  SP PPP     SPPPP  S
Sbjct: 1823 PPPSASPSPPPPSSSPSPPPPSSSPSPPPPSLS 1855

 Score =  155 bits (393), Expect = 2e-36
 Identities = 95/204 (46%), Positives = 100/204 (49%), Gaps = 16/204 (7%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP----- 175
            P PPP  P   P PPPP     SPPPP   P  PPPP   P PPPP+    SPPP     
Sbjct: 1595 PSPPPSPPPPLPLPPPP-----SPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPS 1649

Query: 176  -PVYKYKSPPP---PVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYK 343
             P     SPPP   P+    +PPPP     SPP P   P   PSPPPP     S  PP +
Sbjct: 1650 PPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPP---PSPPPPNAPSPSSMPPSQ 1706

Query: 344  YPSPPPPPYKYPSPP------PPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKY 505
             P PP PP   P PP      PP     SPPPP     SPPPP+  P   PSPPPP    
Sbjct: 1707 SPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPP-----SPPPPSPPPSPPPSPPPP---- 1757

Query: 506  KSPPPPVYSP-PPPVYKYKSPPPP 574
             SPPPP  SP PPP     SPPPP
Sbjct: 1758 -SPPPPSLSPSPPPPSTSPSPPPP 1780

 Score =  155 bits (393), Expect = 2e-36
 Identities = 100/190 (52%), Positives = 103/190 (54%), Gaps = 3/190 (1%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPP--PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
            PPPP  P   P+PPPP+    SPP  PP   P P PPP   PSPPPP     SPPPP   
Sbjct: 1713 PPPPLPPP--PNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPP-----SPPPPSLS 1765

Query: 188  YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
              SPPPP     SPPPP     SP PPP  P   PSPPPP     SPPPP   PSPPPPP
Sbjct: 1766 -PSPPPPSTS-PSPPPP---SASPSPPP--PSASPSPPPPSLS-PSPPPPSTSPSPPPPP 1817

Query: 368  YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPP-PPVYSPPPP 544
               PSPPPP     SPPPP     SPPPP+      PSPPPP      PP PP  SPPPP
Sbjct: 1818 AS-PSPPPPSAS-PSPPPP-SSSPSPPPPSSS----PSPPPPSLSPSPPPSPPPSSPPPP 1870

Query: 545  VYKYKSPPPP 574
                 SPP P
Sbjct: 1871 -----SPPTP 1875

 Score =  154 bits (390), Expect = 4e-36
 Identities = 100/199 (50%), Positives = 102/199 (51%), Gaps = 10/199 (5%)
 Frame = +2

Query: 8    SPPPP----PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 175
            SPPPP    P       SPPPP+     PPPP   P  PPPP   PSPPPP     SPPP
Sbjct: 1690 SPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSP-PSPPPPSPPPPSPPP 1748

Query: 176  PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
                  SPPPP     SPPPP     SP PPP  P   PSPPPP     SPPPP   PSP
Sbjct: 1749 S--PPPSPPPP-----SPPPPSL---SPSPPP--PSTSPSPPPPSAS-PSPPPPSASPSP 1795

Query: 356  PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKK-----PYKYPSPPPPVYKYKSPPP 520
            PPP    PSPPPP      PPPP     SPPPP+       P   PSPPPP     SPPP
Sbjct: 1796 PPPSLS-PSPPPPSTSPSPPPPPA--SPSPPPPSASPSPPPPSSSPSPPPP-SSSPSPPP 1851

Query: 521  PVYSP-PPPVYKYKSPPPP 574
            P  SP PPP     SPPPP
Sbjct: 1852 PSLSPSPPPSPPPSSPPPP 1870

 Score =  151 bits (382), Expect = 3e-35
 Identities = 88/182 (48%), Positives = 92/182 (50%), Gaps = 5/182 (2%)
 Frame = +2

Query: 44   PSPPPPVYKYNSPPPPYKYPSP-PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKY 220
            PSPPPP     SPPPP   P P PPPP   PSPPPP      PPPPV     PPP     
Sbjct: 1534 PSPPPP-----SPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPP----- 1583

Query: 221  KSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVY 400
             SPPP       P PPP  P   P PPPP     SPPPP   P  PPPP   P PPPP+ 
Sbjct: 1584 -SPPPSPPPSPPPSPPPSPPPPLPLPPPP-----SPPPPLPPPPVPPPPSPPPLPPPPLP 1637

Query: 401  KYKSPPP-PVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPP---PPVYSPPPPVYKYKSPP 568
               SPPP P       PPP+  P   P PPPP     SPP   PP+ +PPPP     SPP
Sbjct: 1638 PPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPP-----SPP 1692

Query: 569  PP 574
            PP
Sbjct: 1693 PP 1694

 Score =  150 bits (378), Expect = 9e-35
 Identities = 96/212 (45%), Positives = 99/212 (46%), Gaps = 21/212 (9%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP-PPYKYPSPPPPVYKYKSPPPPVYK 187
            PPP P  P   PSPPP        PPP   PSPPP PP   P PPPP      PPPPV  
Sbjct: 1572 PPPVPPSPLPPPSPPPS-------PPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPP 1624

Query: 188  YKSPPPPVYKYKSPPPPVYKYKSPPP-PPKKPYKYPSPPPPVYKYNSPPPPY------KY 346
              SPPP       PPPP+    SPPP PP  P   P P PP      PPPP         
Sbjct: 1625 PPSPPP------LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPL 1678

Query: 347  PSPPPPPYKYPSPPPPVYKYKS------------PPPPVYKYKSPPPPAKKPYKYPSPPP 490
            PSPP P    PSPPPP     S            PPPP+    +PPPP   P   PSPPP
Sbjct: 1679 PSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPP 1738

Query: 491  PVYKYKSPPP-PVYSPPPPVYKYKSPPPPVYS 583
            P     SPPP P  SPPPP     SPPPP  S
Sbjct: 1739 PSPPPPSPPPSPPPSPPPP-----SPPPPSLS 1765

 Score =  149 bits (375), Expect = 2e-34
 Identities = 96/193 (49%), Positives = 100/193 (51%), Gaps = 13/193 (6%)
 Frame = +2

Query: 8   SPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP---PYKYPSPPPPVYKYK 163
           SPPPP     P  P   PSPPPP     SPPPP   PSPPPP   P   PSPPPP     
Sbjct: 252 SPPPPSLSPSPPPPSVSPSPPPPSLS-PSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPS 310

Query: 164 SPP-PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY 340
            PP PP     SPPPP      PPP +    SP PPP  P   PSPPPP +   SPPPP 
Sbjct: 311 PPPRPPPSASPSPPPPSLSPSPPPPSL----SPSPPP--PSLSPSPPPPSFS-PSPPPPS 363

Query: 341 KYPSPPP----PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYK 508
             PSPPP    P    PSPPPP+     PPPP     SPPPP   P   P PPPP     
Sbjct: 364 LSPSPPPATPPPSPPPPSPPPPL-----PPPP-----SPPPPLPPP---PIPPPP----- 405

Query: 509 SPPPPVYSPPPPV 547
           SPPPP   PPPP+
Sbjct: 406 SPPPP---PPPPL 415

 Score =  142 bits (359), Expect = 1e-32
 Identities = 91/176 (51%), Positives = 93/176 (52%), Gaps = 7/176 (3%)
 Frame = +2

Query: 77  SPPPPYKYPSPP--PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKY 250
           SPP P   PSPP  PPP   PSPPPP     SPPPP      PPP +    SPPPP    
Sbjct: 204 SPPYPPSLPSPPSLPPPSASPSPPPPSLS-PSPPPPSLSPSPPPPSISP--SPPPPSL-- 258

Query: 251 KSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP---PYKYPSPPPPVYKYKSPP- 418
            SP PPP  P   PSPPPP     SPPPP   PSPPPP   P   PSPPPP      PP 
Sbjct: 259 -SPSPPP--PSVSPSPPPPSLS-PSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPR 314

Query: 419 PPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP-PPPVYKYKSPPPPVYS 583
           PP     SPPPP+      PSPPPP     SPPPP  SP PPP     SPPPP  S
Sbjct: 315 PPPSASPSPPPPSLS----PSPPPPSLS-PSPPPPSLSPSPPPPSFSPSPPPPSLS 365

 Score =  138 bits (347), Expect = 4e-31
 Identities = 93/189 (49%), Positives = 95/189 (50%), Gaps = 6/189 (3%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
            SPPPP   P   PSPPPP     SPPPP   PSPPPP    PSPPPP     SPPPP   
Sbjct: 1740 SPPPPSPPPSPPPSPPPP-----SPPPPSLSPSPPPPSTS-PSPPPPSAS-PSPPPPSAS 1792

Query: 188  YKSPPPPVYKYKSPPPPVYKYKSPPPP----PKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
              SPPPP     SPPPP      PPPP    P  P   PSPPPP     SPPPP   PSP
Sbjct: 1793 -PSPPPPSLS-PSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSS-PSPPPPSSSPSP 1849

Query: 356  PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPP--VYKYKSPPPPVY 529
            PPP    PSPPP      SPPP      SPPPP+  P   P+PP P  V        P  
Sbjct: 1850 PPPSL-SPSPPP------SPPP-----SSPPPPS--PPTPPAPPRPFLVSLDIIATQPSS 1895

Query: 530  SPPPPVYKY 556
            S PP  Y Y
Sbjct: 1896 SNPPERYPY 1904

 Score =  130 bits (327), Expect = 8e-29
 Identities = 84/188 (44%), Positives = 89/188 (47%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
            S PPPP  P   PS  P      SPPPP    SPP PP   P PPPPV     PPPP   
Sbjct: 2086 SVPPPPSPPPSLPSSSP------SPPPP----SPPLPPSPPPLPPPPV-----PPPP--- 2127

Query: 188  YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPP 367
              +PPP      SPPP       PPPP   P   P PPPP     SPP     PSPPPP 
Sbjct: 2128 --TPPP------SPPP------LPPPPTPPPSPPPLPPPPTPPPQSPP----LPSPPPPS 2169

Query: 368  YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
               P P PP      PPPP+     PPPP+  P+  P  P P     SPPPP   PPPP+
Sbjct: 2170 PPTPPPLPPPSPSPLPPPPI-----PPPPSPPPHPPPQSPLP----PSPPPP--PPPPPL 2218

Query: 548  YKYKSPPP 571
                SPPP
Sbjct: 2219 PPPPSPPP 2226

 Score =  123 bits (308), Expect = 1e-26
 Identities = 77/162 (47%), Positives = 82/162 (50%), Gaps = 5/162 (3%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP---PPYKYPSPPPPVYKYKSPPPPV 181
            PP PP  P   P PPPPV     PPPP   PSPPP   PP   PSPPP       PPPP 
Sbjct: 2106 PPSPPLPPSPPPLPPPPV-----PPPPTPPPSPPPLPPPPTPPPSPPP------LPPPPT 2154

Query: 182  YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPS--PPPPVYKYNSPPPPYKYPSP 355
               +SPP P     SPPPP     SPP PP  P   PS  PPPP+     PPPP   P P
Sbjct: 2155 PPPQSPPLP-----SPPPP-----SPPTPPPLPPPSPSPLPPPPI-----PPPPSPPPHP 2199

Query: 356  PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPS 481
            PP     PSPPPP      PPPP+     PPPP+  P + PS
Sbjct: 2200 PPQSPLPPSPPPP-----PPPPPL-----PPPPSPPPSQPPS 2231

 Score =  119 bits (298), Expect = 2e-25
 Identities = 80/180 (44%), Positives = 85/180 (47%), Gaps = 4/180 (2%)
 Frame = +2

Query: 50   PPPPVYKYNSPPP--PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYK 223
            PPPP     SPPP  P   PSPPPP    P  PPP+     PPPPV     PPPP     
Sbjct: 2088 PPPP-----SPPPSLPSSSPSPPPPSPPLPPSPPPL-----PPPPV-----PPPP----- 2127

Query: 224  SPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYK 403
            +PPP      SPPP P  P   PSPPP       PPPP    +PPP     PSPPPP   
Sbjct: 2128 TPPP------SPPPLPPPPTPPPSPPP------LPPPP----TPPPQSPPLPSPPPP--- 2168

Query: 404  YKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP--PVYSPPPPVYKYKSPPPPV 577
              SPP P        PP   P   P PPPP+    SPPP  P  SP PP      PPPP+
Sbjct: 2169 --SPPTP--------PPLPPPSPSPLPPPPIPPPPSPPPHPPPQSPLPPSPPPPPPPPPL 2218

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 58/118 (49%), Positives = 60/118 (50%)
 Frame = +2

Query: 224  SPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYK 403
            SPPPP     SPPPP       PSPPP      SPPPP   PSPPPP    P PPPPV  
Sbjct: 1535 SPPPP-----SPPPPS------PSPPP------SPPPPSPPPSPPPPSPPPPLPPPPVPP 1577

Query: 404  YKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPV 577
               PPP        PPP+  P   PSPPP      SPPPP+  PPPP      PPPPV
Sbjct: 1578 SPLPPPS-------PPPSPPPSPPPSPPP------SPPPPLPLPPPPSPPPPLPPPPV 1622

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 62/125 (49%), Positives = 63/125 (50%)
 Frame = +2

Query: 200 PPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYP 379
           P P Y    P PP     S PPP   P    SPPPP     SPPPP   PSPPPP    P
Sbjct: 203 PSPPYPPSLPSPP-----SLPPPSASP----SPPPPSLS-PSPPPPSLSPSPPPPSIS-P 251

Query: 380 SPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYK 559
           SPPPP      PPP V    SPPPP+      PSPPPP     SPPPP  SP PP     
Sbjct: 252 SPPPPSLSPSPPPPSV--SPSPPPPSLS----PSPPPPSLS-PSPPPPSLSPSPP----P 300

Query: 560 SPPPP 574
           SPPPP
Sbjct: 301 SPPPP 305

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 56/125 (44%), Positives = 61/125 (48%), Gaps = 6/125 (4%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 193
            PPPP  P   PSPPPP+    SPPPP   P  PPPP   P  PPP+     PPPP+    
Sbjct: 1173 PPPPNPPP--PSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPP 1230

Query: 194  SPPPPVYKYKSPPPPVYKYKSPPPP------PKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
            SPPP       P PP     SPPPP      P  P   PSPPPP     +PPPP     P
Sbjct: 1231 SPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPP-----TPPPP-----P 1280

Query: 356  PPPPY 370
            P  P+
Sbjct: 1281 PLAPF 1285

 Score = 84.0 bits (206), Expect = 8e-15
 Identities = 44/91 (48%), Positives = 47/91 (51%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPP P  P   P PPPP+     PPPP   PSPPP P   P P PP     SPPPP    
Sbjct: 1204 PPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPP----PSPPPPTPPP 1259

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPY 283
             +PPPP     SPPPP      PPPPP  P+
Sbjct: 1260 PAPPPPTPP-PSPPPPT----PPPPPPLAPF 1285

 Score = 79.7 bits (195), Expect = 2e-13
 Identities = 51/97 (52%), Positives = 52/97 (53%), Gaps = 1/97 (1%)
 Frame = +2

Query: 290  PSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPY 469
            PSPPPP     SPPPP   P P PPP   PSPPP      SPPPP     SPPPP   P 
Sbjct: 1534 PSPPPP-----SPPPPSPSPPPSPPP---PSPPP------SPPPP-----SPPPPLPPPP 1574

Query: 470  KYPSPPPPVYKYKSPPP-PVYSPPPPVYKYKSPPPPV 577
              PSP PP     SPPP P  SPPP      SPPPP+
Sbjct: 1575 VPPSPLPP----PSPPPSPPPSPPPS--PPPSPPPPL 1605

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 39/76 (51%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = +2

Query: 347 PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPY-KYPSPPPPVYKYKSPPPP 523
           PSP PPP   PSPPPP     SP PP     SPPPP+  P    PSPPPP+     PPPP
Sbjct: 676 PSPSPPP---PSPPPP-----SPSPP----PSPPPPSPPPSPPPPSPPPPLPPPPLPPPP 723

Query: 524 VYSPPPPVYKYKSPPP 571
           +  P PP     SPPP
Sbjct: 724 LPPPSPPPSPPPSPPP 739

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 44/100 (44%), Positives = 48/100 (48%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 184
            +SPP P   P   P+PPP      SP PP   P PP PP   P PPP     +SP PP  
Sbjct: 2158 QSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPP---PHPPP-----QSPLPP-- 2207

Query: 185  KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPP 304
               SPPPP      PPPP+      PPPP  P   PS PP
Sbjct: 2208 ---SPPPP-----PPPPPL------PPPPSPP---PSQPP 2230

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 37/79 (46%), Positives = 39/79 (49%)
 Frame = +2

Query: 347 PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV 526
           PSPP PP   PSPP       S PPP     SPPPP+  P    SPPPP      PPP +
Sbjct: 203 PSPPYPP-SLPSPP-------SLPPPSAS-PSPPPPSLSP----SPPPPSLSPSPPPPSI 249

Query: 527 YSPPPPVYKYKSPPPPVYS 583
              PPP     SPPPP  S
Sbjct: 250 SPSPPPPSLSPSPPPPSVS 268

[99][TOP]
>UniRef100_Q41645 Extensin (Fragment) n=1 Tax=Volvox carteri RepID=Q41645_VOLCA
          Length = 464

 Score =  170 bits (430), Expect = 9e-41
 Identities = 100/213 (46%), Positives = 106/213 (49%), Gaps = 21/213 (9%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP---------------------SPPPPPY 124
           SPPPPP+      SPPPP    +SPPP  + P                     SPPPPP 
Sbjct: 221 SPPPPPRVS---TSPPPPARVSSSPPPATRSPPPRRITSPSPVLTASPPLPKTSPPPPPR 277

Query: 125 KYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPP 304
             PSPPPPV     PPPP  +    PPP     SPPPP     SP PPP  P   PSPPP
Sbjct: 278 VPPSPPPPVASPPPPPPP--RVSPSPPPPQPVSSPPPPPPPRPSPSPPP--PRSSPSPPP 333

Query: 305 PVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSP 484
           P     SPPPP   PS PPPP   PSPPPPV    SPPPP  +   PPPPA  P   P P
Sbjct: 334 PSPPPPSPPPPRPSPS-PPPPRSSPSPPPPVV---SPPPPPPRASPPPPPASSPPPPPRP 389

Query: 485 PPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           PPP     SPPP   SPPPP     +PP P  S
Sbjct: 390 PPP-----SPPP---SPPPPATAAANPPSPAPS 414

 Score =  169 bits (429), Expect = 1e-40
 Identities = 100/199 (50%), Positives = 105/199 (52%), Gaps = 10/199 (5%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP-PYKYPSPPPPVYKYKSPPPPVY 184
           SPPPPP+ P   PSPPPPV     PPPP   PSPPPP P   P PPPP     SPPPP  
Sbjct: 271 SPPPPPRVP---PSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPP-R 326

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
              SPPPP     SPPPP     SP PPP  P   PSPPPPV    SPPPP    SPPPP
Sbjct: 327 SSPSPPPPSPPPPSPPPP---RPSPSPPP--PRSSPSPPPPVV---SPPPPPPRASPPPP 378

Query: 365 PYKYPSP---PPPVYKYKSPPPPVYKYKSPPPPAKK------PYKYPSPPPPVYKYKSPP 517
           P   P P   PPP     SPPPP     +PP PA        P     PPPP  +  +PP
Sbjct: 379 PASSPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPLGTRPPPPPPEDDAPP 438

Query: 518 PPVYSPPPPVYKYKSPPPP 574
           P  Y PPP   +  SPPPP
Sbjct: 439 PDYYFPPP---QDMSPPPP 454

 Score =  160 bits (405), Expect = 7e-38
 Identities = 95/186 (51%), Positives = 100/186 (53%), Gaps = 6/186 (3%)
 Frame = +2

Query: 44  PSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSP-----PPPVYKYKSPPPPVYKYKSPPPP 208
           PSPPPP     SPPPP +  S PPP  + P P     P PV    SPP P     SPPPP
Sbjct: 220 PSPPPPPRVSTSPPPPARVSSSPPPATRSPPPRRITSPSPVLT-ASPPLP---KTSPPPP 275

Query: 209 VYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSP-PPPPYKYPSP 385
                SPPPPV    + PPPP  P   PSPPPP    + PPPP   PSP PPPP   PSP
Sbjct: 276 PRVPPSPPPPV----ASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSP 331

Query: 386 PPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSP 565
           PPP     SPPPP     SPPPP       PSPPPP     SPPPPV SPPPP  +   P
Sbjct: 332 PPP-----SPPPP-----SPPPPRPS----PSPPPP-RSSPSPPPPVVSPPPPPPRASPP 376

Query: 566 PPPVYS 583
           PPP  S
Sbjct: 377 PPPASS 382

 Score =  112 bits (280), Expect = 2e-23
 Identities = 71/165 (43%), Positives = 78/165 (47%), Gaps = 14/165 (8%)
 Frame = +2

Query: 11  PPPPPKK------PYKYPSPPPPVYKYNSPPPPYKYPSPPPP--------PYKYPSPPPP 148
           PPPPP+       P   PSPPPP     SPPPP   PSPPPP        P   P PPPP
Sbjct: 312 PPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPP 371

Query: 149 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSP 328
             +   PPPP     SPPPP       PPP     SPPPP       PSP P   +   P
Sbjct: 372 --RASPPPPPA---SSPPPPPRPPPPSPPP-----SPPPPATAAANPPSPAPSRSRAGGP 421

Query: 329 PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKK 463
           P   +   PPPPP +  +PPP  Y    PPP   +  SPPPP KK
Sbjct: 422 PLGTR---PPPPPPEDDAPPPDYY---FPPP---QDMSPPPPKKK 457

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 52/128 (40%), Positives = 60/128 (46%), Gaps = 6/128 (4%)
 Frame = +2

Query: 8   SPPPPPKKPYKYP---SPPPPVYKYNSPPPPYKYPSPPP---PPYKYPSPPPPVYKYKSP 169
           SPPPP   P   P   SPPPP  + + PPPP   P PPP   PP   PSPPPP     +P
Sbjct: 349 SPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANP 408

Query: 170 PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP 349
           P       SP P   +   PP      + PPPPP+        PPP Y +    PP +  
Sbjct: 409 P-------SPAPSRSRAGGPP---LGTRPPPPPPE-----DDAPPPDYYF----PPPQDM 449

Query: 350 SPPPPPYK 373
           SPPPP  K
Sbjct: 450 SPPPPKKK 457

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 39/96 (40%), Positives = 47/96 (48%), Gaps = 5/96 (5%)
 Frame = +2

Query: 5   KSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPV-YKYKSPPPPV 181
           ++ PPPP       SPPPP      PPPP   PSPPPP     +PP P   + ++  PP+
Sbjct: 372 RASPPPPPA----SSPPPP----PRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPL 423

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSP----PPPPKK 277
                PPPP       PPP Y +  P    PPPPKK
Sbjct: 424 GTRPPPPPP---EDDAPPPDYYFPPPQDMSPPPPKK 456

[100][TOP]
>UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO
          Length = 1765

 Score =  170 bits (430), Expect = 9e-41
 Identities = 99/196 (50%), Positives = 104/196 (53%), Gaps = 3/196 (1%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP-PYKYPSPPPPVYKYK-SPPPP 178
            K PPP P  P   PSPPPP      PPPP   PSPPPP P   PSPPPPV++   SPPPP
Sbjct: 1079 KPPPPSPPSPPSPPSPPPPPPPSPPPPPP---PSPPPPRPPPPPSPPPPVHEPPPSPPPP 1135

Query: 179  VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
                 SPPPP       PPP     SPPPPP  P   P P PP      PPPP   PSPP
Sbjct: 1136 ----PSPPPPT---PDAPPP-----SPPPPPPSPPPSPPPSPPPPPSPMPPPP---PSPP 1180

Query: 359  PP-PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
            PP P   PSPPPPV++    PPP      PPP    P   P PPPP     SPPPP   P
Sbjct: 1181 PPRPPPPPSPPPPVHEPPPSPPPPPNPSPPPPSPMPPPPSPMPPPPSPPPPSPPPPSPMP 1240

Query: 536  PPPVYKYKSPPPPVYS 583
            PPP     SPPPP+ S
Sbjct: 1241 PPP-----SPPPPIPS 1251

 Score =  166 bits (419), Expect = 2e-39
 Identities = 94/190 (49%), Positives = 100/190 (52%), Gaps = 2/190 (1%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
            SPPPPP      P PPPP     SPPPP   P P PPP   P PP P     SPPPP   
Sbjct: 1101 SPPPPPPPSPPPPRPPPPP----SPPPPVHEPPPSPPPPPSPPPPTPDAPPPSPPPPPPS 1156

Query: 188  YKSPPPPVYKYKSPPPPVYKYKSPPP--PPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
                PPP     SPPPP      PPP  PP +P   PSPPPPV++    PPP   PSPPP
Sbjct: 1157 PPPSPPP-----SPPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSPPP 1211

Query: 362  PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPP 541
            P    P PPPP      PPPP     SPPPP+  P   P PPPP     SPPPP+ SPPP
Sbjct: 1212 PS---PMPPPP---SPMPPPP-----SPPPPSPPP-PSPMPPPP-----SPPPPIPSPPP 1254

Query: 542  PVYKYKSPPP 571
            P    +SPPP
Sbjct: 1255 PPPTPRSPPP 1264

 Score =  153 bits (386), Expect = 1e-35
 Identities = 91/198 (45%), Positives = 98/198 (49%), Gaps = 10/198 (5%)
 Frame = +2

Query: 11   PPPPPKKPYKYP--SPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 184
            P PP       P   PPPP     SPP P   PSPPPPP   P PPPP     SPPPP  
Sbjct: 1065 PAPPAAAMDNRPCEKPPPP-----SPPSPPSPPSPPPPPPPSPPPPPP----PSPPPP-- 1113

Query: 185  KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSP--------PPPY 340
              + PPPP     SPPPPV++    PPPP      PSPPPP      P        PPP 
Sbjct: 1114 --RPPPPP-----SPPPPVHEPPPSPPPP------PSPPPPTPDAPPPSPPPPPPSPPPS 1160

Query: 341  KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP 520
              PSPPPPP   P PPP     + PPPP     SPPPP  +P   PSPPPP      PP 
Sbjct: 1161 PPPSPPPPPSPMPPPPPSPPPPRPPPPP-----SPPPPVHEP--PPSPPPPPNPSPPPPS 1213

Query: 521  PVYSPPPPVYKYKSPPPP 574
            P+  PP P+    SPPPP
Sbjct: 1214 PMPPPPSPMPPPPSPPPP 1231

 Score =  146 bits (369), Expect = 1e-33
 Identities = 93/191 (48%), Positives = 98/191 (51%), Gaps = 3/191 (1%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP--PPPYKYPSPPPPVYKYKSPPPPV 181
            SPPPPP  P   P  PPP      PPPP   PSPP  PPP   P PPPP     SPPPP 
Sbjct: 1131 SPPPPPSPPPPTPDAPPPS---PPPPPPSPPPSPPPSPPPPPSPMPPPP----PSPPPP- 1182

Query: 182  YKYKSPPPPVYKYKSPPPPVYK-YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
               + PPPP     SPPPPV++   SPPPPP      PSPPPP     SP PP   P PP
Sbjct: 1183 ---RPPPPP-----SPPPPVHEPPPSPPPPPN-----PSPPPP-----SPMPPPPSPMPP 1224

Query: 359  PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP 538
            PP    PSPPPP      PPPP     SPPPP       PSPPPP    +SPPP     P
Sbjct: 1225 PPSPPPPSPPPP---SPMPPPP-----SPPPP------IPSPPPPPPTPRSPPP----AP 1266

Query: 539  PPVYKYKSPPP 571
            PP+     P P
Sbjct: 1267 PPLPGDVDPTP 1277

 Score =  121 bits (304), Expect = 3e-26
 Identities = 83/178 (46%), Positives = 87/178 (48%), Gaps = 2/178 (1%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPP--PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 184
            PPPP   P   PSPPPP      PPP  P   P PP      PSPPPPV++   PPP   
Sbjct: 1152 PPPPSPPPSPPPSPPPPPSPMPPPPPSPPPPRPPPP------PSPPPPVHE---PPP--- 1199

Query: 185  KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
               SPPPP     SPPPP     SP PPP      P PPPP     SPPP    PSPPPP
Sbjct: 1200 ---SPPPP--PNPSPPPP-----SPMPPPPS----PMPPPP-----SPPP----PSPPPP 1236

Query: 365  PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP 538
                P PPPP     SPPPP+    SPPPP   P   P  PPP+     P P   SPP
Sbjct: 1237 S---PMPPPP-----SPPPPI---PSPPPPPPTPRSPPPAPPPLPGDVDPTPA--SPP 1281

 Score = 80.9 bits (198), Expect = 7e-14
 Identities = 44/101 (43%), Positives = 51/101 (50%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
            ++ PP PP  P   P PP P+    SP PP   P PP PP   P PPPP     SPPPP+
Sbjct: 1195 HEPPPSPPPPPNPSPPPPSPMPPPPSPMPPPPSPPPPSPPPPSPMPPPP-----SPPPPI 1249

Query: 182  YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPP 304
                SPPPP    +SPPP      +PPP P      P+ PP
Sbjct: 1250 ---PSPPPPPPTPRSPPP------APPPLPGDVDPTPASPP 1281

[101][TOP]
>UniRef100_Q3ECC3 Putative uncharacterized protein At1g76930.1 n=1 Tax=Arabidopsis
           thaliana RepID=Q3ECC3_ARATH
          Length = 293

 Score =  168 bits (425), Expect = 3e-40
 Identities = 102/164 (62%), Positives = 106/164 (64%), Gaps = 5/164 (3%)
 Frame = +2

Query: 65  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 244
           Y Y+SPPPP K+ SPPP    Y SPPPPV  Y   PPPV  YKSPPPPV  Y   PPPV 
Sbjct: 25  YFYSSPPPPVKHYSPPP---VYKSPPPPVKHYS--PPPV--YKSPPPPVKHYS--PPPV- 74

Query: 245 KYKSPPPPPK---KPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP 415
            YKSPPPP K    P  Y SPPPPVYK  SPPPP K+ SPPP    Y SPPPPV  Y   
Sbjct: 75  -YKSPPPPVKYYSPPPVYKSPPPPVYK--SPPPPVKHYSPPP---VYKSPPPPVKHYS-- 126

Query: 416 PPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV--YSPPP 541
           PPPV  YKSPPPP     K+ SPPP    YKSPPPPV  YSPPP
Sbjct: 127 PPPV--YKSPPPPV----KHYSPPP---VYKSPPPPVKHYSPPP 161

 Score =  166 bits (421), Expect = 9e-40
 Identities = 104/173 (60%), Positives = 110/173 (63%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           + S PPPP K Y     PPPVYK  SPPPP K+ SPPP    Y SPPPPV  Y   PPPV
Sbjct: 26  FYSSPPPPVKHYS----PPPVYK--SPPPPVKHYSPPP---VYKSPPPPVKHYS--PPPV 74

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
             YKSPPPPV KY SPPP    YKSPPPP      Y SPPPPV K+ SPPP YK    PP
Sbjct: 75  --YKSPPPPV-KYYSPPP---VYKSPPPP-----VYKSPPPPV-KHYSPPPVYK---SPP 119

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP 520
           PP K+ SPPP    YKSPPPPV K+ SPPP       Y SPPPPV K+ SPPP
Sbjct: 120 PPVKHYSPPP---VYKSPPPPV-KHYSPPP------VYKSPPPPV-KHYSPPP 161

 Score =  154 bits (389), Expect = 5e-36
 Identities = 95/153 (62%), Positives = 97/153 (63%), Gaps = 11/153 (7%)
 Frame = +2

Query: 152 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPP 331
           Y Y SPPPPV  Y   PPPVYK  SPPPPV K+ SPPP       Y SPPPPV K+ SPP
Sbjct: 25  YFYSSPPPPVKHYS--PPPVYK--SPPPPV-KHYSPPPV------YKSPPPPV-KHYSPP 72

Query: 332 PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK---KPYKYPSPPPPVYK 502
           P YK    PPPP KY SPPP    YKSPPPPVYK  SPPPP K    P  Y SPPPPV  
Sbjct: 73  PVYK---SPPPPVKYYSPPPV---YKSPPPPVYK--SPPPPVKHYSPPPVYKSPPPPVKH 124

Query: 503 ------YKSPPPPV--YSPPPPVYKYKSPPPPV 577
                 YKSPPPPV  YSPPP    YKSPPPPV
Sbjct: 125 YSPPPVYKSPPPPVKHYSPPP---VYKSPPPPV 154

 Score = 79.0 bits (193), Expect = 3e-13
 Identities = 48/86 (55%), Positives = 50/86 (58%), Gaps = 15/86 (17%)
 Frame = +2

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV-YSPPPP 544
           Y Y SPPPPV  Y   PPPVYK  SPPPP K    + SPPP    YKSPPPPV +  PPP
Sbjct: 25  YFYSSPPPPVKHYS--PPPVYK--SPPPPVK----HYSPPPV---YKSPPPPVKHYSPPP 73

Query: 545 VYK--------------YKSPPPPVY 580
           VYK              YKSPPPPVY
Sbjct: 74  VYKSPPPPVKYYSPPPVYKSPPPPVY 99

[102][TOP]
>UniRef100_Q304C4 Putative uncharacterized protein At1g76930.2 n=1 Tax=Arabidopsis
           thaliana RepID=Q304C4_ARATH
          Length = 256

 Score =  168 bits (425), Expect = 3e-40
 Identities = 102/164 (62%), Positives = 106/164 (64%), Gaps = 5/164 (3%)
 Frame = +2

Query: 65  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 244
           Y Y+SPPPP K+ SPPP    Y SPPPPV  Y   PPPV  YKSPPPPV  Y   PPPV 
Sbjct: 25  YFYSSPPPPVKHYSPPP---VYKSPPPPVKHYS--PPPV--YKSPPPPVKHYS--PPPV- 74

Query: 245 KYKSPPPPPK---KPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP 415
            YKSPPPP K    P  Y SPPPPVYK  SPPPP K+ SPPP    Y SPPPPV  Y   
Sbjct: 75  -YKSPPPPVKYYSPPPVYKSPPPPVYK--SPPPPVKHYSPPP---VYKSPPPPVKHYS-- 126

Query: 416 PPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV--YSPPP 541
           PPPV  YKSPPPP     K+ SPPP    YKSPPPPV  YSPPP
Sbjct: 127 PPPV--YKSPPPPV----KHYSPPP---VYKSPPPPVKHYSPPP 161

 Score =  166 bits (421), Expect = 9e-40
 Identities = 104/173 (60%), Positives = 110/173 (63%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           + S PPPP K Y     PPPVYK  SPPPP K+ SPPP    Y SPPPPV  Y   PPPV
Sbjct: 26  FYSSPPPPVKHYS----PPPVYK--SPPPPVKHYSPPP---VYKSPPPPVKHYS--PPPV 74

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
             YKSPPPPV KY SPPP    YKSPPPP      Y SPPPPV K+ SPPP YK    PP
Sbjct: 75  --YKSPPPPV-KYYSPPP---VYKSPPPP-----VYKSPPPPV-KHYSPPPVYK---SPP 119

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP 520
           PP K+ SPPP    YKSPPPPV K+ SPPP       Y SPPPPV K+ SPPP
Sbjct: 120 PPVKHYSPPP---VYKSPPPPV-KHYSPPP------VYKSPPPPV-KHYSPPP 161

 Score =  154 bits (389), Expect = 5e-36
 Identities = 95/153 (62%), Positives = 97/153 (63%), Gaps = 11/153 (7%)
 Frame = +2

Query: 152 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPP 331
           Y Y SPPPPV  Y   PPPVYK  SPPPPV K+ SPPP       Y SPPPPV K+ SPP
Sbjct: 25  YFYSSPPPPVKHYS--PPPVYK--SPPPPV-KHYSPPPV------YKSPPPPV-KHYSPP 72

Query: 332 PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK---KPYKYPSPPPPVYK 502
           P YK    PPPP KY SPPP    YKSPPPPVYK  SPPPP K    P  Y SPPPPV  
Sbjct: 73  PVYK---SPPPPVKYYSPPPV---YKSPPPPVYK--SPPPPVKHYSPPPVYKSPPPPVKH 124

Query: 503 ------YKSPPPPV--YSPPPPVYKYKSPPPPV 577
                 YKSPPPPV  YSPPP    YKSPPPPV
Sbjct: 125 YSPPPVYKSPPPPVKHYSPPP---VYKSPPPPV 154

 Score = 79.0 bits (193), Expect = 3e-13
 Identities = 48/86 (55%), Positives = 50/86 (58%), Gaps = 15/86 (17%)
 Frame = +2

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV-YSPPPP 544
           Y Y SPPPPV  Y   PPPVYK  SPPPP K    + SPPP    YKSPPPPV +  PPP
Sbjct: 25  YFYSSPPPPVKHYS--PPPVYK--SPPPPVK----HYSPPPV---YKSPPPPVKHYSPPP 73

Query: 545 VYK--------------YKSPPPPVY 580
           VYK              YKSPPPPVY
Sbjct: 74  VYKSPPPPVKYYSPPPVYKSPPPPVY 99

[103][TOP]
>UniRef100_UPI0001982EE5 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
            RepID=UPI0001982EE5
          Length = 746

 Score =  167 bits (424), Expect = 4e-40
 Identities = 103/211 (48%), Positives = 114/211 (54%), Gaps = 21/211 (9%)
 Frame = +2

Query: 14   PPPPKKPYKYPSPPPPVYKYNSPPPPYKY----PSPPPPPYKYPSPPPPVYK----YKSP 169
            P P   P   PSP PP  K +SPPPP+K     P+P P P    SPPPPV+      +SP
Sbjct: 513  PTPTPTPKPKPSPHPP--KTSSPPPPHKATPPTPTPKPSPAPISSPPPPVHSTPPPVRSP 570

Query: 170  PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP 349
            PPPV+   SPPPP+   +SPPPP      PP     P    SPPPPV    SPPPP   P
Sbjct: 571  PPPVF---SPPPPI-PVRSPPPPTPVRSPPPSVSSPPPPEHSPPPPV---QSPPPPLYSP 623

Query: 350  SPP---PPPYKYPSPPPPVYKYKSPPPPVYK-----YKSPPPPAKKPYK-YPSPPPPVYK 502
            SPP   PPP    SPPPPV   +SPPPPV         SPPPP   P     SPPPPV  
Sbjct: 624  SPPVHSPPPPPVHSPPPPV---RSPPPPVSSPPPPPVSSPPPPVHSPPPPVSSPPPPVSS 680

Query: 503  ----YKSPPPPVYSPPPPVYKYKSPPPPVYS 583
                   PPPPV SPPPPV  +  PPPPV+S
Sbjct: 681  PHPPVAFPPPPVSSPPPPV--HSPPPPPVFS 709

 Score =  159 bits (402), Expect = 2e-37
 Identities = 101/200 (50%), Positives = 114/200 (57%), Gaps = 20/200 (10%)
 Frame = +2

Query: 8    SPPPPPKKPYKYP--SPPPPVYKYNSPPPPYKYPSPP----PPPYKYPSPPPPVYKYKSP 169
            +PP P  KP   P  SPPPPV+   S PPP + P PP    PPP    SPPPP    +SP
Sbjct: 540  TPPTPTPKPSPAPISSPPPPVH---STPPPVRSPPPPVFSPPPPIPVRSPPPPT-PVRSP 595

Query: 170  PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPY 340
            PP V    SPPPP +   SPPPPV   +SPPPP   P  P   P PPPPV+   SPPPP 
Sbjct: 596  PPSV---SSPPPPEH---SPPPPV---QSPPPPLYSPSPPVHSP-PPPPVH---SPPPPV 642

Query: 341  KYPSPP---PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYK---YP-----SPP 487
            + P PP   PPP    SPPPPV+   SPPPPV    SPPPP   P+    +P     SPP
Sbjct: 643  RSPPPPVSSPPPPPVSSPPPPVH---SPPPPV---SSPPPPVSSPHPPVAFPPPPVSSPP 696

Query: 488  PPVYKYKSPPPPVYSPPPPV 547
            PPV+    PPPPV+SPP  V
Sbjct: 697  PPVHS--PPPPPVFSPPSAV 714

 Score =  154 bits (389), Expect = 5e-36
 Identities = 104/244 (42%), Positives = 118/244 (48%), Gaps = 50/244 (20%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYP--SPPPPVYKYNSPP------------------PPYKYPSPPPPP 121
            + SP P P KP   P  S PP      SPP                  PP   P+P P P
Sbjct: 460  HPSPSPSPPKPQPAPPKSTPPTPKPRPSPPKSVPSTPKPQPSPSPVSAPPTPTPTPTPTP 519

Query: 122  YKYPSP-------PPPVYK--------------YKSPPPPVYK----YKSPPPPVYKYKS 226
               PSP       PPP +K                SPPPPV+      +SPPPPV+   S
Sbjct: 520  KPKPSPHPPKTSSPPPPHKATPPTPTPKPSPAPISSPPPPVHSTPPPVRSPPPPVF---S 576

Query: 227  PPPPVYKYKSPPPPPKK--PYKYPSPPPPVYKYNSPPPPYKYPSPP---PPPYKYPSPPP 391
            PPPP+     PPP P +  P    SPPPP +   SPPPP + P PP   P P  +  PPP
Sbjct: 577  PPPPIPVRSPPPPTPVRSPPPSVSSPPPPEH---SPPPPVQSPPPPLYSPSPPVHSPPPP 633

Query: 392  PVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPP 571
            PV+   SPPPPV   +SPPPP   P     PPPPV    SPPPPV+SPPPPV    SPPP
Sbjct: 634  PVH---SPPPPV---RSPPPPVSSP-----PPPPV---SSPPPPVHSPPPPV---SSPPP 676

Query: 572  PVYS 583
            PV S
Sbjct: 677  PVSS 680

 Score =  147 bits (371), Expect = 6e-34
 Identities = 104/236 (44%), Positives = 119/236 (50%), Gaps = 43/236 (18%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYPSPPPPVYKYNSPPP-PYKYPSPPP-PPYKYPSPP---PPVYKYKSP 169
            KS PP P+ P + P+PPP     + P P P  +PSP P PP   P+PP   PP  K +  
Sbjct: 428  KSSPPKPRPPVRSPTPPPASTPRSPPTPKPQPHPSPSPSPPKPQPAPPKSTPPTPKPRPS 487

Query: 170  PP--------------PVYKYKSPPP---PVYKYK-SPPPPVYKYKSPPPPPK------- 274
            PP              PV    +P P   P  K K SP PP  K  SPPPP K       
Sbjct: 488  PPKSVPSTPKPQPSPSPVSAPPTPTPTPTPTPKPKPSPHPP--KTSSPPPPHKATPPTPT 545

Query: 275  -KPYKYP--SPPPPVYKYNSPPPPYKYPSP----PPPPYKYPSPPPPVYKYKSPPPPVYK 433
             KP   P  SPPPPV+   S PPP + P P    PPPP    SPPPP    +SPPP V  
Sbjct: 546  PKPSPAPISSPPPPVH---STPPPVRSPPPPVFSPPPPIPVRSPPPPT-PVRSPPPSV-- 599

Query: 434  YKSPPPPA-KKPYKYPSPPPPVYK-----YKSPPPPVYSPPPPVYKYKSPPPPVYS 583
              SPPPP    P    SPPPP+Y      +  PPPPV+SPPPPV   +SPPPPV S
Sbjct: 600  -SSPPPPEHSPPPPVQSPPPPLYSPSPPVHSPPPPPVHSPPPPV---RSPPPPVSS 651

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 62/119 (52%), Positives = 66/119 (55%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           +  PPPP        SPPPPV    SPPPP    SPPPPP    SPPPPV+   SPPPPV
Sbjct: 628 HSPPPPP------VHSPPPPV---RSPPPPVS--SPPPPPVS--SPPPPVH---SPPPPV 671

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
               SPPPPV    SP PPV     PPPP        SPPPPV+   SPPPP  + SPP
Sbjct: 672 ---SSPPPPV---SSPHPPV---AFPPPP------VSSPPPPVH---SPPPPPVF-SPP 711

[104][TOP]
>UniRef100_Q2L049 Filamentous hemagglutinin/adhesin n=1 Tax=Bordetella avium 197N
            RepID=Q2L049_BORA1
          Length = 2621

 Score =  167 bits (424), Expect = 4e-40
 Identities = 97/198 (48%), Positives = 97/198 (48%), Gaps = 9/198 (4%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPP-----YKYPSPPPPPYKYPSPPPPVYKYKSPP 172
            SPPPPP  P   P PPPP  K   PPPP      K   PPPPP   P PPP V K   PP
Sbjct: 2320 SPPPPPPPPP--PPPPPPKVKKVDPPPPPPPPKVKKVDPPPPP---PPPPPKVKKVDPPP 2374

Query: 173  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPK----KPYKYPSPPPPVYKYNSPPPPY 340
            PP      PPPP  K   PPPP      PPPPPK     P   P PPPP  K   PPPP 
Sbjct: 2375 PP-----PPPPPKVKKVDPPPP----PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP- 2424

Query: 341  KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP 520
              P PPPP  K   PPPP      PPPP  K   PPPP       P PPPP  K   PPP
Sbjct: 2425 --PPPPPPKVKKVDPPPPP---PPPPPPKVKKVDPPPP-------PPPPPPKVKKVDPPP 2472

Query: 521  PVYSPPPPVYKYKSPPPP 574
            P   PPP V K   PPPP
Sbjct: 2473 PPPPPPPKVKKVDPPPPP 2490

 Score =  160 bits (405), Expect = 7e-38
 Identities = 93/197 (47%), Positives = 94/197 (47%), Gaps = 8/197 (4%)
 Frame = +2

Query: 5    KSPPPPPKKPYKY--------PSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKY 160
            K  PPPP  P K         P PPPP  K   PPPP   P PPPP  K   PPPP    
Sbjct: 2339 KVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP---PPPPPPKVKKVDPPPPP--- 2392

Query: 161  KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY 340
              PPPP  K   PPPP      PPPP  K   PPPPP      P PPP V K + PPPP 
Sbjct: 2393 PPPPPPKVKKVDPPPP----PPPPPPKVKKVDPPPPP------PPPPPKVKKVDPPPPP- 2441

Query: 341  KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP 520
              P PPPP  K   PPPP      PPPP  K   PPPP       P PPPP  K   PPP
Sbjct: 2442 --PPPPPPKVKKVDPPPP----PPPPPPKVKKVDPPPP-------PPPPPPKVKKVDPPP 2488

Query: 521  PVYSPPPPVYKYKSPPP 571
            P   PPPP  K   PPP
Sbjct: 2489 P--PPPPPKVKKVDPPP 2503

 Score =  147 bits (372), Expect = 5e-34
 Identities = 86/188 (45%), Positives = 88/188 (46%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP        PPP V K + PPPP   P PPPP  K   PPPP      PPPP  K 
Sbjct: 2373 PPPPPP-------PPPKVKKVDPPPPP---PPPPPPKVKKVDPPPP----PPPPPPKVKK 2418

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP  K   PPPPP      P PPPP  K   PPPP   P PPPP  
Sbjct: 2419 VDPPPP----PPPPPPKVKKVDPPPPP------PPPPPPKVKKVDPPPP---PPPPPPKV 2465

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
            K   PPPP      PPPP  K   PPPP       P PPP V K   PP      P P  
Sbjct: 2466 KKVDPPPP----PPPPPPKVKKVDPPPP-------PPPPPKVKKVDPPPKDEVDGPKPAP 2514

Query: 551  KYKSPPPP 574
            K K+ P P
Sbjct: 2515 KPKAQPRP 2522

 Score =  140 bits (352), Expect = 9e-32
 Identities = 85/189 (44%), Positives = 88/189 (46%), Gaps = 23/189 (12%)
 Frame = +2

Query: 11   PPPPPK-----KPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKY------PSPPPPVYK 157
            PPPPPK      P   P PPP V K + PPPP   P PPPP  K       P PPPP  K
Sbjct: 2361 PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPP---PPPPPPKVKKVDPPPPPPPPPPKVK 2417

Query: 158  YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPK----KPYKYPSPPPPVYKYNS 325
               PPPP      PPPP  K   PPPP      PPPPPK     P   P PPPP  K   
Sbjct: 2418 KVDPPPP----PPPPPPKVKKVDPPPP----PPPPPPPKVKKVDPPPPPPPPPPKVKKVD 2469

Query: 326  PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP--------PAKKPYKYPS 481
            PPPP   P PPPP  K   PPPP      PPPP  K   PPP        PA KP   P 
Sbjct: 2470 PPPP---PPPPPPKVKKVDPPPP-----PPPPPKVKKVDPPPKDEVDGPKPAPKPKAQPR 2521

Query: 482  PPPPVYKYK 508
            P P   +Y+
Sbjct: 2522 PSPSTARYE 2530

 Score = 86.3 bits (212), Expect = 2e-15
 Identities = 50/104 (48%), Positives = 50/104 (48%), Gaps = 9/104 (8%)
 Frame = +2

Query: 290  PSPPPPVYKYNSPPPPYKY-----PSPPPPPYKY----PSPPPPVYKYKSPPPPVYKYKS 442
            PSPPPP      PPPP        P PPPPP K     P PPPP      PPPP  K   
Sbjct: 2319 PSPPPPP-PPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPP------PPPPKVKKVD 2371

Query: 443  PPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            PPPP       P PPPP  K   PPPP   PPPP  K   PPPP
Sbjct: 2372 PPPP-------PPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPP 2408

[105][TOP]
>UniRef100_Q8GD27 Adhesin FhaB n=1 Tax=Bordetella avium RepID=Q8GD27_BORAV
          Length = 2621

 Score =  167 bits (424), Expect = 4e-40
 Identities = 97/198 (48%), Positives = 97/198 (48%), Gaps = 9/198 (4%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPP-----YKYPSPPPPPYKYPSPPPPVYKYKSPP 172
            SPPPPP  P   P PPPP  K   PPPP      K   PPPPP   P PPP V K   PP
Sbjct: 2320 SPPPPPPPPP--PPPPPPKVKKVDPPPPPPPPKVKKVDPPPPP---PPPPPKVKKVDPPP 2374

Query: 173  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPK----KPYKYPSPPPPVYKYNSPPPPY 340
            PP      PPPP  K   PPPP      PPPPPK     P   P PPPP  K   PPPP 
Sbjct: 2375 PP-----PPPPPKVKKVDPPPP----PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP- 2424

Query: 341  KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP 520
              P PPPP  K   PPPP      PPPP  K   PPPP       P PPPP  K   PPP
Sbjct: 2425 --PPPPPPKVKKVDPPPPP---PPPPPPKVKKVDPPPP-------PPPPPPKVKKVDPPP 2472

Query: 521  PVYSPPPPVYKYKSPPPP 574
            P   PPP V K   PPPP
Sbjct: 2473 PPPPPPPKVKKVDPPPPP 2490

 Score =  160 bits (405), Expect = 7e-38
 Identities = 93/197 (47%), Positives = 94/197 (47%), Gaps = 8/197 (4%)
 Frame = +2

Query: 5    KSPPPPPKKPYKY--------PSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKY 160
            K  PPPP  P K         P PPPP  K   PPPP   P PPPP  K   PPPP    
Sbjct: 2339 KVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP---PPPPPPKVKKVDPPPPP--- 2392

Query: 161  KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY 340
              PPPP  K   PPPP      PPPP  K   PPPPP      P PPP V K + PPPP 
Sbjct: 2393 PPPPPPKVKKVDPPPP----PPPPPPKVKKVDPPPPP------PPPPPKVKKVDPPPPP- 2441

Query: 341  KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP 520
              P PPPP  K   PPPP      PPPP  K   PPPP       P PPPP  K   PPP
Sbjct: 2442 --PPPPPPKVKKVDPPPP----PPPPPPKVKKVDPPPP-------PPPPPPKVKKVDPPP 2488

Query: 521  PVYSPPPPVYKYKSPPP 571
            P   PPPP  K   PPP
Sbjct: 2489 P--PPPPPKVKKVDPPP 2503

 Score =  147 bits (372), Expect = 5e-34
 Identities = 86/188 (45%), Positives = 88/188 (46%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
            PPPPP        PPP V K + PPPP   P PPPP  K   PPPP      PPPP  K 
Sbjct: 2373 PPPPPP-------PPPKVKKVDPPPPP---PPPPPPKVKKVDPPPP----PPPPPPKVKK 2418

Query: 191  KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
              PPPP      PPPP  K   PPPPP      P PPPP  K   PPPP   P PPPP  
Sbjct: 2419 VDPPPP----PPPPPPKVKKVDPPPPP------PPPPPPKVKKVDPPPP---PPPPPPKV 2465

Query: 371  KYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVY 550
            K   PPPP      PPPP  K   PPPP       P PPP V K   PP      P P  
Sbjct: 2466 KKVDPPPP----PPPPPPKVKKVDPPPP-------PPPPPKVKKVDPPPKDEVDGPKPAP 2514

Query: 551  KYKSPPPP 574
            K K+ P P
Sbjct: 2515 KPKAQPRP 2522

 Score =  140 bits (352), Expect = 9e-32
 Identities = 85/189 (44%), Positives = 88/189 (46%), Gaps = 23/189 (12%)
 Frame = +2

Query: 11   PPPPPK-----KPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKY------PSPPPPVYK 157
            PPPPPK      P   P PPP V K + PPPP   P PPPP  K       P PPPP  K
Sbjct: 2361 PPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPP---PPPPPPKVKKVDPPPPPPPPPPKVK 2417

Query: 158  YKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPK----KPYKYPSPPPPVYKYNS 325
               PPPP      PPPP  K   PPPP      PPPPPK     P   P PPPP  K   
Sbjct: 2418 KVDPPPP----PPPPPPKVKKVDPPPP----PPPPPPPKVKKVDPPPPPPPPPPKVKKVD 2469

Query: 326  PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP--------PAKKPYKYPS 481
            PPPP   P PPPP  K   PPPP      PPPP  K   PPP        PA KP   P 
Sbjct: 2470 PPPP---PPPPPPKVKKVDPPPP-----PPPPPKVKKVDPPPKDEVDGPKPAPKPKAQPR 2521

Query: 482  PPPPVYKYK 508
            P P   +Y+
Sbjct: 2522 PSPSTARYE 2530

 Score = 86.3 bits (212), Expect = 2e-15
 Identities = 50/104 (48%), Positives = 50/104 (48%), Gaps = 9/104 (8%)
 Frame = +2

Query: 290  PSPPPPVYKYNSPPPPYKY-----PSPPPPPYKY----PSPPPPVYKYKSPPPPVYKYKS 442
            PSPPPP      PPPP        P PPPPP K     P PPPP      PPPP  K   
Sbjct: 2319 PSPPPPP-PPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPP------PPPPKVKKVD 2371

Query: 443  PPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            PPPP       P PPPP  K   PPPP   PPPP  K   PPPP
Sbjct: 2372 PPPP-------PPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPP 2408

[106][TOP]
>UniRef100_Q41805 Extensin-like protein n=1 Tax=Zea mays RepID=Q41805_MAIZE
          Length = 1188

 Score =  167 bits (424), Expect = 4e-40
 Identities = 108/218 (49%), Positives = 114/218 (52%), Gaps = 27/218 (12%)
 Frame = +2

Query: 8    SPPPPPKK---PYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
            SPPP PK    P    SPPPP  K  SPPPP    SPPPP  K P PP PV    SPPPP
Sbjct: 987  SPPPAPKSSPPPAPMSSPPPPEVK--SPPPPAPVSSPPPP-VKSPPPPAPV---SSPPPP 1040

Query: 179  VYKYKSPPPPVYKYKSPPPPVYKYKSPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYK 343
            V   KSPPPP     SPPPPV   KSPPPP     P  P K P PP PV   +SPPPP K
Sbjct: 1041 V---KSPPPPA-PVSSPPPPV---KSPPPPAPISSPPPPVKSPPPPAPV---SSPPPPVK 1090

Query: 344  YPSP------PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPA--KKPYKYPSPPPPVY 499
             P P      PPPP K P PP PV    SPPP   K  S PPPA    P    +P PP  
Sbjct: 1091 SPPPPAPVSSPPPPIKSPPPPAPV---SSPPPAPVKPPSLPPPAPVSSPPPVVTPAPPKK 1147

Query: 500  KYKSPPPPVYSPPPPVY-----------KYKSPPPPVY 580
            + +S PPP  S PPP +           KY SPPPP +
Sbjct: 1148 EEQSLPPPAESQPPPSFNDIILPPIMANKYASPPPPQF 1185

 Score =  166 bits (419), Expect = 2e-39
 Identities = 106/210 (50%), Positives = 113/210 (53%), Gaps = 20/210 (9%)
 Frame = +2

Query: 14   PPPPKKPYKYPSP---PPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 184
            PPP  K    P+P   PPP  K  S PPP    SPPPP  K P PP PV    SPPPPV 
Sbjct: 972  PPPEVKSSPPPTPVSSPPPAPK--SSPPPAPMSSPPPPEVKSPPPPAPV---SSPPPPV- 1025

Query: 185  KYKSPPPPVYKYKSPPPPVYKYKSPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYP 349
              KSPPPP     SPPPPV   KSPPPP     P  P K P PP P+   +SPPPP K P
Sbjct: 1026 --KSPPPPA-PVSSPPPPV---KSPPPPAPVSSPPPPVKSPPPPAPI---SSPPPPVKSP 1076

Query: 350  SPP------PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK------KPYKYPSPPPP 493
             PP      PPP K P PP PV    SPPPP+   KSPPPPA        P K PS PPP
Sbjct: 1077 PPPAPVSSPPPPVKSPPPPAPV---SSPPPPI---KSPPPPAPVSSPPPAPVKPPSLPPP 1130

Query: 494  VYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
                 S PPPV +P PP  + +S PPP  S
Sbjct: 1131 APV--SSPPPVVTPAPPKKEEQSLPPPAES 1158

 Score =  162 bits (409), Expect = 2e-38
 Identities = 106/207 (51%), Positives = 109/207 (52%), Gaps = 18/207 (8%)
 Frame = +2

Query: 8    SPPPPP-KKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPP----PVYKYKSPP 172
            SPPP P   P   P   PP    N PPP  K  SPPP P   P P P    P     SPP
Sbjct: 947  SPPPAPVSSPPATPKSSPPPAPVNLPPPEVK-SSPPPTPVSSPPPAPKSSPPPAPMSSPP 1005

Query: 173  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP-----PKKPYKYPSPPPPVYKYNSPPPP 337
            PP  + KSPPPP     SPPPPV   KSPPPP     P  P K P PP PV   +SPPPP
Sbjct: 1006 PP--EVKSPPPPA-PVSSPPPPV---KSPPPPAPVSSPPPPVKSPPPPAPV---SSPPPP 1056

Query: 338  YKYPSP------PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVY 499
             K P P      PPPP K P PP PV    SPPPPV   KSPPPPA       SPPPP+ 
Sbjct: 1057 VKSPPPPAPISSPPPPVKSPPPPAPV---SSPPPPV---KSPPPPA----PVSSPPPPI- 1105

Query: 500  KYKSPPP--PVYSPPPPVYKYKSPPPP 574
              KSPPP  PV SPPP   K  S PPP
Sbjct: 1106 --KSPPPPAPVSSPPPAPVKPPSLPPP 1130

 Score =  161 bits (407), Expect = 4e-38
 Identities = 105/227 (46%), Positives = 110/227 (48%), Gaps = 37/227 (16%)
 Frame = +2

Query: 8    SPPP-----PPKKPYKYPSP-----PPPVYKYNSPPPPYKYP------SPPPPPYKYPSP 139
            SPPP     PP  P   P P     PPP  K + PP P   P      SPPP P   P P
Sbjct: 915  SPPPAMVSSPPMTPKSSPPPVVVSSPPPTVKSSPPPAPVSSPPATPKSSPPPAPVNLPPP 974

Query: 140  -----PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP-----PKKPYKY 289
                 PPP      PP P    KS PPP     SPPPP  + KSPPPP     P  P K 
Sbjct: 975  EVKSSPPPTPVSSPPPAP----KSSPPPA-PMSSPPPP--EVKSPPPPAPVSSPPPPVKS 1027

Query: 290  PSPPPPVYKYNSPPPPYKYPSPP------PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 451
            P PP PV   +SPPPP K P PP      PPP K P PP P+    SPPPPV   KSPPP
Sbjct: 1028 PPPPAPV---SSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPI---SSPPPPV---KSPPP 1078

Query: 452  PAK-----KPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPV 577
            PA       P K P PP PV    SPPPP+ SPPPP      PP PV
Sbjct: 1079 PAPVSSPPPPVKSPPPPAPV---SSPPPPIKSPPPPAPVSSPPPAPV 1122

 Score =  157 bits (397), Expect = 6e-37
 Identities = 106/214 (49%), Positives = 110/214 (51%), Gaps = 22/214 (10%)
 Frame = +2

Query: 5    KSPPPPPKKPYKYP----SPPPPVYKYN-------SPPPPYKYPSPPPPPYKYPSPPPPV 151
            KSPP     P   P    +PPP + K +       SPPPP K  SPP P    PSPPPPV
Sbjct: 480  KSPPATSPSPQVQPPAASTPPPSLVKLSPPQAPVGSPPPPVKTTSPPAP-IGSPSPPPPV 538

Query: 152  YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPP 331
                SPPPPV   KSPPPP     SPPPP    KSPPPP        SPPPPV    SPP
Sbjct: 539  -SVVSPPPPV---KSPPPPA-PVGSPPPPE---KSPPPPAP----VASPPPPV---KSPP 583

Query: 332  PPYKYPSP------PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPA-----KKPYKYP 478
            PP    SP      PPPP    SPPPPV   KSPPPP     SPPPPA       P K P
Sbjct: 584  PPTLVASPPPPVKSPPPPAPVASPPPPV---KSPPPPT-PVASPPPPAPVASSPPPMKSP 639

Query: 479  SPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
             PP PV    SPPPP  SPPPP     +PPP  Y
Sbjct: 640  PPPTPV---SSPPPPEKSPPPPPPAKSTPPPEEY 670

 Score =  154 bits (388), Expect = 6e-36
 Identities = 106/227 (46%), Positives = 111/227 (48%), Gaps = 35/227 (15%)
 Frame = +2

Query: 8    SPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYP------- 133
            SPPPP     P  P K  SPPPP     SPPPP K P P      PPPP K P       
Sbjct: 533  SPPPPVSVVSPPPPVK--SPPPPA-PVGSPPPPEKSPPPPAPVASPPPPVKSPPPPTLVA 589

Query: 134  SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP----KKPYKYPSPP 301
            SPPPPV   KSPPPP     SPPPPV   KSPPPP      PPP P      P K P PP
Sbjct: 590  SPPPPV---KSPPPPA-PVASPPPPV---KSPPPPTPVASPPPPAPVASSPPPMKSPPPP 642

Query: 302  PPVYKYNSPPPPYKYPSPP------PPPYKYPSPPPPVYKYKSPPPPVYKYKSP-----P 448
             PV   +SPPPP K P PP      PPP +YP+PP  V   KS PPP      P     P
Sbjct: 643  TPV---SSPPPPEKSPPPPPPAKSTPPPEEYPTPPTSV---KSSPPPEKSLPPPTLIPSP 696

Query: 449  PPAKKPY--KYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
            PP +KP     PS PP   +  SPP    S PP   K   PP PV S
Sbjct: 697  PPQEKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQTPKSSPPPAPVSS 743

 Score =  153 bits (387), Expect = 8e-36
 Identities = 100/203 (49%), Positives = 102/203 (50%), Gaps = 11/203 (5%)
 Frame = +2

Query: 8    SPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYPSPP------PPPYKYPSPPPPVY 154
            SPPPP     P  P   PSPPPPV    SPPPP K P PP      PPP K P PP PV 
Sbjct: 515  SPPPPVKTTSPPAPIGSPSPPPPV-SVVSPPPPVKSPPPPAPVGSPPPPEKSPPPPAPV- 572

Query: 155  KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPP 334
               SPPPPV   KSPPPP     SPPPPV   KSPPPP        SPPPPV    SPPP
Sbjct: 573  --ASPPPPV---KSPPPPTL-VASPPPPV---KSPPPPAP----VASPPPPV---KSPPP 616

Query: 335  PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSP 514
            P    SPPPP     SPPP     KSPPPP     SPPPP K P               P
Sbjct: 617  PTPVASPPPPAPVASSPPP----MKSPPPPT-PVSSPPPPEKSP---------------P 656

Query: 515  PPPVYSPPPPVYKYKSPPPPVYS 583
            PPP     PP  +Y +PP  V S
Sbjct: 657  PPPPAKSTPPPEEYPTPPTSVKS 679

 Score =  152 bits (383), Expect = 2e-35
 Identities = 109/256 (42%), Positives = 113/256 (44%), Gaps = 65/256 (25%)
 Frame = +2

Query: 5    KSPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYPSPP------PPPYKYPSPPPPV 151
            KSPPPP     P  P K P PP PV    SPPPP K P PP      PPP K P PP PV
Sbjct: 548  KSPPPPAPVGSPPPPEKSPPPPAPVA---SPPPPVKSPPPPTLVASPPPPVKSPPPPAPV 604

Query: 152  YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY------KYKSPPPP-----PKKPYKYPSP 298
                SPPPPV   KSPPPP     SPPPP          KSPPPP     P  P K P P
Sbjct: 605  ---ASPPPPV---KSPPPPT-PVASPPPPAPVASSPPPMKSPPPPTPVSSPPPPEKSPPP 657

Query: 299  PPPVYKYNSPPPPYKYPSPP-------------PPPYKYPSPPP---------------- 391
            PPP     S PPP +YP+PP             PPP   PSPPP                
Sbjct: 658  PPPA---KSTPPPEEYPTPPTSVKSSPPPEKSLPPPTLIPSPPPQEKPTPPSTPSKPPSS 714

Query: 392  -----PVYKYKSPPPPVYKYKSPPPPAKKPYKYP--SPP-------PPVYKYKSPPPPVY 529
                 P  +  S PP   K   PP P   P   P  SPP       PP  K  SPPP   
Sbjct: 715  PEKPSPPKEPVSSPPQTPKSSPPPAPVSSPPPTPVSSPPALAPVSSPPSVK-SSPPPAPL 773

Query: 530  SPPPPVYKYKSPPPPV 577
            S PPP  + KS PPPV
Sbjct: 774  SSPPPAPQVKSSPPPV 789

 Score =  148 bits (374), Expect = 3e-34
 Identities = 101/216 (46%), Positives = 105/216 (48%), Gaps = 28/216 (12%)
 Frame = +2

Query: 20   PPKKPYKYPSP-----PPPVYKYNSPPPPYKYPSPPPPPYKYPSP-----PPPVYKYKSP 169
            PP +P   P P     PPP+ K  S PPP    SPP  P   P P     PPP  K   P
Sbjct: 892  PPSEPKSSPPPTPVSLPPPIVK--SSPPPAMVSSPPMTPKSSPPPVVVSSPPPTVKSSPP 949

Query: 170  P-----PPVYKYKSPPP-----PVYKYKSPPPPVYKYKSPPPPPKK---PYKYPSPPPPV 310
            P     PP     SPPP     P  + KS PPP     SPPP PK    P    SPPPP 
Sbjct: 950  PAPVSSPPATPKSSPPPAPVNLPPPEVKSSPPPT-PVSSPPPAPKSSPPPAPMSSPPPPE 1008

Query: 311  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK-----KPYKY 475
             K  SPPPP    SPPPP  K P PP PV    SPPPPV   KSPPPPA       P K 
Sbjct: 1009 VK--SPPPPAPVSSPPPP-VKSPPPPAPV---SSPPPPV---KSPPPPAPVSSPPPPVKS 1059

Query: 476  PSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
            P PP P+    SPPPPV   PPP     SPPPPV S
Sbjct: 1060 PPPPAPI---SSPPPPV-KSPPPPAPVSSPPPPVKS 1091

 Score =  145 bits (365), Expect = 3e-33
 Identities = 101/220 (45%), Positives = 108/220 (49%), Gaps = 31/220 (14%)
 Frame = +2

Query: 8    SPP--PPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSP-----PPPVYKYKS 166
            SPP  P P  P  + S PP V K ++PP P    SPP  P   P P     PPP+ K   
Sbjct: 857  SPPLTPKPASPPAHVSSPPEVVKPSTPPAPTTVISPPSEPKSSPPPTPVSLPPPIVKSSP 916

Query: 167  PP-----PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP-----PPKKPYKYPSP-----P 301
            PP     PP+    SPPP V    S PPP  K  SPPP     PP  P   P P     P
Sbjct: 917  PPAMVSSPPMTPKSSPPPVVV---SSPPPTVK-SSPPPAPVSSPPATPKSSPPPAPVNLP 972

Query: 302  PPVYKYNSPPPPYKYPSPPP----PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP- 466
            PP  K + PP P   P P P    PP    SPPPP  + KSPPPP     SPPPP K P 
Sbjct: 973  PPEVKSSPPPTPVSSPPPAPKSSPPPAPMSSPPPP--EVKSPPPPA-PVSSPPPPVKSPP 1029

Query: 467  --YKYPSPPPPVYKYKSPPPPV-Y-SPPPPVYKYKSPPPP 574
                  SPPPPV   KSPPPP    SPPPPV   KSPPPP
Sbjct: 1030 PPAPVSSPPPPV---KSPPPPAPVSSPPPPV---KSPPPP 1063

 Score =  144 bits (364), Expect = 4e-33
 Identities = 92/197 (46%), Positives = 100/197 (50%), Gaps = 31/197 (15%)
 Frame = +2

Query: 5    KSPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYPSPP------PPPYKYPSPPPPV 151
            KSPPPP     P  P K P PP PV   +SPPPP K P PP      PPP K P PP P+
Sbjct: 1010 KSPPPPAPVSSPPPPVKSPPPPAPV---SSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPI 1066

Query: 152  YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPP 331
                SPPPPV   KSPPPP     SPPPPV   KSPPPP        SPPPP+    SPP
Sbjct: 1067 ---SSPPPPV---KSPPPPA-PVSSPPPPV---KSPPPPAP----VSSPPPPI---KSPP 1109

Query: 332  PPYKYPSPPPPPYKYPSPPPPVYKYKSPP-----PPVYKYKSPPPPAKKP---------- 466
            PP    SPPP P K PS PPP      PP     PP  + +S PPPA+            
Sbjct: 1110 PPAPVSSPPPAPVKPPSLPPPAPVSSPPPVVTPAPPKKEEQSLPPPAESQPPPSFNDIIL 1169

Query: 467  -----YKYPSPPPPVYK 502
                  KY SPPPP ++
Sbjct: 1170 PPIMANKYASPPPPQFQ 1186

 Score =  141 bits (355), Expect = 4e-32
 Identities = 106/265 (40%), Positives = 111/265 (41%), Gaps = 73/265 (27%)
 Frame = +2

Query: 8    SPPPPPKK--PYKYPSPPPPVYKYNSPPPPYKYP-------------------------- 103
            SPP  PK   P+   S PPPV K + PP P   P                          
Sbjct: 825  SPPLAPKSSPPHVVVSSPPPVVKSSPPPAPVSSPPLTPKPASPPAHVSSPPEVVKPSTPP 884

Query: 104  ------SPPPPPYKYPSP-----PPPVYKYKSPP-----PPVYKYKSPPPPVYKYKSPPP 235
                  SPP  P   P P     PPP+ K   PP     PP+    SPPP V    S PP
Sbjct: 885  APTTVISPPSEPKSSPPPTPVSLPPPIVKSSPPPAMVSSPPMTPKSSPPPVVV---SSPP 941

Query: 236  PVYKYKSPPP-----PPKKPYKYPSP-----PPPVYKYNSPPPPYKYP------------ 349
            P  K  SPPP     PP  P   P P     PPP  K + PP P   P            
Sbjct: 942  PTVK-SSPPPAPVSSPPATPKSSPPPAPVNLPPPEVKSSPPPTPVSSPPPAPKSSPPPAP 1000

Query: 350  --SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPA-----KKPYKYPSPPPPVYKYK 508
              SPPPP  K P PP PV    SPPPPV   KSPPPPA       P K P PP PV    
Sbjct: 1001 MSSPPPPEVKSPPPPAPV---SSPPPPV---KSPPPPAPVSSPPPPVKSPPPPAPV---S 1051

Query: 509  SPPPPVYSPPPPVYKYKSPPPPVYS 583
            SPPPPV SPPPP     SPPPPV S
Sbjct: 1052 SPPPPVKSPPPPA-PISSPPPPVKS 1075

 Score =  127 bits (318), Expect = 8e-28
 Identities = 94/241 (39%), Positives = 105/241 (43%), Gaps = 51/241 (21%)
 Frame = +2

Query: 5    KSPPPPPKK-----PYKYPSPP------PPVYKYNSPP------PPYKYPSPPPPPYKYP 133
            KSPPPPP       P +YP+PP      PP  K   PP      PP + P+PP  P K P
Sbjct: 653  KSPPPPPPAKSTPPPEEYPTPPTSVKSSPPPEKSLPPPTLIPSPPPQEKPTPPSTPSKPP 712

Query: 134  SPP----PPVYKYKSPP------PPVYKYKSPPP-PVYKYKSPPPPVYKYKSPPPPPKKP 280
            S P    PP     SPP      PP     SPPP PV    S PP +    SPP     P
Sbjct: 713  SSPEKPSPPKEPVSSPPQTPKSSPPPAPVSSPPPTPV----SSPPALAPVSSPPSVKSSP 768

Query: 281  YKYP-SPPPPVYKYNSPPPPYKYPSPPPPPYKYP-----SPPPPVYKYKSPPPPVYKYKS 442
               P S PPP  +  S PPP +  SPPP P   P     S PP V K   PP P+    S
Sbjct: 769  PPAPLSSPPPAPQVKSSPPPVQVSSPPPAPKSSPPLAPVSSPPQVEKTSPPPAPL---SS 825

Query: 443  PP--PPAKKPYKYPSPPPPVYKYKSPPPPVYSP---------------PPPVYKYKSPPP 571
            PP  P +  P+   S PPPV K   PP PV SP               PP V K  +PP 
Sbjct: 826  PPLAPKSSPPHVVVSSPPPVVKSSPPPAPVSSPPLTPKPASPPAHVSSPPEVVKPSTPPA 885

Query: 572  P 574
            P
Sbjct: 886  P 886

 Score =  124 bits (312), Expect = 4e-27
 Identities = 93/193 (48%), Positives = 95/193 (49%), Gaps = 4/193 (2%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPP-PYKYPSPPPPPYKYPSP-PPPVYKYKSPPPPV 181
           S P P K     P P P      SP P P   P P P P   P+P  PP   Y  P PPV
Sbjct: 418 SSPVPGKPAASAPMPSPHTPPDVSPEPLPEPSPVPAPAPMPMPTPHSPPADDYVPPTPPV 477

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
              KSPP       SP P V    +  PPP    K   P  PV    SPPPP K  SPP 
Sbjct: 478 -PGKSPPAT-----SPSPQVQPPAASTPPPSL-VKLSPPQAPV---GSPPPPVKTTSPPA 527

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPP--VYSP 535
           P    PSPPPPV    SPPPPV   KSPPPPA       SPPPP    KSPPPP  V SP
Sbjct: 528 P-IGSPSPPPPV-SVVSPPPPV---KSPPPPAP----VGSPPPPE---KSPPPPAPVASP 575

Query: 536 PPPVYKYKSPPPP 574
           PPPV   KSPPPP
Sbjct: 576 PPPV---KSPPPP 585

 Score =  123 bits (308), Expect = 1e-26
 Identities = 98/265 (36%), Positives = 106/265 (40%), Gaps = 76/265 (28%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP------SPP------PPPYKYPSPP--- 142
            SPPP P+      S PPPV   + PP P   P      SPP      PPP    SPP   
Sbjct: 775  SPPPAPQ----VKSSPPPVQVSSPPPAPKSSPPLAPVSSPPQVEKTSPPPAPLSSPPLAP 830

Query: 143  ---PPVYKYKSPPPPVYKYKSPPPPVYK------------YKSPPPPVYKYKSPP----- 262
               PP     S PPPV K   PP PV              + S PP V K  +PP     
Sbjct: 831  KSSPPHVVVSS-PPPVVKSSPPPAPVSSPPLTPKPASPPAHVSSPPEVVKPSTPPAPTTV 889

Query: 263  -PPPKKPYKYPSP-----PPPVYKYNSP----------------------PPPYKYPSPP 358
              PP +P   P P     PPP+ K + P                      PPP    SPP
Sbjct: 890  ISPPSEPKSSPPPTPVSLPPPIVKSSPPPAMVSSPPMTPKSSPPPVVVSSPPPTVKSSPP 949

Query: 359  PPPYKYP------SPPP-----PVYKYKSPPPPVYKYKSPPPPAKKPYKYP--SPPPPVY 499
            P P   P      SPPP     P  + KS PPP      PP P   P   P  SPPPP  
Sbjct: 950  PAPVSSPPATPKSSPPPAPVNLPPPEVKSSPPPTPVSSPPPAPKSSPPPAPMSSPPPPEV 1009

Query: 500  KYKSPPPPVYSPPPPVYKYKSPPPP 574
            K   PP PV SPPPPV   KSPPPP
Sbjct: 1010 KSPPPPAPVSSPPPPV---KSPPPP 1031

 Score =  122 bits (306), Expect = 2e-26
 Identities = 92/241 (38%), Positives = 101/241 (41%), Gaps = 49/241 (20%)
 Frame = +2

Query: 8    SPPP-----PPKKPYKYPSPP----PPVYKYNSPP-------PPYKYPSPPP-----PPY 124
            SPPP     PP  P K PS P    PP    +SPP       PP    SPPP     PP 
Sbjct: 695  SPPPQEKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQTPKSSPPPAPVSSPPPTPVSSPPA 754

Query: 125  KYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPP 304
              P   PP  K   PP P+    S PPP  + KS PPPV +  SPPP PK         P
Sbjct: 755  LAPVSSPPSVKSSPPPAPL----SSPPPAPQVKSSPPPV-QVSSPPPAPKSS-------P 802

Query: 305  PVYKYNSP-------PPPYKYPSPP-----PPPYKYPSPPPPVYKYKSPPPPVYKYKSPP 448
            P+   +SP       PPP    SPP      PP+   S PPPV K   PP PV      P
Sbjct: 803  PLAPVSSPPQVEKTSPPPAPLSSPPLAPKSSPPHVVVSSPPPVVKSSPPPAPVSSPPLTP 862

Query: 449  PPAKKPYKYPSPP----------------PPVYKYKSPPPPVYSPPPPVYKYKSPPPPVY 580
             PA  P    SPP                PP     SPPP   S PPP+ K  SPPP + 
Sbjct: 863  KPASPPAHVSSPPEVVKPSTPPAPTTVISPPSEPKSSPPPTPVSLPPPIVK-SSPPPAMV 921

Query: 581  S 583
            S
Sbjct: 922  S 922

 Score =  115 bits (287), Expect = 3e-24
 Identities = 81/193 (41%), Positives = 88/193 (45%), Gaps = 2/193 (1%)
 Frame = +2

Query: 11  PP--PPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           PP  P P KP      P P    +  P P   PSP P P   P P P         PP  
Sbjct: 416 PPSSPVPGKPAASAPMPSPHTPPDVSPEPLPEPSPVPAPAPMPMPTPH-------SPPAD 468

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
            Y  P PPV   KSPP       + P P  +P    +PPP + K + P  P      PPP
Sbjct: 469 DYVPPTPPV-PGKSPPA------TSPSPQVQPPAASTPPPSLVKLSPPQAPV---GSPPP 518

Query: 365 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPP 544
           P K  SPP P+    SPPPPV    SPPPP K P     PP PV    SPPPP  SPPPP
Sbjct: 519 PVKTTSPPAPIGS-PSPPPPV-SVVSPPPPVKSP----PPPAPV---GSPPPPEKSPPPP 569

Query: 545 VYKYKSPPPPVYS 583
                SPPPPV S
Sbjct: 570 A-PVASPPPPVKS 581

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 65/166 (39%), Positives = 71/166 (42%), Gaps = 7/166 (4%)
 Frame = +2

Query: 98  YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKK 277
           YP+P   P   P P  P      P P      SP P       P P      +P  PP  
Sbjct: 409 YPTPGGGPPSSPVPGKPAASAPMPSPHTPPDVSPEPLPEPSPVPAPAPMPMPTPHSPPAD 468

Query: 278 PYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYK-------SPPPPVYKY 436
            Y  P+PP P        PP   PSP   P    +PPP + K         SPPPPV   
Sbjct: 469 DYVPPTPPVP-----GKSPPATSPSPQVQPPAASTPPPSLVKLSPPQAPVGSPPPPVK-- 521

Query: 437 KSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            +  PPA  P   PSPPPPV    SPPPPV SPPPP     SPPPP
Sbjct: 522 -TTSPPA--PIGSPSPPPPV-SVVSPPPPVKSPPPPA-PVGSPPPP 562

 Score = 79.0 bits (193), Expect = 3e-13
 Identities = 52/121 (42%), Positives = 58/121 (47%), Gaps = 28/121 (23%)
 Frame = +2

Query: 5    KSPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYP-------SPPPPPYKYPSPPPP 148
            KSPPPP     P  P K P PP PV   +SPPPP K P       SPPP P K PS PPP
Sbjct: 1074 KSPPPPAPVSSPPPPVKSPPPPAPV---SSPPPPIKSPPPPAPVSSPPPAPVKPPSLPPP 1130

Query: 149  VYKYKSPP-----PPVYKYKSPPPPVYKYKSPPPPVY-----------KYKSPPPPPKKP 280
                  PP     PP  + +S PPP    +S PPP +           KY SPPPP  + 
Sbjct: 1131 APVSSPPPVVTPAPPKKEEQSLPPPA---ESQPPPSFNDIILPPIMANKYASPPPPQFQG 1187

Query: 281  Y 283
            Y
Sbjct: 1188 Y 1188

[107][TOP]
>UniRef100_Q39005 Cell wall protein n=1 Tax=Arabidopsis thaliana RepID=Q39005_ARATH
          Length = 305

 Score =  167 bits (423), Expect = 6e-40
 Identities = 111/233 (47%), Positives = 121/233 (51%), Gaps = 41/233 (17%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSP---PPPVYKYNSPP---PPYKYPSP----PPPPYKYPSP---P 142
           Y  P PPP +  KYP P   PPP+ KY  PP   PP KYP P    P PP KYP P   P
Sbjct: 51  YSPPKPPPIE--KYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYP 108

Query: 143 PPVYKYKSP---PPPVYKYKSPP---PPVYKYKSP---PPPVYKYKSP---PPPPKKPYK 286
           PP+ KY  P   PPP+ KY  P    PP  KY  P   PPPV KY  P   PPP KK   
Sbjct: 109 PPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPVKKYPPPEHYPPPIKKYPP 168

Query: 287 YPSPPPPVYKYNSPPPPYKYPSPP---PPPYKYPSP----PPPVYKYKSP---PPPVYKY 436
               PPP+ KY   PPP KYP P    PPP +YP P    PPP+ KY  P   PPP+  Y
Sbjct: 169 QEQYPPPIKKY---PPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTY 225

Query: 437 KSPP---PPAKKPYK-YPSPPPPVY--KYKSPPPPVYSPPPPVYKYKSPPPPV 577
             PP   PP   PYK YP PP   Y    + PPPP + P PP  KY   PPPV
Sbjct: 226 PHPPVKYPPP--PYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKY---PPPV 273

 Score =  142 bits (357), Expect = 2e-32
 Identities = 100/216 (46%), Positives = 113/216 (52%), Gaps = 32/216 (14%)
 Frame = +2

Query: 23  PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPP 202
           PK PY  P  PPP+ KY   PPP +YP   PP  KYP PP     Y+ PP    KY   P
Sbjct: 47  PKFPYS-PPKPPPIEKY---PPPVQYP---PPIKKYPPPP-----YEHPP---VKY---P 88

Query: 203 PPVYKYKSPP---PPVYKYKSPPPPPKKPYKYPSP---PPPVYKYNSP----PPPYKYPS 352
           PP+  Y  PP   PP  +Y   PPP K   KYP P   PPP+ KY  P    PP  KYP 
Sbjct: 89  PPIKTYPHPPVKYPPPEQY---PPPIK---KYPPPEQYPPPIKKYPPPEQYSPPFKKYPP 142

Query: 353 P---PPPPYKYPSP---PPPVYKY---KSPPPPVYKYKSP---PPPAKK---PYKYPSP- 484
           P   PPP  KYP P   PPP+ KY   +  PPP+ KY  P   PPP KK   P +YP P 
Sbjct: 143 PEQYPPPVKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPI 202

Query: 485 ---PPPVYKYKSP---PPPVYSPPPPVYKYKSPPPP 574
              PPP+ KY  P   PPP+ + P P  KY  PPPP
Sbjct: 203 KKYPPPIKKYPPPEEYPPPIKTYPHPPVKY--PPPP 236

 Score =  135 bits (340), Expect = 2e-30
 Identities = 107/242 (44%), Positives = 118/242 (48%), Gaps = 55/242 (22%)
 Frame = +2

Query: 2   YKSPP---PPPKKPY-----KYPSP---PPPVYKY----NSPPPPYKYPSPP---PPPYK 127
           Y+ PP   PPP K Y     KYP P   PPP+ KY      PPP  KYP P    PP  K
Sbjct: 80  YEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKK 139

Query: 128 YPSP---PPPVYKYKSP---PPPVYKY---KSPPPPVYKYKSP---PPPVYKYKSPP--P 265
           YP P   PPPV KY  P   PPP+ KY   +  PPP+ KY  P   PPP+ KY  P   P
Sbjct: 140 YPPPEQYPPPVKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYP 199

Query: 266 PPKKPY-----KYPSP---PPPVYKY-----NSPPPPYK-YPSPP----PPPYKYPSPPP 391
           PP K Y     KYP P   PPP+  Y       PPPPYK YP PP    PPP + P PPP
Sbjct: 200 PPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECP-PPP 258

Query: 392 PVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPP-----VYKY 556
             Y    P PP  KY   PPP     +YPSPP     YK     ++S   P     VYKY
Sbjct: 259 EHY----PWPPKKKY---PPPV----EYPSPP-----YKKYLRLIHSNSKPNKDVFVYKY 302

Query: 557 KS 562
            S
Sbjct: 303 MS 304

 Score =  108 bits (269), Expect = 4e-22
 Identities = 70/147 (47%), Positives = 78/147 (53%), Gaps = 33/147 (22%)
 Frame = +2

Query: 236 PVYKYKSPPPPPKKPYKYPSP---PPPVYKYNSPP---PPYKYPSP----PPPPYKYPSP 385
           P + Y  P PPP +  KYP P   PPP+ KY  PP   PP KYP P    P PP KYP P
Sbjct: 47  PKFPYSPPKPPPIE--KYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPP 104

Query: 386 ---PPPVYKYKSP---PPPVYKYKSPPPPAKKP--YKYPSP---PPPVYKYKSP---PPP 523
              PPP+ KY  P   PPP+ KY  PPP    P   KYP P   PPPV KY  P   PPP
Sbjct: 105 EQYPPPIKKYPPPEQYPPPIKKY--PPPEQYSPPFKKYPPPEQYPPPVKKYPPPEHYPPP 162

Query: 524 V--YSP----PPPVYKYKSP---PPPV 577
           +  Y P    PPP+ KY  P   PPP+
Sbjct: 163 IKKYPPQEQYPPPIKKYPPPEKYPPPI 189

[108][TOP]
>UniRef100_Q84JV0 Putative cell wall protein n=1 Tax=Arabidopsis thaliana
           RepID=Q84JV0_ARATH
          Length = 288

 Score =  167 bits (422), Expect = 7e-40
 Identities = 110/233 (47%), Positives = 121/233 (51%), Gaps = 41/233 (17%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSP---PPPVYKYNSPP---PPYKYPSP----PPPPYKYPSP---P 142
           Y  P PPP +  KYP P   PPP+ KY  PP   PP KYP P    P PP KYP P   P
Sbjct: 51  YSPPKPPPIE--KYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYP 108

Query: 143 PPVYKYKSP---PPPVYKYKSPP---PPVYKYKSP---PPPVYKYKSP---PPPPKKPYK 286
           PP+ KY  P   PPP+ KY  P    PP  KY  P   PPP+ KY  P   PPP KK   
Sbjct: 109 PPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPPIKKYPP 168

Query: 287 YPSPPPPVYKYNSPPPPYKYPSPP---PPPYKYPSP----PPPVYKYKSP---PPPVYKY 436
               PPP+ KY   PPP KYP P    PPP +YP P    PPP+ KY  P   PPP+  Y
Sbjct: 169 QEQYPPPIKKY---PPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTY 225

Query: 437 KSPP---PPAKKPYK-YPSPPPPVY--KYKSPPPPVYSPPPPVYKYKSPPPPV 577
             PP   PP   PYK YP PP   Y    + PPPP + P PP  KY   PPPV
Sbjct: 226 PHPPVKYPPP--PYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKY---PPPV 273

 Score =  141 bits (356), Expect = 3e-32
 Identities = 100/216 (46%), Positives = 113/216 (52%), Gaps = 32/216 (14%)
 Frame = +2

Query: 23  PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPP 202
           PK PY  P  PPP+ KY   PPP +YP   PP  KYP PP     Y+ PP    KY   P
Sbjct: 47  PKFPYS-PPKPPPIEKY---PPPVQYP---PPIKKYPPPP-----YEHPP---VKY---P 88

Query: 203 PPVYKYKSPP---PPVYKYKSPPPPPKKPYKYPSP---PPPVYKYNSP----PPPYKYPS 352
           PP+  Y  PP   PP  +Y   PPP K   KYP P   PPP+ KY  P    PP  KYP 
Sbjct: 89  PPIKTYPHPPVKYPPPEQY---PPPIK---KYPPPEQYPPPIKKYPPPEQYSPPFKKYPP 142

Query: 353 P---PPPPYKYPSP---PPPVYKY---KSPPPPVYKYKSP---PPPAKK---PYKYPSP- 484
           P   PPP  KYP P   PPP+ KY   +  PPP+ KY  P   PPP KK   P +YP P 
Sbjct: 143 PEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPI 202

Query: 485 ---PPPVYKYKSP---PPPVYSPPPPVYKYKSPPPP 574
              PPP+ KY  P   PPP+ + P P  KY  PPPP
Sbjct: 203 KKYPPPIKKYPPPEEYPPPIKTYPHPPVKY--PPPP 236

 Score =  135 bits (339), Expect = 3e-30
 Identities = 101/223 (45%), Positives = 111/223 (49%), Gaps = 50/223 (22%)
 Frame = +2

Query: 2   YKSPP---PPPKKPY-----KYPSP---PPPVYKY----NSPPPPYKYPSPP---PPPYK 127
           Y+ PP   PPP K Y     KYP P   PPP+ KY      PPP  KYP P    PP  K
Sbjct: 80  YEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKK 139

Query: 128 YPSP---PPPVYKYKSP---PPPVYKY---KSPPPPVYKYKSP---PPPVYKYKSPP--P 265
           YP P   PPP+ KY  P   PPP+ KY   +  PPP+ KY  P   PPP+ KY  P   P
Sbjct: 140 YPPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYP 199

Query: 266 PPKKPY-----KYPSP---PPPVYKY-----NSPPPPYK-YPSPP----PPPYKYPSPPP 391
           PP K Y     KYP P   PPP+  Y       PPPPYK YP PP    PPP + P PPP
Sbjct: 200 PPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECP-PPP 258

Query: 392 PVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP 520
             Y    P PP  KY   PPP     +YPSPP     YK  PP
Sbjct: 259 EHY----PWPPKKKY---PPPV----EYPSPP-----YKKYPP 285

 Score =  120 bits (302), Expect = 6e-26
 Identities = 85/193 (44%), Positives = 93/193 (48%), Gaps = 54/193 (27%)
 Frame = +2

Query: 5   KSPPP----PPKKPYKYPSP---PPPVYKYNSP----PPPYKYPSP---PPPPYKYPSP- 139
           K PPP    PP K  KYP P   PPP+ KY  P    PP  KYP P   PPP  KYP P 
Sbjct: 100 KYPPPEQYPPPIK--KYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPE 157

Query: 140 --PPPVYKY---KSPPPPVYKYKSP---PPPVYKYKSP----------PPPVYKYKSP-- 259
             PPP+ KY   +  PPP+ KY  P   PPP+ KY  P          PPP+ KY  P  
Sbjct: 158 HYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEE 217

Query: 260 -PPP----PKKPYKYPSPP------PPVYKY----NSPPPPYKYPSPP----PPPYKYPS 382
            PPP    P  P KYP PP      PP+  Y      PPPP  YP PP    PPP +YPS
Sbjct: 218 YPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPPPVEYPS 277

Query: 383 PPPPVYKYKSPPP 421
           PP    KY    P
Sbjct: 278 PP--YKKYPPADP 288

 Score =  107 bits (268), Expect = 5e-22
 Identities = 69/147 (46%), Positives = 78/147 (53%), Gaps = 33/147 (22%)
 Frame = +2

Query: 236 PVYKYKSPPPPPKKPYKYPSP---PPPVYKYNSPP---PPYKYPSP----PPPPYKYPSP 385
           P + Y  P PPP +  KYP P   PPP+ KY  PP   PP KYP P    P PP KYP P
Sbjct: 47  PKFPYSPPKPPPIE--KYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPP 104

Query: 386 ---PPPVYKYKSP---PPPVYKYKSPPPPAKKP--YKYPSP---PPPVYKYKSP---PPP 523
              PPP+ KY  P   PPP+ KY  PPP    P   KYP P   PPP+ KY  P   PPP
Sbjct: 105 EQYPPPIKKYPPPEQYPPPIKKY--PPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPP 162

Query: 524 V--YSP----PPPVYKYKSP---PPPV 577
           +  Y P    PPP+ KY  P   PPP+
Sbjct: 163 IKKYPPQEQYPPPIKKYPPPEKYPPPI 189

[109][TOP]
>UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f.
           nagariensis RepID=Q9SBM1_VOLCA
          Length = 409

 Score =  166 bits (420), Expect = 1e-39
 Identities = 97/199 (48%), Positives = 102/199 (51%), Gaps = 9/199 (4%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPPP  P   P PPPP      PPPP   P PPPPP   PSPPPP      PPPP   
Sbjct: 86  SPPPPPPPPVPPPPPPPPP----PPPPPSPPPPPPPPPPPPPSPPPP-----PPPPPPPP 136

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPP-PPKKPYKYPSPPPPVYKYNSPPP-PYKYPSPPP 361
              PPPP     SP PP     SPPP PP  P   P P PP     SPPP P   P P P
Sbjct: 137 PNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSP 196

Query: 362 PPYKYPSP---PPPVYKYKSPPPPVYKYKSP-PPPAKKPYKYPSPPPPVYKYKSPP---P 520
           PP   PSP   PPP     SP PP     SP PPP + P+  PSPPPP     +PP   P
Sbjct: 197 PPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRP 256

Query: 521 PVYSPPPPVYKYKSPPPPV 577
           P  SPPPP+    SPPPP+
Sbjct: 257 PPPSPPPPLPPPPSPPPPL 275

 Score =  163 bits (413), Expect = 8e-39
 Identities = 92/190 (48%), Positives = 97/190 (51%), Gaps = 2/190 (1%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P PPPP      PPPP   PSP PPP   PSPPP       P PP    
Sbjct: 118 PPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPP 177

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPP--PPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
            SPPP       P PP     SPPP  PP+ P   PSP PP  +  SP PP   P P  P
Sbjct: 178 PSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPP---PSPNPPSPRPPSPSPPSPRPPPRRP 234

Query: 365 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPP 544
           P+  PSPPPP     +PPPP     SPPPP   P   PSPPPP+    SPPPP  SPPPP
Sbjct: 235 PFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPP---PSPPPPLPPPPSPPPP--SPPPP 289

Query: 545 VYKYKSPPPP 574
                SP PP
Sbjct: 290 SPLPPSPRPP 299

 Score =  158 bits (400), Expect = 3e-37
 Identities = 93/195 (47%), Positives = 97/195 (49%), Gaps = 7/195 (3%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           PPPPP  P   P P PP+    SPPPP   P PPPPP   P PPPP     SPPPP    
Sbjct: 67  PPPPPPPP---PPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPP-----SPPPP---- 114

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             PPPP     SPPPP      PPPPP  P   P PPPP       PPP   PSPPP P 
Sbjct: 115 --PPPPPPPPPSPPPPP---PPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPP 169

Query: 371 KYPSPPPPVYKYKSPP--PPVYKYKSP---PPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
             P P PP     SPP  PP     SP   PPP+  P   PSP PP  +  SP PP   P
Sbjct: 170 PSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRP 229

Query: 536 PP--PVYKYKSPPPP 574
           PP  P +   SPPPP
Sbjct: 230 PPRRPPFPPPSPPPP 244

 Score =  156 bits (395), Expect = 1e-36
 Identities = 93/204 (45%), Positives = 102/204 (50%), Gaps = 15/204 (7%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSP-PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           +PPPPP  P   PSPPP       P PPP   PSPPP P   P P PP     SPPP   
Sbjct: 138 NPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPP 197

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSP------PPPPKKPYKYPSPPPPVYKYNSPPPPY-K 343
               P PP     SP PP  +  SP      PPP + P+  PSPPPP     +PPPP   
Sbjct: 198 PSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPP 257

Query: 344 YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYK-------YPSPPPPVYK 502
            PSPPPP    PSPPPP+    SPPPP     SP PP+ +P K       +P PPPP   
Sbjct: 258 PPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPP 317

Query: 503 YKSPPPPVYSPPPPVYKYKSPPPP 574
              PPPP  SP PP     SPPPP
Sbjct: 318 PPRPPPP--SPNPPRPPPPSPPPP 339

 Score =  156 bits (394), Expect = 1e-36
 Identities = 87/191 (45%), Positives = 97/191 (50%), Gaps = 3/191 (1%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           P PPP+ P   PSP PP  +  SP PP   P P  PP+  PSPPPP     +PPPP    
Sbjct: 202 PSPPPRPP---PSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPP 258

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYK-YPSPPPPP 367
            SPPPP+    SPPPP+    SPPPP   P   PSP PP  +   P PP   +P PPPP 
Sbjct: 259 PSPPPPLPPPPSPPPPLPPPPSPPPPSPPP---PSPLPPSPRPPKPSPPNNPFPRPPPPN 315

Query: 368 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPV 547
              P PPPP      PPPP      PPPP+  P   P PPPP      PPPP   PP P 
Sbjct: 316 PPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNP---PRPPPPSPSPPKPPPPPSPPPRPP 372

Query: 548 YKYKSPP--PP 574
            +   PP  PP
Sbjct: 373 RRPPRPPRRPP 383

 Score =  150 bits (378), Expect = 9e-35
 Identities = 88/191 (46%), Positives = 96/191 (50%), Gaps = 3/191 (1%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           P PPP  P   P  PPP    + PP P   P P PPP   PSP PP  +  SP PP  + 
Sbjct: 170 PSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPR- 228

Query: 191 KSPPP--PVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY-KYPSPPP 361
             PPP  P +   SPPPP     +PPPP   P   PSPPPP+    SPPPP    PSPPP
Sbjct: 229 --PPPRRPPFPPPSPPPPRPPPPAPPPPRPPP---PSPPPPLPPPPSPPPPLPPPPSPPP 283

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPP 541
           P    PSP PP  +   P PP   +  PPPP   P   P PPPP      PPPP  SPPP
Sbjct: 284 PSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPP---PRPPPPSPNPPRPPPP--SPPP 338

Query: 542 PVYKYKSPPPP 574
           P     SP PP
Sbjct: 339 PRPPPPSPNPP 349

 Score =  150 bits (378), Expect = 9e-35
 Identities = 88/190 (46%), Positives = 94/190 (49%), Gaps = 2/190 (1%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           P PPP  P   P  PPP     SP PP   P SP PPP + P PPP      SPPPP   
Sbjct: 194 PSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPP------SPPPPRPP 247

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSP-PPPYKYPSPPPP 364
             +PPPP     SPPPP+    SPPPP   P   PSPPPP     SP PP  + P P PP
Sbjct: 248 PPAPPPPRPPPPSPPPPLPPPPSPPPPLPPP---PSPPPPSPPPPSPLPPSPRPPKPSPP 304

Query: 365 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPP 544
              +P PPPP      PPPP      PPPP+  P   P PPPP      PPPP  SPP P
Sbjct: 305 NNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPP---PRPPPPSPNPPRPPPPSPSPPKP 361

Query: 545 VYKYKSPPPP 574
                 PPPP
Sbjct: 362 ------PPPP 365

 Score =  149 bits (376), Expect = 2e-34
 Identities = 91/196 (46%), Positives = 94/196 (47%), Gaps = 8/196 (4%)
 Frame = +2

Query: 11  PP--PPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY----KYPSPPPPVYKYKSPP 172
           PP  PPP  P     PP P    + PPPP   P PPPPP       PSPPPP      PP
Sbjct: 42  PPGSPPPGTPPPGVPPPTPSGPEHPPPPP---PPPPPPPQPPLPPSPSPPPP------PP 92

Query: 173 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPS 352
           PPV     PPPP     SPPPP      PPPPP  P   P PPPP      PPPP   PS
Sbjct: 93  PPVPPPPPPPPPPPPPPSPPPPP---PPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPS 149

Query: 353 PPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP-PAKKPYKYPSPPPPVYKYKSPPP-PV 526
           P PPP   PSPPP       P PP     SPPP P  +P   P P PP     SPPP P 
Sbjct: 150 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPP 209

Query: 527 YSPPPPVYKYKSPPPP 574
            SP PP  +  SP PP
Sbjct: 210 PSPNPPSPRPPSPSPP 225

 Score =  148 bits (374), Expect = 3e-34
 Identities = 89/193 (46%), Positives = 99/193 (51%), Gaps = 5/193 (2%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPP--PPYKYPSPPPPPYKYPSPPPPVYKYKSPPP--P 178
           P PPP  P + P  PPP    + PP  PP   PSP PP  + PSP PP  +   PPP  P
Sbjct: 178 PSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPR---PPPRRP 234

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY-KYPSP 355
            +   SPPPP     +PPPP     SPPPP   P   PSPPPP+    SPPPP    PSP
Sbjct: 235 PFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPP---PSPPPPLPPPPSPPPPSPPPPSP 291

Query: 356 PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
            PP  + P P PP   +  PPPP      PPPP+  P   P PPPP     SPPPP   P
Sbjct: 292 LPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNP---PRPPPP-----SPPPP--RP 341

Query: 536 PPPVYKYKSPPPP 574
           PPP      PPPP
Sbjct: 342 PPPSPNPPRPPPP 354

 Score =  139 bits (351), Expect = 1e-31
 Identities = 84/191 (43%), Positives = 89/191 (46%), Gaps = 5/191 (2%)
 Frame = +2

Query: 14  PPPPKKPY----KYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 181
           PPP + P     + P+ PPP     SPPP    P  PPP    P  PPP      PPPP 
Sbjct: 24  PPPRRSPVVALVETPAAPPP----GSPPPGTPPPGVPPPTPSGPEHPPP------PPPP- 72

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
                PPPP      P PP+    SPPPPP  P   P PPPP      PPPP   P PPP
Sbjct: 73  -----PPPP------PQPPLPPSPSPPPPPPPPVPPPPPPPP----PPPPPPSPPPPPPP 117

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP- 538
           PP   PSPPPP      PPPP     +PPPP   P   PSPPP       P PP   PP 
Sbjct: 118 PPPPPPSPPPP------PPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPS 171

Query: 539 PPVYKYKSPPP 571
           PP     SPPP
Sbjct: 172 PPPSPPPSPPP 182

 Score =  117 bits (292), Expect = 9e-25
 Identities = 76/163 (46%), Positives = 84/163 (51%), Gaps = 2/163 (1%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP-SPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           SPPPP   P   PSPPPP+    SPPPP   P SP PP  + P P PP   +  PPPP  
Sbjct: 260 SPPPPLPPP---PSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPP-- 314

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
              +PPPP      PPPP     SP PP   P   PSPPPP      PPPP   P+PP P
Sbjct: 315 ---NPPPP-----RPPPP-----SPNPPRPPP---PSPPPP-----RPPPP--SPNPPRP 351

Query: 365 PYKYPSPPPPVYKYKSPPPPVYKYKSPPP-PAKKPYKYPSPPP 490
           P   PSPP P      PPPP     SPPP P ++P + P  PP
Sbjct: 352 PPPSPSPPKP------PPPP-----SPPPRPPRRPPRPPRRPP 383

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 57/133 (42%), Positives = 61/133 (45%), Gaps = 3/133 (2%)
 Frame = +2

Query: 8   SPPPPPKKPY--KYPSPPPPVYKYNSPPPPYKYPS-PPPPPYKYPSPPPPVYKYKSPPPP 178
           SPPPP   P   + P P PP   +  PPPP   P  PPPP    P PPPP     SPPPP
Sbjct: 285 SPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPP-----SPPPP 339

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
                 PPPP     SP PP      PPPP   P   P PPPP      P PP + P  P
Sbjct: 340 -----RPPPP-----SPNPP-----RPPPPSPSP---PKPPPP------PSPPPRPPRRP 375

Query: 359 PPPYKYPSPPPPV 397
           P P + P   P V
Sbjct: 376 PRPPRRPPTAPGV 388

[110][TOP]
>UniRef100_B9EXV1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9EXV1_ORYSJ
          Length = 532

 Score =  165 bits (418), Expect = 2e-39
 Identities = 102/204 (50%), Positives = 111/204 (54%), Gaps = 16/204 (7%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           P PPP      PSPPPP     SPPPP   PSPPPP    PSPPPP     SPPPP    
Sbjct: 360 PSPPPPP----PSPPPP-----SPPPP--SPSPPPPSPPPPSPPPP---SPSPPPP---- 401

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY-------KYP 349
            SPPPP     SPPPP       PPPP  P   P PP PVY Y+SPPPPY       +Y 
Sbjct: 402 -SPPPP-----SPPPP----SPSPPPPSPPPPSPPPPSPVY-YSSPPPPYYEVSPEDRYL 450

Query: 350 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVY------KYKS 511
           SPPPPP  + +PPPP Y+      P  +Y SPPPP    Y+   PPPP Y      +Y S
Sbjct: 451 SPPPPPAYHEAPPPPYYEVS----PEDRYLSPPPP--PAYQETPPPPPQYEVSPEDRYLS 504

Query: 512 PPPPVYSPPP---PVYKYKSPPPP 574
           PPPP  SP     PVY+Y SPPPP
Sbjct: 505 PPPP--SPVKWKLPVYEYSSPPPP 526

 Score =  165 bits (418), Expect = 2e-39
 Identities = 101/204 (49%), Positives = 112/204 (54%), Gaps = 26/204 (12%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPPP      PSPPPP     SPPPP   PSPPPP    PSPPPP     SPPPP   
Sbjct: 361 SPPPPP------PSPPPP-----SPPPPS--PSPPPPSPPPPSPPPPS---PSPPPP--- 401

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSP-PPPPKKPYKYPSPPPPVYKYNSPPPPY-------K 343
             SPPPP     SPPPP     SP PPPP  P   P PP PVY Y+SPPPPY       +
Sbjct: 402 --SPPPP-----SPPPP-----SPSPPPPSPPPPSPPPPSPVY-YSSPPPPYYEVSPEDR 448

Query: 344 YPSPPPPPYKYPSPPPPVY------KYKSPPPPVYKYKSPPPPAKKPY----KYPSPPPP 493
           Y SPPPPP  + +PPPP Y      +Y SPPPP    ++PPPP +       +Y SPPPP
Sbjct: 449 YLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPEDRYLSPPPP 508

Query: 494 --------VYKYKSPPPPVYSPPP 541
                   VY+Y SPPPP  +  P
Sbjct: 509 SPVKWKLPVYEYSSPPPPAATWKP 532

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 63/118 (53%), Positives = 64/118 (54%), Gaps = 9/118 (7%)
 Frame = +2

Query: 254 SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 433
           SPPPPP      PSPPPP     SPPPP    SP PPP   PSPPPP     SPPPP   
Sbjct: 361 SPPPPP------PSPPPP-----SPPPP----SPSPPP---PSPPPP-----SPPPPS-- 395

Query: 434 YKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY--SPPP-------PVYKYKSPPPPVY 580
             SPPPP+  P   PSPPPP     SP PP    SPPP       PVY Y SPPPP Y
Sbjct: 396 -PSPPPPSPPP---PSPPPP-----SPSPP--PPSPPPPSPPPPSPVY-YSSPPPPYY 441

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 43/91 (47%), Positives = 51/91 (56%), Gaps = 7/91 (7%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYK 163
           Y SPPPPP     + +PPPP Y      +Y SPPPP  Y   PPPP +Y   P    +Y 
Sbjct: 449 YLSPPPPPA---YHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPED--RYL 503

Query: 164 SPPPP-VYKYKSPPPPVYKYKSPPPPVYKYK 253
           SPPPP   K+K    PVY+Y SPPPP   +K
Sbjct: 504 SPPPPSPVKWKL---PVYEYSSPPPPAATWK 531

[111][TOP]
>UniRef100_Q8L3T8 cDNA clone:001-201-A04, full insert sequence n=2 Tax=Oryza sativa
           RepID=Q8L3T8_ORYSJ
          Length = 570

 Score =  165 bits (418), Expect = 2e-39
 Identities = 102/204 (50%), Positives = 111/204 (54%), Gaps = 16/204 (7%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           P PPP      PSPPPP     SPPPP   PSPPPP    PSPPPP     SPPPP    
Sbjct: 398 PSPPPPP----PSPPPP-----SPPPP--SPSPPPPSPPPPSPPPP---SPSPPPP---- 439

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY-------KYP 349
            SPPPP     SPPPP       PPPP  P   P PP PVY Y+SPPPPY       +Y 
Sbjct: 440 -SPPPP-----SPPPP----SPSPPPPSPPPPSPPPPSPVY-YSSPPPPYYEVSPEDRYL 488

Query: 350 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVY------KYKS 511
           SPPPPP  + +PPPP Y+      P  +Y SPPPP    Y+   PPPP Y      +Y S
Sbjct: 489 SPPPPPAYHEAPPPPYYEVS----PEDRYLSPPPP--PAYQETPPPPPQYEVSPEDRYLS 542

Query: 512 PPPPVYSPPP---PVYKYKSPPPP 574
           PPPP  SP     PVY+Y SPPPP
Sbjct: 543 PPPP--SPVKWKLPVYEYSSPPPP 564

 Score =  165 bits (418), Expect = 2e-39
 Identities = 101/204 (49%), Positives = 112/204 (54%), Gaps = 26/204 (12%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPPP      PSPPPP     SPPPP   PSPPPP    PSPPPP     SPPPP   
Sbjct: 399 SPPPPP------PSPPPP-----SPPPPS--PSPPPPSPPPPSPPPPS---PSPPPP--- 439

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSP-PPPPKKPYKYPSPPPPVYKYNSPPPPY-------K 343
             SPPPP     SPPPP     SP PPPP  P   P PP PVY Y+SPPPPY       +
Sbjct: 440 --SPPPP-----SPPPP-----SPSPPPPSPPPPSPPPPSPVY-YSSPPPPYYEVSPEDR 486

Query: 344 YPSPPPPPYKYPSPPPPVY------KYKSPPPPVYKYKSPPPPAKKPY----KYPSPPPP 493
           Y SPPPPP  + +PPPP Y      +Y SPPPP    ++PPPP +       +Y SPPPP
Sbjct: 487 YLSPPPPPAYHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPEDRYLSPPPP 546

Query: 494 --------VYKYKSPPPPVYSPPP 541
                   VY+Y SPPPP  +  P
Sbjct: 547 SPVKWKLPVYEYSSPPPPAATWKP 570

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 63/118 (53%), Positives = 64/118 (54%), Gaps = 9/118 (7%)
 Frame = +2

Query: 254 SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 433
           SPPPPP      PSPPPP     SPPPP    SP PPP   PSPPPP     SPPPP   
Sbjct: 399 SPPPPP------PSPPPP-----SPPPP----SPSPPP---PSPPPP-----SPPPPS-- 433

Query: 434 YKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY--SPPP-------PVYKYKSPPPPVY 580
             SPPPP+  P   PSPPPP     SP PP    SPPP       PVY Y SPPPP Y
Sbjct: 434 -PSPPPPSPPP---PSPPPP-----SPSPP--PPSPPPPSPPPPSPVY-YSSPPPPYY 479

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 43/91 (47%), Positives = 51/91 (56%), Gaps = 7/91 (7%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVY------KYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYK 163
           Y SPPPPP     + +PPPP Y      +Y SPPPP  Y   PPPP +Y   P    +Y 
Sbjct: 487 YLSPPPPPA---YHEAPPPPYYEVSPEDRYLSPPPPPAYQETPPPPPQYEVSPED--RYL 541

Query: 164 SPPPP-VYKYKSPPPPVYKYKSPPPPVYKYK 253
           SPPPP   K+K    PVY+Y SPPPP   +K
Sbjct: 542 SPPPPSPVKWKL---PVYEYSSPPPPAATWK 569

[112][TOP]
>UniRef100_UPI0000E125D3 Os05g0552600 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000E125D3
          Length = 510

 Score =  165 bits (417), Expect = 3e-39
 Identities = 107/191 (56%), Positives = 112/191 (58%), Gaps = 1/191 (0%)
 Frame = +2

Query: 5   KSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           KSPPPP      + SPPPP  + + PPP Y   SPPPPP +   PPPPVY   SPPPPV 
Sbjct: 67  KSPPPP-----HHDSPPPP--RASPPPPVY---SPPPPPPRSSPPPPPVY---SPPPPV- 112

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
              SPPPPV    SPPPPV    SPPPP       PSPPPPV    + PPP   PSPPPP
Sbjct: 113 --SSPPPPV---PSPPPPV---SSPPPP------VPSPPPPV---PTSPPPSPLPSPPPP 155

Query: 365 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY-SPPP 541
                SPPPPV    SPPPPV    SPPPP       PSPPPPV    SPPPPV  SPPP
Sbjct: 156 VPS--SPPPPV---SSPPPPVPS--SPPPPV-----VPSPPPPV--LSSPPPPVVASPPP 201

Query: 542 PVYKYKSPPPP 574
           PV    SPPPP
Sbjct: 202 PV--VPSPPPP 210

 Score =  148 bits (374), Expect = 3e-34
 Identities = 95/171 (55%), Positives = 100/171 (58%), Gaps = 1/171 (0%)
 Frame = +2

Query: 68  KYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYK 247
           K+   PPP  + SPPPP     SPPPPVY   SPPPP  +   PPPPVY   SPPPPV  
Sbjct: 64  KHEKSPPPPHHDSPPPPR---ASPPPPVY---SPPPPPPRSSPPPPPVY---SPPPPV-- 112

Query: 248 YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 427
             SPPPP       PSPPPPV   +SPPPP   PSPPPP    P+ PPP     SPPPPV
Sbjct: 113 -SSPPPP------VPSPPPPV---SSPPPPV--PSPPPP---VPTSPPPS-PLPSPPPPV 156

Query: 428 YKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY-SPPPPVYKYKSPPPPV 577
               SPPPP        SPPPPV    SPPPPV  SPPPPV    SPPPPV
Sbjct: 157 PS--SPPPPVS------SPPPPVPS--SPPPPVVPSPPPPV--LSSPPPPV 195

 Score =  123 bits (309), Expect = 9e-27
 Identities = 83/142 (58%), Positives = 85/142 (59%), Gaps = 1/142 (0%)
 Frame = +2

Query: 161 KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY 340
           KSPPPP   + SPPPP     SPPPPVY   SPPPPP  P   P PPPPVY   SPPPP 
Sbjct: 67  KSPPPP--HHDSPPPP---RASPPPPVY---SPPPPP--PRSSP-PPPPVY---SPPPPV 112

Query: 341 KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPP 520
              SPPPP    PSPPPPV    SPPPPV    SPPPP       P+ PPP     SPPP
Sbjct: 113 S--SPPPP---VPSPPPPV---SSPPPPV---PSPPPPV------PTSPPPS-PLPSPPP 154

Query: 521 PV-YSPPPPVYKYKSPPPPVYS 583
           PV  SPPPPV    SPPPPV S
Sbjct: 155 PVPSSPPPPV---SSPPPPVPS 173

 Score =  123 bits (308), Expect = 1e-26
 Identities = 89/181 (49%), Positives = 95/181 (52%), Gaps = 3/181 (1%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYP---SPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           Y  PPPPP+     P   SPPPPV   +SPPPP    SPPPP     SPPPPV    SPP
Sbjct: 89  YSPPPPPPRSSPPPPPVYSPPPPV---SSPPPPVP--SPPPP---VSSPPPPV---PSPP 137

Query: 173 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPS 352
           PPV    SPPP      SPPPPV    S PPPP       SPPPPV   +SPPPP   PS
Sbjct: 138 PPV--PTSPPPS--PLPSPPPPV---PSSPPPP-----VSSPPPPV--PSSPPPPV-VPS 182

Query: 353 PPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYS 532
           PPPP     SPPPPV    SPPPPV    SPPPP      Y +      +Y +   P Y 
Sbjct: 183 PPPPVLS--SPPPPV--VASPPPPV--VPSPPPPGASDVVYCTNKT---RYPTCTSPAYC 233

Query: 533 P 535
           P
Sbjct: 234 P 234

[113][TOP]
>UniRef100_Q4PSF3 Proline-rich extensin-like family protein n=1 Tax=Arabidopsis
           thaliana RepID=Q4PSF3_ARATH
          Length = 249

 Score =  165 bits (417), Expect = 3e-39
 Identities = 95/194 (48%), Positives = 99/194 (51%), Gaps = 5/194 (2%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SPPPPP       SPPPPV    SPPPP    SPPPPP     PPPPV     PPPPV  
Sbjct: 43  SPPPPP---VNISSPPPPVNL--SPPPPPVNLSPPPPPVNLSPPPPPV-NLSPPPPPVLL 96

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPP----PPKKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
             SPPPP      PPPPV     PPP    PP  P     PPPPV    SPPPP    SP
Sbjct: 97  --SPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNL--SPPPPPVLLSP 152

Query: 356 PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
           PPPP  + SPPPP      PPP + +   PP P    Y   +PPPP YKY    PP   P
Sbjct: 153 PPPPVLF-SPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPP 211

Query: 536 PPPVYKYK-SPPPP 574
           P     YK SPPPP
Sbjct: 212 PQAARSYKRSPPPP 225

 Score =  159 bits (403), Expect = 1e-37
 Identities = 98/206 (47%), Positives = 102/206 (49%), Gaps = 21/206 (10%)
 Frame = +2

Query: 20  PPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSP 199
           P   P    SPPPP    +SPPPP    SPPPPP     PPPPV    SPPPP      P
Sbjct: 34  PEPAPLVDLSPPPPPVNISSPPPPVNL-SPPPPPVNLSPPPPPV--NLSPPPPPVNLSPP 90

Query: 200 PPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYP 379
           PPPV     PPPPV    SPPPP   P     PPPPV    SPPPP    SPPPPP    
Sbjct: 91  PPPVL-LSPPPPPV--NLSPPPP---PVNLSPPPPPVLL--SPPPPPVLLSPPPPPVNLS 142

Query: 380 SPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYP----SPPPP-----VYKYKSPPPP--- 523
            PPPPV    SPPPP   +  PPP   +P   P    SPPPP      Y  K+PPPP   
Sbjct: 143 PPPPPV--LLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYK 200

Query: 524 ---VYSPPPP------VYKYKSPPPP 574
              VY PPPP       YK   PPPP
Sbjct: 201 YGRVYPPPPPPPQAARSYKRSPPPPP 226

 Score =  140 bits (353), Expect = 7e-32
 Identities = 86/182 (47%), Positives = 89/182 (48%), Gaps = 20/182 (10%)
 Frame = +2

Query: 8   SPPPPPKK------PYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP 169
           SPPPPP        P     PPPPV    SPPPP    SPPPPP     PPPPV     P
Sbjct: 70  SPPPPPVNLSPPPPPVNLSPPPPPVLL--SPPPPPVNLSPPPPPVNLSPPPPPVL-LSPP 126

Query: 170 PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP----KKPYKYPSPPPPVYKYNSPPPP 337
           PPPV    SPPPP      PPPPV    SPPPPP      P     PPPP     SPPPP
Sbjct: 127 PPPVLL--SPPPPPVNLSPPPPPVLL--SPPPPPVLFSPPPPTVTRPPPPPTITRSPPPP 182

Query: 338 ------YKYPSPPPPPYKY----PSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPP 487
                 Y   +PPPPPYKY    P PPPP    +S     YK   PPPP  K  +  SPP
Sbjct: 183 RPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARS-----YKRSPPPPPPSKYGRVYSPP 237

Query: 488 PP 493
           PP
Sbjct: 238 PP 239

 Score =  136 bits (342), Expect = 1e-30
 Identities = 83/173 (47%), Positives = 85/173 (49%), Gaps = 22/173 (12%)
 Frame = +2

Query: 8   SPPPPPKKPYKYP-----SPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           SPPPPP      P     SPPPP    + PPPP    SPPPPP     PPPPV    SPP
Sbjct: 79  SPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNL-SPPPPPVLLSPPPPPVLL--SPP 135

Query: 173 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP----PPKKPYKYPSPPPP------VYKYN 322
           PP      PPPPV    SPPPP   +  PPP    PP  P    SPPPP       YK  
Sbjct: 136 PPPVNLSPPPPPVLL--SPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKT 193

Query: 323 SPPPPYKYPSPPPPPYKYPSPPPP----VYKYKSPPPPVYKY---KSPPPPAK 460
            PPPPYKY    PPP     PPPP     YK   PPPP  KY    SPPPP K
Sbjct: 194 PPPPPYKYGRVYPPP-----PPPPQAARSYKRSPPPPPPSKYGRVYSPPPPGK 241

 Score =  119 bits (299), Expect = 1e-25
 Identities = 66/147 (44%), Positives = 70/147 (47%), Gaps = 9/147 (6%)
 Frame = +2

Query: 164 SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP-----PPKKPYKYPSPPPPVYKYNSP 328
           +P P      SPPPP     SPPPPV     PPP     PP  P     PPPPV    SP
Sbjct: 33  APEPAPLVDLSPPPPPVNISSPPPPV-NLSPPPPPVNLSPPPPPVNLSPPPPPVNL--SP 89

Query: 329 PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP----PAKKPYKYPSPPPPV 496
           PPP    SPPPPP     PPPPV     PPPPV     PPP    P   P     PPPPV
Sbjct: 90  PPPPVLLSPPPPPVNLSPPPPPV-NLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPV 148

Query: 497 YKYKSPPPPVYSPPPPVYKYKSPPPPV 577
                PPP ++SPPPP      PPP +
Sbjct: 149 LLSPPPPPVLFSPPPPTVTRPPPPPTI 175

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 49/111 (44%), Positives = 54/111 (48%), Gaps = 19/111 (17%)
 Frame = +2

Query: 8   SPPPPPKKPYKYP-----SPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPP---VYKYK 163
           SPPPPP      P     SPPPP   ++ PPP    P PPP   + P PP P    Y  K
Sbjct: 133 SPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKK 192

Query: 164 SPPPPVYKY-----KSPPPPV----YKYKSPPPPVYKYKS--PPPPPKKPY 283
           +PPPP YKY       PPPP     YK   PPPP  KY     PPPP K +
Sbjct: 193 TPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVYSPPPPGKSW 243

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 35/79 (44%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
 Frame = +2

Query: 5   KSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 184
           +SPPPP  +   Y       YK   PPPPYKY    PPP   P PP     YK  PPP  
Sbjct: 177 RSPPPPRPQAAAY-------YKKTPPPPPYKYGRVYPPP---PPPPQAARSYKRSPPP-- 224

Query: 185 KYKSPPPPVY-KYKSPPPP 238
               PPP  Y +  SPPPP
Sbjct: 225 ----PPPSKYGRVYSPPPP 239

[114][TOP]
>UniRef100_O81765 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=O81765_ARATH
          Length = 699

 Score =  164 bits (416), Expect = 4e-39
 Identities = 101/206 (49%), Positives = 110/206 (53%), Gaps = 20/206 (9%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPP------------PVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVY 154
            P P P +P + P PP             PV K  SPPP     SPPPP Y  P PPPPV+
Sbjct: 483  PSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPA-PVNSPPPPVYSPPPPPPPVH 541

Query: 155  KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP-KKPYKYPSPPPPVYKYNSPP 331
               SPPPPV+    PPPPVY    PPPPV+   SPPPP    P    SPPPPV+   SPP
Sbjct: 542  ---SPPPPVHS--PPPPPVYSPPPPPPPVH---SPPPPVFSPPPPVYSPPPPVH---SPP 590

Query: 332  PPYKYPSP------PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPP 493
            PP   P P      PPPP   P PPPPVY   SPPPPV+   SPPP    P  Y  PP P
Sbjct: 591  PPVHSPPPPAPVHSPPPPVHSPPPPPPVY---SPPPPVF---SPPPSQSPPVVYSPPPRP 644

Query: 494  VYKYKSPPPPVYSPPP-PVYKYKSPP 568
                K   PPV SPPP PV K ++PP
Sbjct: 645  P---KINSPPVQSPPPAPVEKKETPP 667

 Score =  162 bits (409), Expect = 2e-38
 Identities = 102/211 (48%), Positives = 118/211 (55%), Gaps = 18/211 (8%)
 Frame = +2

Query: 5    KSPPP-----PPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSP 169
            +SPPP     PP   Y  P PPPPV+   SPPPP   P PPPP Y  P PPPPV+   SP
Sbjct: 516  RSPPPAPVNSPPPPVYSPPPPPPPVH---SPPPPVHSP-PPPPVYSPPPPPPPVH---SP 568

Query: 170  PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYP 349
            PPPV+   SPPPPVY   SPPPPV+   SPPPP   P     PP PV+   SPPPP   P
Sbjct: 569  PPPVF---SPPPPVY---SPPPPVH---SPPPPVHSP----PPPAPVH---SPPPPVHSP 612

Query: 350  SPPPPPYKYPSPPPPVYKYKSPPP---PVYKYKSPPPPAK--KPYKYPSPPPPVYKYKSP 514
             PPPP     SPPPPV+   SPPP   P   Y  PP P K   P     PP PV K ++P
Sbjct: 613  PPPPP---VYSPPPPVF---SPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPVEKKETP 666

Query: 515  PPPVYSP-------PPPV-YKYKSPPPPVYS 583
            P    +P       PP + ++Y SPPPP+++
Sbjct: 667  PAHAPAPSDDEFIIPPFIGHQYASPPPPMFA 697

 Score =  160 bits (405), Expect = 7e-38
 Identities = 104/205 (50%), Positives = 114/205 (55%), Gaps = 16/205 (7%)
 Frame = +2

Query: 5   KSPPPPPKKPYKYPSP----------PPPVYKYNSPPPPYKYPSPPPPPYKYP-----SP 139
           + P P P  P   PSP          P P      P PP + P P  P  + P     SP
Sbjct: 459 QKPSPVPTTPVHEPSPVLATPVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSP 518

Query: 140 PP-PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYK 316
           PP PV    SPPPPVY    PPPPV+   SPPPPV+   SPPPPP   Y  P PPPPV+ 
Sbjct: 519 PPAPV---NSPPPPVYSPPPPPPPVH---SPPPPVH---SPPPPP--VYSPPPPPPPVH- 566

Query: 317 YNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPV 496
             SPPPP    SPPPP Y   SPPPPV+   SPPPPV+   SPPPPA       SPPPPV
Sbjct: 567 --SPPPPVF--SPPPPVY---SPPPPVH---SPPPPVH---SPPPPA----PVHSPPPPV 609

Query: 497 YKYKSPPPPVYSPPPPVYKYKSPPP 571
           +    PPPPVYSPPPPV+   SPPP
Sbjct: 610 HS-PPPPPPVYSPPPPVF---SPPP 630

 Score =  159 bits (402), Expect = 2e-37
 Identities = 102/210 (48%), Positives = 114/210 (54%), Gaps = 17/210 (8%)
 Frame = +2

Query: 5   KSPPPPPKKPYKYPSPPPPVYKYNSPP---PPYKYPSPPPP-PYKYPSPPP--------- 145
           + P P P  P + PSP P    +   P    P   PSP P  P + P PP          
Sbjct: 448 QKPSPVPTTPVQKPSPVPTTPVHEPSPVLATPVDKPSPVPSRPVQKPQPPKESPQPDDPY 507

Query: 146 ---PVYKYKSPPP-PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVY 313
              PV K +SPPP PV    SPPPPVY    PPPPV+   SPPPP   P     PPPPV 
Sbjct: 508 DQSPVTKRRSPPPAPV---NSPPPPVYSPPPPPPPVH---SPPPPVHSP-----PPPPV- 555

Query: 314 KYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPP 493
            Y+ PPPP    SPPPP +   SPPPPVY   SPPPPV+   SPPPP       P PP P
Sbjct: 556 -YSPPPPPPPVHSPPPPVF---SPPPPVY---SPPPPVH---SPPPPVHS----PPPPAP 601

Query: 494 VYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           V+   SPPPPV+SPPPP   Y SPPPPV+S
Sbjct: 602 VH---SPPPPVHSPPPPPPVY-SPPPPVFS 627

 Score =  142 bits (358), Expect = 2e-32
 Identities = 95/208 (45%), Positives = 107/208 (51%), Gaps = 17/208 (8%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPP--PVYKYNS-PPPPYKYPSP-PPPPYKYPSPPPPVYKYKSPPPP 178
           P P P  P   P+P P  PV K +  P  P + PSP P  P   PSP       K  P P
Sbjct: 428 PTPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLATPVDKPSPVP 487

Query: 179 VYKYKSPPPPVYKYKSPPP-------PVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP 337
               + P PP    +SP P       PV K +SPPP P       SPPPPVY  + PPPP
Sbjct: 488 SRPVQKPQPPK---ESPQPDDPYDQSPVTKRRSPPPAPVN-----SPPPPVY--SPPPPP 537

Query: 338 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPP 517
               SPPPP +    PPPPVY    PPPPV+   SPPPP        SPPPPVY   SPP
Sbjct: 538 PPVHSPPPPVHS--PPPPPVYSPPPPPPPVH---SPPPPVF------SPPPPVY---SPP 583

Query: 518 PPVYSPPPPVYK------YKSPPPPVYS 583
           PPV+SPPPPV+         SPPPPV+S
Sbjct: 584 PPVHSPPPPVHSPPPPAPVHSPPPPVHS 611

 Score =  107 bits (267), Expect = 7e-22
 Identities = 74/185 (40%), Positives = 81/185 (43%), Gaps = 45/185 (24%)
 Frame = +2

Query: 164 SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPP--PVYK------- 316
           S P PV+K    P PV     P  PV+K   P P P  P + PSP P  PV K       
Sbjct: 420 SKPSPVHK----PTPV-----PTTPVHK---PTPVPTTPVQKPSPVPTTPVQKPSPVPTT 467

Query: 317 -----------------------YNSPPPPYKYPSP-------------PPPPYKYPSPP 388
                                     P PP + P P              PPP    SPP
Sbjct: 468 PVHEPSPVLATPVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPP 527

Query: 389 PPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPP 568
           PPVY    PPPPV+   SPPPP   P     PPPPVY    PPPPV+SPPPPV+   SPP
Sbjct: 528 PPVYSPPPPPPPVH---SPPPPVHSP-----PPPPVYSPPPPPPPVHSPPPPVF---SPP 576

Query: 569 PPVYS 583
           PPVYS
Sbjct: 577 PPVYS 581

 Score =  104 bits (259), Expect = 6e-21
 Identities = 72/166 (43%), Positives = 80/166 (48%), Gaps = 5/166 (3%)
 Frame = +2

Query: 101 PSPPPPPYK-YPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKK 277
           PS P P +K  P P  PV+K    P    +  SP P     K  P P      P P    
Sbjct: 419 PSKPSPVHKPTPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLAT 478

Query: 278 PYKYPSPPP--PVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP-PVYKYKSPP 448
           P   PSP P  PV K   P PP + P P  P         PV K +SPPP PV    SPP
Sbjct: 479 PVDKPSPVPSRPVQK---PQPPKESPQPDDP-----YDQSPVTKRRSPPPAPV---NSPP 527

Query: 449 PPAKKPYKYPSPPPPVYKYKSPPPPVY-SPPPPVYKYKSPPPPVYS 583
           PP   P   P PPPPV+   SPPPPV+  PPPPVY    PPPPV+S
Sbjct: 528 PPVYSP---PPPPPPVH---SPPPPVHSPPPPPVYSPPPPPPPVHS 567

[115][TOP]
>UniRef100_Q9FLQ7 Formin-like protein 20 n=1 Tax=Arabidopsis thaliana RepID=FH20_ARATH
          Length = 1615

 Score =  164 bits (416), Expect = 4e-39
 Identities = 95/210 (45%), Positives = 107/210 (50%), Gaps = 19/210 (9%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKY---PSPPPPPYKY---PSPPPPVYKYK 163
            Y SPPPPP  P  Y SPPPP      PPPP  Y   P PPPPP  Y   P PPPP   Y 
Sbjct: 940  YGSPPPPPPPPPSYGSPPPP------PPPPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYG 993

Query: 164  SPPPPVYKYKSPPPPVYKYKS-----PPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSP 328
            SPPPP      PPPP     S     PPPP++   +PPPPP  P    +PPPP      P
Sbjct: 994  SPPPP------PPPPFSHVSSIPPPPPPPPMHG-GAPPPPPPPPMHGGAPPPP------P 1040

Query: 329  PPPYK--YPSPPPPPYKY----PSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYK--YPSP 484
            PPP     P PPPPP  +    P PPPP++    PPPP       PPP   P +   P P
Sbjct: 1041 PPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPP 1100

Query: 485  PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            PPP  +  +PPP    PPPP++    PPPP
Sbjct: 1101 PPPPMRGGAPPP----PPPPMHGGAPPPPP 1126

 Score =  160 bits (405), Expect = 7e-38
 Identities = 94/221 (42%), Positives = 107/221 (48%), Gaps = 30/221 (13%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPS------PPPPVYKYK 163
            Y SPPPPP  P  Y SPPPP      PPPP  Y SPPPPP   PS      PPPP + + 
Sbjct: 953  YGSPPPPPPPPPSYGSPPPP------PPPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHV 1006

Query: 164  S------PPPPVYKYKSPPPPVYKYKS-----PPPPVYKYKSPPPPPKKPYKY---PSPP 301
            S      PPPP++    PPPP           PPPP     +PPPPP  P      P PP
Sbjct: 1007 SSIPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPP 1066

Query: 302  PPVYKYNSPPPPYKY----PSPPPPPYK--YPSPPPPVYKYKSPPPPVYKYKS----PPP 451
            PP++    PPPP       P PPPPP +   P PPPP  +  +PPPP          PPP
Sbjct: 1067 PPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPP 1126

Query: 452  PAKKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            P  +    P PPPP  +    PPP   PPPP  +   PPPP
Sbjct: 1127 PPMRGGAPPPPPPPGGRGPGAPPP---PPPPGGRAPGPPPP 1164

 Score =  156 bits (395), Expect = 1e-36
 Identities = 96/219 (43%), Positives = 101/219 (46%), Gaps = 30/219 (13%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKY----PSP-------------PPPPYKYPS 136
            SPPPPP  P   P        Y  PPPP  Y    PSP             P PP K   
Sbjct: 859  SPPPPPPPPPFSPLNTTKANDYILPPPPLPYTSIAPSPSVKILPLHGISSAPSPPVKTAP 918

Query: 137  PPPP------VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSP 298
            PPPP       +   SPPPP   Y SPPP       PPPP   Y SPPPPP  P  Y SP
Sbjct: 919  PPPPPPPFSNAHSVLSPPPP--SYGSPPP-------PPPPPPSYGSPPPPPPPPPSYGSP 969

Query: 299  PPPVYKYNSPPPPYKY---PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPY 469
            PPP      PPPP  Y   P PPPPP  Y SPPPP      PPPP     S PPP   P 
Sbjct: 970  PPP------PPPPPGYGSPPPPPPPPPSYGSPPPP------PPPPFSHVSSIPPPPPPPP 1017

Query: 470  KY----PSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
             +    P PPPP     +PPPP   PPPP++    PPPP
Sbjct: 1018 MHGGAPPPPPPPPMHGGAPPPP---PPPPMHGGAPPPPP 1053

 Score =  155 bits (391), Expect = 3e-36
 Identities = 90/215 (41%), Positives = 105/215 (48%), Gaps = 24/215 (11%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKY----PSPPPPPYKY-----PSPPPPVY 154
            Y SPPPPP  P  Y SPPPP      PPPP+ +    P PPPPP  +     P PPPP++
Sbjct: 979  YGSPPPPPPPPPSYGSPPPP------PPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMH 1032

Query: 155  KYKSPPPPVYKYKS------PPPPVY--KYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPV 310
                PPPP            PPPP++      PPPP++    PPPPP      P PPPP 
Sbjct: 1033 GGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPP 1092

Query: 311  YKYNSPPPPYK-----YPSPPPPPYK--YPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPY 469
             +  +PPPP        P PPPPP     P PPPP  +  +PPPP      PPP  + P 
Sbjct: 1093 MRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPP------PPPGGRGPG 1146

Query: 470  KYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
              P PPPP  +   PPPP   P PP      PPPP
Sbjct: 1147 APPPPPPPGGRAPGPPPPP-GPRPP---GGGPPPP 1177

 Score =  145 bits (365), Expect = 3e-33
 Identities = 98/262 (37%), Positives = 112/262 (42%), Gaps = 74/262 (28%)
 Frame = +2

Query: 11   PPPPPKKPYK---------YPSPPPPVYKYNSPPPPYKY----------PSPPPPPYKY- 130
            PPPPP  P+           P PPPP      PPPP+            P PPPPP+K  
Sbjct: 790  PPPPPPPPFASVRRNSETLLPPPPPP------PPPPFASVRRNSETLLPPPPPPPPWKSL 843

Query: 131  ------------------PSPPPPVYK---------YKSPPPPV-YKYKSPPP-----PV 211
                              P PPPP +          Y  PPPP+ Y   +P P     P+
Sbjct: 844  YASTFETHEACSTSSSPPPPPPPPPFSPLNTTKANDYILPPPPLPYTSIAPSPSVKILPL 903

Query: 212  YKYKSPPPPVYKYKSPPPPP---KKPYKYPSPPPPVYKYNSPPPP-------YKYPSPPP 361
            +   S P P  K   PPPPP      +   SPPPP   Y SPPPP          P PPP
Sbjct: 904  HGISSAPSPPVKTAPPPPPPPPFSNAHSVLSPPPP--SYGSPPPPPPPPPSYGSPPPPPP 961

Query: 362  PPYKY---PSPPPPVYKYKS---PPPPVYKYKSPPPPAKKPYKY-----PSPPPPVYKYK 508
            PP  Y   P PPPP   Y S   PPPP   Y SPPPP   P+ +     P PPPP     
Sbjct: 962  PPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGG 1021

Query: 509  SPPPPVYSPPPPVYKYKSPPPP 574
            +PPPP   PPPP++    PPPP
Sbjct: 1022 APPPP---PPPPMHGGAPPPPP 1040

 Score =  127 bits (320), Expect = 5e-28
 Identities = 104/328 (31%), Positives = 115/328 (35%), Gaps = 140/328 (42%)
 Frame = +2

Query: 11   PPPPPKKPYK---------YPSPPPPVYKYNS------------PPPPYKY--------- 100
            PPPPP  P+           P PPPP   ++S            PPPP  +         
Sbjct: 669  PPPPPPPPFSSERPNSGTVLPPPPPPPPPFSSERPNSGTVLPPPPPPPLPFSSERPNSGT 728

Query: 101  --PSPPPPPYK-----------------------YPSPPPPVY-------------KYKS 166
              P PP PP+K                        P PPPP Y             +  S
Sbjct: 729  VLPPPPSPPWKSVYASALAIPAICSTSQAPTSSPTPPPPPPAYYSVGQKSSDLQTSQLPS 788

Query: 167  PPPPVYKYKSPPPPVYKYK---------SPPPPVYKYKS---------PPPPPKKPYKY- 289
            PPPP      PPPP    +          PPPP   + S         PPPPP  P+K  
Sbjct: 789  PPPP-----PPPPPFASVRRNSETLLPPPPPPPPPPFASVRRNSETLLPPPPPPPPWKSL 843

Query: 290  ------------------PSPPPPVYK---------YNSPPPPYKY----PSP------- 355
                              P PPPP +          Y  PPPP  Y    PSP       
Sbjct: 844  YASTFETHEACSTSSSPPPPPPPPPFSPLNTTKANDYILPPPPLPYTSIAPSPSVKILPL 903

Query: 356  ------PPPPYKYPSPPPP------VYKYKSPPPPVYKYKSPPPPAKKPYKY---PSPPP 490
                  P PP K   PPPP       +   SPPPP   Y SPPPP   P  Y   P PPP
Sbjct: 904  HGISSAPSPPVKTAPPPPPPPPFSNAHSVLSPPPP--SYGSPPPPPPPPPSYGSPPPPPP 961

Query: 491  PVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            P   Y SPPPP   PPPP Y    PPPP
Sbjct: 962  PPPSYGSPPPP--PPPPPGYGSPPPPPP 987

 Score =  112 bits (281), Expect = 2e-23
 Identities = 70/177 (39%), Positives = 83/177 (46%), Gaps = 15/177 (8%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPS-----PPPPPYKY----PSPPPPVYK-Y 160
            PPPPP      P PPPP     +PPPP   P      PPPPP  +    P PPPP+    
Sbjct: 1026 PPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGA 1085

Query: 161  KSPPPPVYKYKSPPPPVYKYKS-----PPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNS 325
              PPPP  +  +PPPP    +      PPPP++    PPPPP  P +  +PPPP      
Sbjct: 1086 PPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPP--PMRGGAPPPP------ 1137

Query: 326  PPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPV 496
            PPP  + P  PPP      PPPP  +   PPPP      P PP   P     PPPP+
Sbjct: 1138 PPPGGRGPGAPPP------PPPPGGRAPGPPPP----PGPRPPGGGP-----PPPPM 1179

 Score =  107 bits (268), Expect = 5e-22
 Identities = 94/310 (30%), Positives = 109/310 (35%), Gaps = 120/310 (38%)
 Frame = +2

Query: 11   PPPPPKKPYKY--------PSPPPPVYKYNSPPPPYKYPSPPPPPYKY-----------P 133
            PPPPP   Y +        P PPPP +    P      P PPPPP  +           P
Sbjct: 651  PPPPPLPTYSHYQTSQLPPPPPPPPPFSSERPNSGTVLPPPPPPPPPFSSERPNSGTVLP 710

Query: 134  SPPPPVYKYKS---------PPPPVYKYKS-------------------------PPPPV 211
             PPPP   + S         PPPP   +KS                         PPPP 
Sbjct: 711  PPPPPPLPFSSERPNSGTVLPPPPSPPWKSVYASALAIPAICSTSQAPTSSPTPPPPPPA 770

Query: 212  Y-------------KYKSPPPPVYKYKSPPPPPKKPYK------YPSPPPPVYKYNSPPP 334
            Y             +  SPPPP      PPPPP    +       P PPPP      PPP
Sbjct: 771  YYSVGQKSSDLQTSQLPSPPPP------PPPPPFASVRRNSETLLPPPPPP------PPP 818

Query: 335  PYKY----------PSPPPPPYKY---------------PSPPPPVYKYKSPPPPVYK-- 433
            P+            P PPPPP+K                 SPPPP      PPPP +   
Sbjct: 819  PFASVRRNSETLLPPPPPPPPWKSLYASTFETHEACSTSSSPPPP------PPPPPFSPL 872

Query: 434  -------YKSPPPPAKKPYKYPSPPP-----PVYKYKSPP-PPVYSPPPP--------VY 550
                   Y  PPPP   PY   +P P     P++   S P PPV + PPP         +
Sbjct: 873  NTTKANDYILPPPPL--PYTSIAPSPSVKILPLHGISSAPSPPVKTAPPPPPPPPFSNAH 930

Query: 551  KYKSPPPPVY 580
               SPPPP Y
Sbjct: 931  SVLSPPPPSY 940

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 85/297 (28%), Positives = 101/297 (34%), Gaps = 111/297 (37%)
 Frame = +2

Query: 20   PPKKPYKYPSPPPPVYKYNSPPP--------------PYKYPSPPPPPYKYPSPPPPVYK 157
            P   P + PS  PP   + +PPP                   SPPPPP     PPPP+  
Sbjct: 604  PDSSPKETPSSLPPASPHQAPPPLPSLTSEAKTVLHSSQAVASPPPPP-----PPPPLPT 658

Query: 158  YK--------SPPPPVYKYKS-----------PPPPVYKYKSPPPPVYKYKSPPPPPKKP 280
            Y          PPPP   + S           PPPP   + S  P       PPPPP  P
Sbjct: 659  YSHYQTSQLPPPPPPPPPFSSERPNSGTVLPPPPPPPPPFSSERPNSGTVLPPPPPPPLP 718

Query: 281  YK---------YPSPPPPVYK------------YNSPPPPYKYPSPPPPPYKY------- 376
            +           P PP P +K             ++   P   P+PPPPP  Y       
Sbjct: 719  FSSERPNSGTVLPPPPSPPWKSVYASALAIPAICSTSQAPTSSPTPPPPPPAYYSVGQKS 778

Query: 377  --------PSPPPPVYKYKSPPPPVYKYK--------SPPPPAKKPYKY----------P 478
                    PSPPPP      PPPP    +         PPPP   P+            P
Sbjct: 779  SDLQTSQLPSPPPP-----PPPPPFASVRRNSETLLPPPPPPPPPPFASVRRNSETLLPP 833

Query: 479  SPPPPVYK---------------YKSPPPPVYSPPPPVYK---------YKSPPPPV 577
             PPPP +K                 SPPPP   PPPP +          Y  PPPP+
Sbjct: 834  PPPPPPWKSLYASTFETHEACSTSSSPPPP---PPPPPFSPLNTTKANDYILPPPPL 887

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 68/235 (28%), Positives = 83/235 (35%), Gaps = 75/235 (31%)
 Frame = +2

Query: 104  SPPPPPYKYPSPPPPVYKYKSPPP-------------PVYKYKSPPPPVYKYKSPPPPVY 244
            SP   P + PS  PP   +++PPP                   SPPPP      PPPP+ 
Sbjct: 603  SPDSSPKETPSSLPPASPHQAPPPLPSLTSEAKTVLHSSQAVASPPPP-----PPPPPLP 657

Query: 245  KYK-------SPPPPPKKPYKY-----------PSPPPPVYKYNSPPPPYKYPSPPPPPY 370
             Y         PPPPP  P+             P PPPP +    P      P PPPPP 
Sbjct: 658  TYSHYQTSQLPPPPPPPPPFSSERPNSGTVLPPPPPPPPPFSSERPNSGTVLPPPPPPPL 717

Query: 371  KYPS---------PPPPVYKYKS-------------------------PPPPVYKYKSPP 448
             + S         PPPP   +KS                         PPPP Y      
Sbjct: 718  PFSSERPNSGTVLPPPPSPPWKSVYASALAIPAICSTSQAPTSSPTPPPPPPAYYSVGQK 777

Query: 449  PPAKKPYKYPSPPPPVYKYKSPPPPVYS----------PPPPVYKYKSPPPPVYS 583
                +  + PSPPPP      PPPP ++          PPPP      PPPP ++
Sbjct: 778  SSDLQTSQLPSPPPP------PPPPPFASVRRNSETLLPPPP-----PPPPPPFA 821

[116][TOP]
>UniRef100_Q39866 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39866_SOYBN
          Length = 118

 Score =  164 bits (415), Expect = 5e-39
 Identities = 93/144 (64%), Positives = 94/144 (65%), Gaps = 6/144 (4%)
 Frame = +2

Query: 131 PSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPV 310
           PSPPPP Y YKSPPPP     SPPPP Y YKSPPPP     SP PPP  PY Y SPPPP 
Sbjct: 1   PSPPPP-YVYKSPPPPS---PSPPPP-YIYKSPPPP-----SPSPPP--PYVYKSPPPPS 48

Query: 311 YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP------VYKYKSPPPPAKKPYK 472
               SPPPPY Y SPPPP    PSPPPP Y YKSPPPP       Y YKSPPPP+     
Sbjct: 49  ---PSPPPPYVYKSPPPPS---PSPPPP-YVYKSPPPPSPSPPSPYYYKSPPPPS----- 96

Query: 473 YPSPPPPVYKYKSPPPPVYSPPPP 544
            PSPPPP Y YKSPPPP  SPPPP
Sbjct: 97  -PSPPPPYY-YKSPPPPSPSPPPP 118

 Score =  162 bits (411), Expect = 1e-38
 Identities = 94/148 (63%), Positives = 94/148 (63%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           P PPP  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPPPP    
Sbjct: 1   PSPPP--PYVYKSPPPPS---PSPPPPYIYKSPPPPS---PSPPPP-YVYKSPPPP---S 48

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPY 370
            SPPPP Y YKSPPPP     SP PPP  PY Y SPPPP     SPP PY Y SPPPP  
Sbjct: 49  PSPPPP-YVYKSPPPP-----SPSPPP--PYVYKSPPPP---SPSPPSPYYYKSPPPPS- 96

Query: 371 KYPSPPPPVYKYKSPPPPVYKYKSPPPP 454
             PSPPPP Y YKSPPPP     SPPPP
Sbjct: 97  --PSPPPPYY-YKSPPPP---SPSPPPP 118

 Score =  157 bits (398), Expect = 4e-37
 Identities = 91/137 (66%), Positives = 92/137 (67%)
 Frame = +2

Query: 164 SPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYK 343
           SPPPP Y YKSPPPP     SPPPP Y YKSPPPP       PSPPPP Y Y SPPPP  
Sbjct: 2   SPPPP-YVYKSPPPPS---PSPPPP-YIYKSPPPPS------PSPPPP-YVYKSPPPPS- 48

Query: 344 YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPP 523
            PSPPPP Y Y SPPPP     SPPPP Y YKSPPPP+      PSPP P Y YKSPPPP
Sbjct: 49  -PSPPPP-YVYKSPPPPS---PSPPPP-YVYKSPPPPS------PSPPSPYY-YKSPPPP 95

Query: 524 VYSPPPPVYKYKSPPPP 574
             SPPPP Y YKSPPPP
Sbjct: 96  SPSPPPPYY-YKSPPPP 111

 Score =  134 bits (338), Expect = 4e-30
 Identities = 81/135 (60%), Positives = 82/135 (60%), Gaps = 6/135 (4%)
 Frame = +2

Query: 194 SPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYK 373
           SPPPP Y YKSPPPP     SP PPP  PY Y SPPPP     SPPPPY Y SPPPP   
Sbjct: 2   SPPPP-YVYKSPPPP-----SPSPPP--PYIYKSPPPPS---PSPPPPYVYKSPPPPS-- 48

Query: 374 YPSPPPPVYKYKSPPPPV------YKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
            PSPPPP Y YKSPPPP       Y YKSPPPP+      PSPP P Y YKSPPPP  SP
Sbjct: 49  -PSPPPP-YVYKSPPPPSPSPPPPYVYKSPPPPS------PSPPSPYY-YKSPPPP--SP 97

Query: 536 PPPVYKYKSPPPPVY 580
                   SPPPP Y
Sbjct: 98  --------SPPPPYY 104

 Score =  120 bits (301), Expect = 8e-26
 Identities = 72/117 (61%), Positives = 72/117 (61%), Gaps = 5/117 (4%)
 Frame = +2

Query: 2   YKSPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           YKSPPPP     P  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKS
Sbjct: 25  YKSPPPPSPSPPP--PYVYKSPPPP---SPSPPPPYVYKSPPPPS---PSPPPP-YVYKS 75

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPP 337
           PPPP     SPP P Y YKSPPPP     SP PPP  PY Y SPPPP     SPPPP
Sbjct: 76  PPPP---SPSPPSPYY-YKSPPPP-----SPSPPP--PYYYKSPPPP---SPSPPPP 118

 Score =  115 bits (287), Expect = 3e-24
 Identities = 68/114 (59%), Positives = 68/114 (59%), Gaps = 8/114 (7%)
 Frame = +2

Query: 257 PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 436
           P PPP  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPPPP    
Sbjct: 1   PSPPP--PYVYKSPPPPS---PSPPPPYIYKSPPPPS---PSPPPP-YVYKSPPPP---- 47

Query: 437 KSPPPPAKKPYKYPSPPPPVYKYKSPPPPVY--SPPPP------VYKYKSPPPP 574
            SP PP   PY Y SPPPP     SPPPP    SPPPP       Y YKSPPPP
Sbjct: 48  -SPSPPP--PYVYKSPPPPS---PSPPPPYVYKSPPPPSPSPPSPYYYKSPPPP 95

[117][TOP]
>UniRef100_Q43505 Extensin-like protein Dif54 n=1 Tax=Solanum lycopersicum
           RepID=Q43505_SOLLC
          Length = 436

 Score =  163 bits (413), Expect = 8e-39
 Identities = 109/215 (50%), Positives = 109/215 (50%), Gaps = 22/215 (10%)
 Frame = +2

Query: 2   YKSPPPP-------PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKY 160
           YKSP P        P K Y Y SP P  Y Y SP P   Y SP P    Y   P PV  Y
Sbjct: 217 YKSPSPAKYYKSPAPSKNYYYKSPSPVKY-YKSPSPAKYYKSPAPSKNYYYKSPSPVKYY 275

Query: 161 KSPPPPVYKYKSPPPPV-YKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYK----YNS 325
           KSP P  Y YKSP P   Y YKSP P  Y YKSP P   K YK P PPP  YK    Y S
Sbjct: 276 KSPSPVKY-YKSPAPSKHYYYKSPSPSQY-YKSPAP--SKYYKSPPPPPTYYKSPVYYKS 331

Query: 326 PPPPYKYPSPPPPPYKYPSPPPPVYK-----YKSPPPPVYKYKSPPPPAKKPYKYPSPPP 490
           PPPP  Y    P  YK P  PPP YK     YKSPPPP Y YK   P  K P     PPP
Sbjct: 332 PPPPPTYYEKSPSYYKSPL-PPPYYKESMPYYKSPPPPPY-YKESTPYYKSP-----PPP 384

Query: 491 PVYK-----YKSPPPPVYSPPPPVYKYKSPPPPVY 580
           P YK     YKSPPPP Y      Y YKSPPPP Y
Sbjct: 385 PYYKESTPSYKSPPPPPYYKESTPY-YKSPPPPPY 418

 Score =  162 bits (409), Expect = 2e-38
 Identities = 119/257 (46%), Positives = 121/257 (47%), Gaps = 64/257 (24%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSP--------PPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYK 157
           YKSP P   K YK PSP        P   Y Y SP P   Y SP P  Y Y SP P  + 
Sbjct: 150 YKSPSP--SKYYKSPSPAKYYKSPAPSKHYYYKSPSPAKYYKSPSPAKY-YKSPAPSKHY 206

Query: 158 YKSPPPPVYKYKSPPPPVYKYKSPPPPV-YKYKSP-------PPPPKKPYKYPSP----- 298
           Y   P PV  YKSP P  Y YKSP P   Y YKSP        P P K YK P+P     
Sbjct: 207 YYKSPSPVKYYKSPSPAKY-YKSPAPSKNYYYKSPSPVKYYKSPSPAKYYKSPAPSKNYY 265

Query: 299 ---PPPVYKYNSPPPPYKYPSPPPPP---YKYPSP------PPPVYKYKSPPPP--VYK- 433
              P PV  Y SP P   Y SP P     YK PSP      P P   YKSPPPP   YK 
Sbjct: 266 YKSPSPVKYYKSPSPVKYYKSPAPSKHYYYKSPSPSQYYKSPAPSKYYKSPPPPPTYYKS 325

Query: 434 ---YKSPPPP----AKKPYKYPSP-PPPVYK-----YKSPPPPVY----------SPPPP 544
              YKSPPPP     K P  Y SP PPP YK     YKSPPPP Y           PPPP
Sbjct: 326 PVYYKSPPPPPTYYEKSPSYYKSPLPPPYYKESMPYYKSPPPPPYYKESTPYYKSPPPPP 385

Query: 545 VYK-----YKSPPPPVY 580
            YK     YKSPPPP Y
Sbjct: 386 YYKESTPSYKSPPPPPY 402

 Score =  138 bits (347), Expect = 4e-31
 Identities = 96/213 (45%), Positives = 98/213 (46%), Gaps = 20/213 (9%)
 Frame = +2

Query: 2   YKSPPPPP--KKPYK---------YPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPP 148
           YKSP P P  KK  K         Y SP P  + Y SP     Y SP P    Y SP P 
Sbjct: 48  YKSPSPSPYYKKSEKHAEHSPSHYYKSPTPSKHYYKSPVVVKYYKSPAPSKKYYKSPSPS 107

Query: 149 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSP 328
            Y YKS  P    YKS  P  Y YKSP P  Y YKS  P P K Y Y SP P  Y Y SP
Sbjct: 108 KYYYKSHTPSKKYYKSLSPAKY-YKSPSPAKY-YKS--PTPSKHYYYKSPSPSKY-YKSP 162

Query: 329 PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSP------PP 490
            P   Y SP P  + Y   P P   YKSP P  Y YKSP P     YK PSP      P 
Sbjct: 163 SPAKYYKSPAPSKHYYYKSPSPAKYYKSPSPAKY-YKSPAPSKHYYYKSPSPVKYYKSPS 221

Query: 491 PVYKYKSPPPP---VYSPPPPVYKYKSPPPPVY 580
           P   YKSP P     Y  P PV  YKSP P  Y
Sbjct: 222 PAKYYKSPAPSKNYYYKSPSPVKYYKSPSPAKY 254

 Score =  103 bits (256), Expect = 1e-20
 Identities = 67/135 (49%), Positives = 69/135 (51%), Gaps = 20/135 (14%)
 Frame = +2

Query: 2   YKSPPPPP---KKPYKYPSPPPPVYKYNSPPPPYKYPSPPP------PPYKYPSPPPPVY 154
           YKSPPPPP   K P  Y SPPPP   Y   P  YK P PPP      P YK P PPPP Y
Sbjct: 313 YKSPPPPPTYYKSPVYYKSPPPPPTYYEKSPSYYKSPLPPPYYKESMPYYKSP-PPPPYY 371

Query: 155 K-----YKSPPPPVY------KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPP 301
           K     YKSPPPP Y       YKSPPPP Y  +S P   YK   PPPPP   YK  +P 
Sbjct: 372 KESTPYYKSPPPPPYYKESTPSYKSPPPPPYYKESTP--YYKS--PPPPPY--YKESTP- 424

Query: 302 PPVYKYNSPPPPYKY 346
                Y SPP    Y
Sbjct: 425 ----SYKSPPSSPTY 435

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 61/164 (37%), Positives = 63/164 (38%), Gaps = 31/164 (18%)
 Frame = +2

Query: 182 YKYKSPPPPVYK---YKSPPPPVYKYKSPPPPPKKP-YKYPSPPPPVYKYNSPPPPYKYP 349
           Y Y SP P       YKSP P  Y  KS       P + Y SP P  + Y SP     Y 
Sbjct: 33  YGYTSPSPTYTTKKYYKSPSPSPYYKKSEKHAEHSPSHYYKSPTPSKHYYKSPVVVKYYK 92

Query: 350 SPPPPPYKYPSPPPPVYKYKS------------------PPPPVYKYKSPPPPAKKPYKY 475
           SP P    Y SP P  Y YKS                   P P   YKSP P     YK 
Sbjct: 93  SPAPSKKYYKSPSPSKYYYKSHTPSKKYYKSLSPAKYYKSPSPAKYYKSPTPSKHYYYKS 152

Query: 476 PSP------PPPVYKYKSPPPP---VYSPPPPVYKYKSPPPPVY 580
           PSP      P P   YKSP P     Y  P P   YKSP P  Y
Sbjct: 153 PSPSKYYKSPSPAKYYKSPAPSKHYYYKSPSPAKYYKSPSPAKY 196

[118][TOP]
>UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
            RepID=UPI00015B541C
          Length = 661

 Score =  163 bits (412), Expect = 1e-38
 Identities = 97/214 (45%), Positives = 103/214 (48%), Gaps = 28/214 (13%)
 Frame = +2

Query: 8    SPPP---------PPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSP----PPP 148
            SPPP         PP +P   PSPPPP      PPPP   P PPPPP   P P    PP 
Sbjct: 464  SPPPSRPPSTPSLPPSRPPSSPSPPPP-----PPPPPPPRPPPPPPPPSQPPPTSLTPPV 518

Query: 149  VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKP--YKYPS--PPPPVYK 316
             Y Y SPPPP      PPPP      PPP  Y Y SPPPPP  P  Y YPS  PPPP   
Sbjct: 519  TYSYPSPPPP------PPPP------PPPVTYNYPSPPPPPSLPVTYNYPSPPPPPPPPS 566

Query: 317  YNSPPPPYKYPS-----PPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKY-- 475
            YN P P Y YPS     PPPPP   PS P P+   K P PP   Y  PP    +P  Y  
Sbjct: 567  YNYPAPTYYYPSPSPRPPPPPPRPRPSRPRPIITPK-PIPPRATYLPPPRLTPQPRTYLP 625

Query: 476  -PSPPPPVYKYKSPPPP---VYSPPPPVYKYKSP 565
             P+P P  + Y  PP P   +Y PP P   Y  P
Sbjct: 626  PPTPTPQTFTYSQPPAPQSRLYLPPRPAPMYLPP 659

 Score =  137 bits (345), Expect = 6e-31
 Identities = 89/201 (44%), Positives = 92/201 (45%), Gaps = 10/201 (4%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP-PPYKYPSPPPPVYKYKSPPPPVY 184
           S  P P   Y YPSP  P+     P P    PSPPP PP   PSP P      S P    
Sbjct: 419 SSQPIPSVTYNYPSPSTPL-----PLPSTSTPSPPPSPPSSTPSPSP------STP---- 463

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPP 364
              SPPP      S PP      +P  PP +P   PSPPPP      PPPP   P PPPP
Sbjct: 464 ---SPPP------SRPP-----STPSLPPSRPPSSPSPPPP-----PPPPPPPRPPPPPP 504

Query: 365 PYKYPSP----PPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPP-----VYKYKSPP 517
           P   P P    PP  Y Y SPPPP      PPPP    Y YPSPPPP      Y Y SPP
Sbjct: 505 PPSQPPPTSLTPPVTYSYPSPPPP-----PPPPPPPVTYNYPSPPPPPSLPVTYNYPSPP 559

Query: 518 PPVYSPPPPVYKYKSPPPPVY 580
           PP   PPPP   Y  P P  Y
Sbjct: 560 PP---PPPP--SYNYPAPTYY 575

 Score =  103 bits (256), Expect = 1e-20
 Identities = 66/159 (41%), Positives = 71/159 (44%), Gaps = 7/159 (4%)
 Frame = +2

Query: 2   YKSPPPPPKKP-----YKYPS--PPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKY 160
           Y SPPPPP  P     Y YPS  PPP      S P  Y YPSPPPP      PPPP Y Y
Sbjct: 522 YPSPPPPPPPPPPPVTYNYPSPPPPP------SLPVTYNYPSPPPP------PPPPSYNY 569

Query: 161 KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPY 340
              P P Y Y SP P     + PPPP      P P   +P   P P PP   Y  PP   
Sbjct: 570 ---PAPTYYYPSPSP-----RPPPPP----PRPRPSRPRPIITPKPIPPRATYLPPPRLT 617

Query: 341 KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPA 457
             P    PP   P+P P  + Y  PP P  +   PP PA
Sbjct: 618 PQPRTYLPP---PTPTPQTFTYSQPPAPQSRLYLPPRPA 653

 Score =  100 bits (248), Expect = 1e-19
 Identities = 68/181 (37%), Positives = 77/181 (42%), Gaps = 11/181 (6%)
 Frame = +2

Query: 65  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 244
           Y Y++     K  +   P Y  P+         S P P   Y  P P      S P P+ 
Sbjct: 394 YDYSTQDYSSKPSTSISPDYSTPTS-------SSQPIPSVTYNYPSP------STPLPLP 440

Query: 245 KYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP-PPYKYPSPPPPVYKYKSPPP 421
              +P PPP  P   PSP P        PPP + PS P  PP + PS P P      PPP
Sbjct: 441 STSTPSPPPSPPSSTPSPSPST----PSPPPSRPPSTPSLPPSRPPSSPSP------PPP 490

Query: 422 PVYKYKSPPPPAKKPYKYPSP---------PPPVYKYKSPPPPVYSPPPPV-YKYKSPPP 571
           P      PPPP + P   P P         PP  Y Y SPPPP   PPPPV Y Y SPPP
Sbjct: 491 P-----PPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPPVTYNYPSPPP 545

Query: 572 P 574
           P
Sbjct: 546 P 546

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 58/173 (33%), Positives = 66/173 (38%), Gaps = 6/173 (3%)
 Frame = +2

Query: 65  YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 244
           Y Y+ P  P+  PS  P     PSPPPP      PPP  Y Y +PPPP      PPPP  
Sbjct: 45  YSYDKPKVPFGLPSHQP-----PSPPPP------PPPVTYNYPAPPPP------PPPP-- 85

Query: 245 KYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 424
               PPPP       P PPPP  + ++P P Y    PP     Y S P       S   P
Sbjct: 86  ----PPPP-------PPPPPPPPRVSTPAPTY---LPPYTGVNYGSSP-------SYNTP 124

Query: 425 VYKYKSPPPPAKKPYKYPSPPPPVYK------YKSPPPPVYSPPPPVYKYKSP 565
            Y      P AK      S  P  Y       + S      +   PV KY  P
Sbjct: 125 SYGTSDYSPVAKFSGPVTSTTPGYYSSLGNTAFASSSATANAGISPVAKYSQP 177

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 37/86 (43%), Positives = 40/86 (46%)
 Frame = +2

Query: 311 YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPP 490
           Y Y+ P  P+  PS  PP     SPPPP      PPP  Y Y +PPPP   P   P PPP
Sbjct: 45  YSYDKPKVPFGLPSHQPP-----SPPPP------PPPVTYNYPAPPPPPPPPPPPPPPPP 93

Query: 491 PVYKYKSPPPPVYSPPPPVYKYKSPP 568
           P     S P P Y PP     Y S P
Sbjct: 94  PPPPRVSTPAPTYLPPYTGVNYGSSP 119

 Score = 68.2 bits (165), Expect = 5e-10
 Identities = 62/187 (33%), Positives = 69/187 (36%), Gaps = 15/187 (8%)
 Frame = +2

Query: 23  PKKPYKYPSPPPPVYKYNSPPPP-----YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           PK P+  PS  PP     SPPPP     Y YP+PPPPP     PPPP      PPPP   
Sbjct: 50  PKVPFGLPSHQPP-----SPPPPPPPVTYNYPAPPPPP-----PPPP------PPPP--- 90

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPP---PPVYKYNSPPPPYKYPSP- 355
              PPPP     S P P Y       PP     Y S P    P Y  +   P  K+  P 
Sbjct: 91  ---PPPPPPPRVSTPAPTYL------PPYTGVNYGSSPSYNTPSYGTSDYSPVAKFSGPV 141

Query: 356 -PPPPYKYPSPPPPVYKYKSPP-----PPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPP 517
               P  Y S     +   S        PV KY  P   +  P  + S   P     S  
Sbjct: 142 TSTTPGYYSSLGNTAFASSSATANAGISPVAKYSQPVVSSNFPSTFTSSTLPSTTASSSS 201

Query: 518 PPVYSPP 538
             V S P
Sbjct: 202 SAVTSTP 208

[119][TOP]
>UniRef100_O82066 Proline-rich protein n=1 Tax=Solanum tuberosum RepID=O82066_SOLTU
          Length = 491

 Score =  163 bits (412), Expect = 1e-38
 Identities = 104/214 (48%), Positives = 108/214 (50%), Gaps = 24/214 (11%)
 Frame = +2

Query: 5   KSPPPPPKKPYK-----YPSPP-PPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           K PP PP  P K     +P PP PP++K   PPP  K P P   P   P+P PPV K   
Sbjct: 196 KLPPFPPMPPLKHWGHPFPLPPIPPLFKKPCPPPLVKPPVPVYNPTPKPTPEPPVVKPLP 255

Query: 167 PPPPVYKYKSPPP--PVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSP---- 328
           PP PVYK K  PP  PVYK K  PPPV  YK  P PP  P   P P PPV K   P    
Sbjct: 256 PPVPVYKPKPKPPPVPVYKPKPKPPPVPVYKPKPKPPPVPTYKPKPEPPVKKPCPPSVPK 315

Query: 329 --PPPYKYPSPPP-PPYK-YPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSP--PP 490
             PPP K P PP  P YK  P P PPV K   PP PVYK     PP  KP   P P   P
Sbjct: 316 PKPPPVKKPCPPKVPTYKPKPKPEPPVVKPLPPPVPVYK-----PPVVKPLPPPVPVYKP 370

Query: 491 PVYKYKSPPPPVYSP------PPPVYKYKSPPPP 574
           PV K   PP PVY P      PPPV  YK P PP
Sbjct: 371 PVVKPLPPPVPVYKPPVVKPLPPPVPIYKKPCPP 404

 Score =  154 bits (389), Expect = 5e-36
 Identities = 97/208 (46%), Positives = 103/208 (49%), Gaps = 18/208 (8%)
 Frame = +2

Query: 11  PPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYK---YKSPPPPV 181
           PP PP K + +P P PP+      PP +K P PPP       PP PVY      +P PPV
Sbjct: 201 PPMPPLKHWGHPFPLPPI------PPLFKKPCPPP----LVKPPVPVYNPTPKPTPEPPV 250

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSP-PPPVYKYN-SPPPPYKYPSP 355
            K   PP PVYK K  PPPV  YK  P PP  P   P P PPPV  Y   P PP K P P
Sbjct: 251 VKPLPPPVPVYKPKPKPPPVPVYKPKPKPPPVPVYKPKPKPPPVPTYKPKPEPPVKKPCP 310

Query: 356 P------PPPYKYPSPPP-PVYKYK-SPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKS 511
           P      PPP K P PP  P YK K  P PPV K   PP P  KP      PPPV  YK 
Sbjct: 311 PSVPKPKPPPVKKPCPPKVPTYKPKPKPEPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKP 370

Query: 512 P-----PPPVYSPPPPVYKYKSPPPPVY 580
           P     PPPV    PPV K   PP P+Y
Sbjct: 371 PVVKPLPPPVPVYKPPVVKPLPPPVPIY 398

 Score =  139 bits (351), Expect = 1e-31
 Identities = 96/218 (44%), Positives = 102/218 (46%), Gaps = 27/218 (12%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSP-PPPVYKYN-SPPPPYKYPSPP------PPPYKYPSPPP-PVY 154
           YK  P PP  P   P P PPPV  Y   P PP K P PP      PPP K P PP  P Y
Sbjct: 273 YKPKPKPPPVPVYKPKPKPPPVPTYKPKPEPPVKKPCPPSVPKPKPPPVKKPCPPKVPTY 332

Query: 155 KYK-SPPPPVYKYKSPPPPVYK---YKSPPPPVYKYKSPP----PPPKKPYKYP-----S 295
           K K  P PPV K   PP PVYK    K  PPPV  YK P     PPP   YK P      
Sbjct: 333 KPKPKPEPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLP 392

Query: 296 PPPPVYKYNSPPPPYKYPSPP---PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP 466
           PP P+YK   PP P+  P PP   P P   P   PPV K   PP P+Y+     PP  KP
Sbjct: 393 PPVPIYKKPCPPFPHLPPLPPIVKPLPPPVPIYVPPVVKPLPPPVPIYE-----PPVVKP 447

Query: 467 YKYPSP--PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
              P P   PP YK   PP P +   PP +    PP P
Sbjct: 448 LPPPVPIYKPPFYKKPCPPLPPFPKIPPFHHPLFPPLP 485

 Score =  137 bits (346), Expect = 5e-31
 Identities = 100/219 (45%), Positives = 105/219 (47%), Gaps = 30/219 (13%)
 Frame = +2

Query: 11  PPPPPKKPYK-YPSPPP-PVYKYNSPPPP---YK-YPSPPPPPYKYPSPPPPVYKYKSP- 169
           P PPP   YK  P PPP PVYK    PPP   YK  P PPP P   P P PPV K   P 
Sbjct: 253 PLPPPVPVYKPKPKPPPVPVYKPKPKPPPVPVYKPKPKPPPVPTYKPKPEPPVKKPCPPS 312

Query: 170 -----PPPVYKYKSPPPPVYKYK-SPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPP 331
                PPPV K   P  P YK K  P PPV K   PP P  KP      PPPV  Y    
Sbjct: 313 VPKPKPPPVKKPCPPKVPTYKPKPKPEPPVVKPLPPPVPVYKPPVVKPLPPPVPVYK--- 369

Query: 332 PPYKYPSPPP-PPYKYP---SPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSP--PPP 493
           PP   P PPP P YK P     PPPV  YK P PP + +  P PP  KP   P P   PP
Sbjct: 370 PPVVKPLPPPVPVYKPPVVKPLPPPVPIYKKPCPP-FPHLPPLPPIVKPLPPPVPIYVPP 428

Query: 494 VYKYKSPPPPVYS--------PPPPVYK---YKSPPPPV 577
           V K   PP P+Y         PP P+YK   YK P PP+
Sbjct: 429 VVKPLPPPVPIYEPPVVKPLPPPVPIYKPPFYKKPCPPL 467

 Score =  131 bits (330), Expect = 3e-29
 Identities = 100/235 (42%), Positives = 109/235 (46%), Gaps = 43/235 (18%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYKYNSPPP-----------PYKYPSPPPPPYK-----YP 133
           +K PP P   P+  P   P + K+ + PP           P   P PP PP K     +P
Sbjct: 157 FKYPPLPQLPPF--PKDHPWMKKFPNLPPFPKDHPWMKKFPKLPPFPPMPPLKHWGHPFP 214

Query: 134 SPP-PPVYKYKSPPPPVYKYKSPPPPVYK---YKSPPPPVYKYKSPPPPPKKPYKYPSPP 301
            PP PP++K   PPP V     PP PVY      +P PPV K   PP P  KP   P PP
Sbjct: 215 LPPIPPLFKKPCPPPLV----KPPVPVYNPTPKPTPEPPVVKPLPPPVPVYKPKPKP-PP 269

Query: 302 PPVYKYNSPPPP---YK-YPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP- 466
            PVYK    PPP   YK  P PPP P   P P PPV   K P PP    K  PPP KKP 
Sbjct: 270 VPVYKPKPKPPPVPVYKPKPKPPPVPTYKPKPEPPV---KKPCPPSVP-KPKPPPVKKPC 325

Query: 467 ------YK-YPSPPPPVYKYKSPPPPVYSP------PPPVYKYKSP-----PPPV 577
                 YK  P P PPV K   PP PVY P      PPPV  YK P     PPPV
Sbjct: 326 PPKVPTYKPKPKPEPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPV 380

 Score =  107 bits (267), Expect = 7e-22
 Identities = 85/201 (42%), Positives = 92/201 (45%), Gaps = 21/201 (10%)
 Frame = +2

Query: 5   KSPPPPPKKP-------YK-YPSPPPPVYKYNSPP-----PPYKYPSPPP-----PPYKY 130
           K  PPP KKP       YK  P P PPV K   PP     PP   P PPP     PP   
Sbjct: 315 KPKPPPVKKPCPPKVPTYKPKPKPEPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVK 374

Query: 131 PSPPP-PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPP 307
           P PPP PVYK     PPV K   PP P+YK   PP P   +  P PP  KP     PP P
Sbjct: 375 PLPPPVPVYK-----PPVVKPLPPPVPIYKKPCPPFP---HLPPLPPIVKPL---PPPVP 423

Query: 308 VYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPP 487
           +Y      PP   P PPP P       PPV K   PP P+YK     PP    YK P PP
Sbjct: 424 IY-----VPPVVKPLPPPVPIY----EPPVVKPLPPPVPIYK-----PPF---YKKPCPP 466

Query: 488 PPVYKYKSPP--PPVYSPPPP 544
            P +  K PP   P++ P PP
Sbjct: 467 LPPFP-KIPPFHHPLFPPLPP 486

 Score = 80.9 bits (198), Expect = 7e-14
 Identities = 57/138 (41%), Positives = 69/138 (50%), Gaps = 14/138 (10%)
 Frame = +2

Query: 206 PVYKYKSPPPPVYKYKSPPPPPKKPY--KYPSPPP-----PVYKYNSPPPPYKYPSPPPP 364
           P +KY  PP P    + PP P   P+  K+P+ PP     P  K     PP+  P PP  
Sbjct: 155 PYFKY--PPLP----QLPPFPKDHPWMKKFPNLPPFPKDHPWMKKFPKLPPFP-PMPPLK 207

Query: 365 PYKYPSPPPPVYK-YKSP-PPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP 538
            + +P P PP+   +K P PPP+ K   PP P   P   P+P PPV K   PP PVY P 
Sbjct: 208 HWGHPFPLPPIPPLFKKPCPPPLVK---PPVPVYNPTPKPTPEPPVVKPLPPPVPVYKPK 264

Query: 539 P-----PVYKYKSPPPPV 577
           P     PVYK K  PPPV
Sbjct: 265 PKPPPVPVYKPKPKPPPV 282

[120][TOP]
>UniRef100_Q94ES3 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum
           RepID=Q94ES3_PEA
          Length = 137

 Score =  162 bits (411), Expect = 1e-38
 Identities = 91/153 (59%), Positives = 95/153 (62%), Gaps = 8/153 (5%)
 Frame = +2

Query: 20  PPKKPYKYPSPPPP-VYKYNSPPPPYKYPSPPPP---PYKYPSPPPP-VYKYKSPPPPVY 184
           P KKPYKYPSPPPP V+ Y  P P Y   SPPPP   PYKY SPPPP V+ Y  P P   
Sbjct: 2   PHKKPYKYPSPPPPPVHTYPHPHPVYH--SPPPPHKKPYKYSSPPPPPVHTYPHPHP--- 56

Query: 185 KYKSPPPPVYKYKSPPPPVYKYKSPPPPP---KKPYKYPSPPPPVYKYNSPPPPYKYPSP 355
            Y SPPPPV+ Y  P P    Y SPPPPP   KKPYKYPSPP        PPP + YP  
Sbjct: 57  VYHSPPPPVHTYPHPHP---VYHSPPPPPTPHKKPYKYPSPP--------PPPAHTYPPH 105

Query: 356 PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 454
            P P  Y SPPPPVY   SPPPP Y YKSPPPP
Sbjct: 106 VPTPV-YHSPPPPVY---SPPPPAYYYKSPPPP 134

 Score =  160 bits (406), Expect = 5e-38
 Identities = 88/170 (51%), Positives = 93/170 (54%), Gaps = 11/170 (6%)
 Frame = +2

Query: 104 SPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPY 283
           +P   PYKYPSPPPP                   PV+ Y  P P    Y SPPPP KKPY
Sbjct: 1   TPHKKPYKYPSPPPP-------------------PVHTYPHPHPV---YHSPPPPHKKPY 38

Query: 284 KYPSPPPP-VYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAK 460
           KY SPPPP V+ Y  P P Y   SPPPP + YP P P    Y SPPPP       P P K
Sbjct: 39  KYSSPPPPPVHTYPHPHPVYH--SPPPPVHTYPHPHPV---YHSPPPP-------PTPHK 86

Query: 461 KPYKYPSPPPPVYK----------YKSPPPPVYSPPPPVYKYKSPPPPVY 580
           KPYKYPSPPPP             Y SPPPPVYSPPPP Y YKSPPPP +
Sbjct: 87  KPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVYSPPPPAYYYKSPPPPYH 136

 Score =  114 bits (285), Expect = 6e-24
 Identities = 63/111 (56%), Positives = 65/111 (58%), Gaps = 22/111 (19%)
 Frame = +2

Query: 2   YKSPPPPPKKPYKYPSPPPPVYK--------YNSPPPP---YKYP-----SPPPPP---- 121
           Y SPPPP KKPYKY SPPPP           Y+SPPPP   Y +P     SPPPPP    
Sbjct: 27  YHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPVHTYPHPHPVYHSPPPPPTPHK 86

Query: 122 --YKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 268
             YKYPSPPPP      P  P   Y SPPPPVY   SPPPP Y YKSPPPP
Sbjct: 87  KPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVY---SPPPPAYYYKSPPPP 134

 Score = 89.0 bits (219), Expect = 3e-16
 Identities = 45/74 (60%), Positives = 47/74 (63%), Gaps = 3/74 (4%)
 Frame = +2

Query: 2   YKSPPPPP---KKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 172
           Y SPPPPP   KKPYKYPSPP        PPP + YP   P P  Y SPPPPVY   SPP
Sbjct: 75  YHSPPPPPTPHKKPYKYPSPP--------PPPAHTYPPHVPTPV-YHSPPPPVY---SPP 122

Query: 173 PPVYKYKSPPPPVY 214
           PP Y YKSPPPP +
Sbjct: 123 PPAYYYKSPPPPYH 136

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 41/86 (47%), Positives = 46/86 (53%), Gaps = 8/86 (9%)
 Frame = +2

Query: 350 SPPPPPYKYPSPPPP-VYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV 526
           +P   PYKYPSPPPP V+ Y  P P    Y SPPPP KKPYKY SPPP            
Sbjct: 1   TPHKKPYKYPSPPPPPVHTYPHPHPV---YHSPPPPHKKPYKYSSPPP------------ 45

Query: 527 YSPPPPVYK-------YKSPPPPVYS 583
               PPV+        Y SPPPPV++
Sbjct: 46  ----PPVHTYPHPHPVYHSPPPPVHT 67

[121][TOP]
>UniRef100_Q2YHP5 Proline-rich protein (Fragment) n=1 Tax=Phaseolus vulgaris
           RepID=Q2YHP5_PHAVU
          Length = 264

 Score =  162 bits (411), Expect = 1e-38
 Identities = 107/216 (49%), Positives = 113/216 (52%), Gaps = 24/216 (11%)
 Frame = +2

Query: 5   KSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           + PP   PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK   
Sbjct: 32  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 91

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYK--YKSPP---PPPKKP--YKYPSPPPPVYKYN- 322
             PPVYK     PPVYK     PPVYK   + PP   PP +KP  YK P   PPVYK   
Sbjct: 92  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 151

Query: 323 SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK--YKSPP---PPAKKP--YKYPS 481
             PP YK P   PP YK P   PPVYK     PPVYK   + PP   PP +KP  YK P 
Sbjct: 152 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 211

Query: 482 PPPPVYKYKSPPPPVYSPP---PPVYKYKSPPPPVY 580
             PPVYK     PPVY PP   PPVYK     PPVY
Sbjct: 212 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 247

 Score =  162 bits (410), Expect = 2e-38
 Identities = 105/209 (50%), Positives = 110/209 (52%), Gaps = 21/209 (10%)
 Frame = +2

Query: 17  PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK     PPVYK
Sbjct: 29  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 88

Query: 188 YKSPPPPVYKYKSPPPPVYK--YKSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYK 343
                PPVYK     PPVYK   + PP   PP +KP  YK P   PPVYK     PP YK
Sbjct: 89  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 148

Query: 344 YPSPPPPPYKYPSPPPPVYKYKSPPPPVYK--YKSPP---PPAKKP--YKYPSPPPPVYK 502
            P   PP YK P   PPVYK     PPVYK   + PP   PP +KP  YK P   PPVYK
Sbjct: 149 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 208

Query: 503 YKSPPPPVYSPP---PPVYKYKSPPPPVY 580
                PPVY PP   PPVYK     PPVY
Sbjct: 209 PPVEKPPVYKPPVEKPPVYKPPVEKPPVY 237

 Score =  158 bits (400), Expect = 3e-37
 Identities = 103/208 (49%), Positives = 108/208 (51%), Gaps = 16/208 (7%)
 Frame = +2

Query: 5   KSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           + PP   PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK   
Sbjct: 62  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 121

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKP--YKYPSPPPPVYKYN-SPPPP 337
             PPVYK     PPVYK     PPVYK     PP +KP  YK P   PPVYK     PP 
Sbjct: 122 EKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEKPPVYKPPVEKPPVYKPPVEKPPV 176

Query: 338 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP--YKYPSPPPPVYKYKS 511
           YK P   PP YK P   PPVYK     PPVYK     PP +KP  YK P   PPVYK   
Sbjct: 177 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEKPPVYKPPVEKPPVYKPPV 231

Query: 512 PPPPVYSPP---PPVYK--YKSPPPPVY 580
             PPVY PP   PPVY+  Y  PP P Y
Sbjct: 232 EKPPVYKPPVEKPPVYQPPYGKPPHPKY 259

 Score =  155 bits (392), Expect = 2e-36
 Identities = 101/202 (50%), Positives = 105/202 (51%), Gaps = 22/202 (10%)
 Frame = +2

Query: 41  YPSPP---PPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 208
           Y  PP   PPVYK     PP YK P   PP YK P   PPVYK     PPVYK     PP
Sbjct: 26  YDKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 85

Query: 209 VYKYKSPPPPVYK--YKSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPP 364
           VYK     PPVYK   + PP   PP +KP  YK P   PPVYK     PP YK P   PP
Sbjct: 86  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 145

Query: 365 PYKYPSPPPPVYKYKSPPPPVYK--YKSPP---PPAKKP--YKYPSPPPPVYKYKSPPPP 523
            YK P   PPVYK     PPVYK   + PP   PP +KP  YK P   PPVYK     PP
Sbjct: 146 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 205

Query: 524 VYSPP---PPVYKYKSPPPPVY 580
           VY PP   PPVYK     PPVY
Sbjct: 206 VYKPPVEKPPVYKPPVEKPPVY 227

 Score =  100 bits (248), Expect = 1e-19
 Identities = 65/134 (48%), Positives = 69/134 (51%), Gaps = 9/134 (6%)
 Frame = +2

Query: 5   KSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           + PP   PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK   
Sbjct: 132 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 191

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKP--YKYPSPPPPVYKYN-SPPPP 337
             PPVYK     PPVYK     PPVYK     PP +KP  YK P   PPVYK     PP 
Sbjct: 192 EKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEKPPVYKPPVEKPPVYKPPVEKPPV 246

Query: 338 YKYPSPPPPPYKYP 379
           Y+ P   PP  KYP
Sbjct: 247 YQPPYGKPPHPKYP 260

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 48/100 (48%), Positives = 51/100 (51%), Gaps = 8/100 (8%)
 Frame = +2

Query: 5   KSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           + PP   PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK   
Sbjct: 162 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 221

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYK--YKSPPPPPKKP 280
             PPVYK     PPVYK     PPVY+  Y  PP P   P
Sbjct: 222 EKPPVYKPPVEKPPVYKPPVEKPPVYQPPYGKPPHPKYPP 261

[122][TOP]
>UniRef100_C5Y7E8 Putative uncharacterized protein Sb05g025945 (Fragment) n=1
           Tax=Sorghum bicolor RepID=C5Y7E8_SORBI
          Length = 360

 Score =  162 bits (410), Expect = 2e-38
 Identities = 98/205 (47%), Positives = 104/205 (50%), Gaps = 14/205 (6%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           S PPP  KP   P P PP    +SPPPP K P PP P     SPPPPV   KSPPPP   
Sbjct: 171 SSPPPEVKPPPAPKPLPPPAPVSSPPPPVKSPPPPAP---VSSPPPPV---KSPPPPA-P 223

Query: 188 YKSPPPPVYKYKSPPPPVYKYKSPPPP---PKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
             SPPPPV   KSPPPP     SPPPP   P  P    SPPPPV    SPPPP    S P
Sbjct: 224 LSSPPPPV---KSPPPPA-PVSSPPPPVKSPPPPAPVSSPPPPV---KSPPPPPAPVSSP 276

Query: 359 PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSPP 538
           PPP K P PP PV    S PPP      PP P   P    +P PP  +  +P PP  S P
Sbjct: 277 PPPEKSPPPPAPV----SSPPPKPPSLPPPAPVSSPPPAVTPAPPKKEESTPAPPAESLP 332

Query: 539 PPVY-----------KYKSPPPPVY 580
           PP +           KY SPPPP +
Sbjct: 333 PPSFNDIILPPIMANKYASPPPPQF 357

 Score =  159 bits (401), Expect = 2e-37
 Identities = 102/224 (45%), Positives = 109/224 (48%), Gaps = 32/224 (14%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSP---PPPVYKYNSPPPPYKYPSPPP----PPYKYPSPPP------- 145
           S PPP  KP   P+P   PPPV K + PP P   P P P    PP    SPPP       
Sbjct: 123 SSPPPAPKPSPPPAPVSSPPPVVKSSPPPAPVSLPPPAPKTLPPPAPVSSPPPEVKPPPA 182

Query: 146 -----PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP-----PKKPYKYPS 295
                P     SPPPPV   KSPPPP     SPPPPV   KSPPPP     P  P K P 
Sbjct: 183 PKPLPPPAPVSSPPPPV---KSPPPPA-PVSSPPPPV---KSPPPPAPLSSPPPPVKSPP 235

Query: 296 PPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKK---- 463
           PP PV   +SPPPP K P PP P     SPPPPV   KSPPPP     SPPPP K     
Sbjct: 236 PPAPV---SSPPPPVKSPPPPAP---VSSPPPPV---KSPPPPPAPVSSPPPPEKSPPPP 286

Query: 464 -PYKYPSPPPPVYKYKSP---PPPVYSPPPPVYKYKSPPPPVYS 583
            P   P P PP     +P   PPP  +P PP  +  +P PP  S
Sbjct: 287 APVSSPPPKPPSLPPPAPVSSPPPAVTPAPPKKEESTPAPPAES 330

 Score =  157 bits (398), Expect = 4e-37
 Identities = 104/228 (45%), Positives = 109/228 (47%), Gaps = 39/228 (17%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPP-------PPYKYPSPP--------------PPPY 124
           SPPP  ++     S PPPV K + PP       PP    SPP              PPP 
Sbjct: 73  SPPPEDEEE----SSPPPVVKSSPPPETPKLSPPPAPVSSPPPVVKSTPPPAPVSSPPPA 128

Query: 125 KYPSP-------PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPY 283
             PSP       PPPV K   PP PV    S PPP  K   PP PV    S PPP  KP 
Sbjct: 129 PKPSPPPAPVSSPPPVVKSSPPPAPV----SLPPPAPKTLPPPAPV----SSPPPEVKPP 180

Query: 284 KYPSPPPPVYKYNSPPPPYKYPSP------PPPPYKYPSPPPPVYKYKSPPPPVYKYKSP 445
             P P PP    +SPPPP K P P      PPPP K P PP P+    SPPPPV   KSP
Sbjct: 181 PAPKPLPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPL---SSPPPPV---KSP 234

Query: 446 PPPA-----KKPYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           PPPA       P K P PP PV    SPPPPV SPPPP     SPPPP
Sbjct: 235 PPPAPVSSPPPPVKSPPPPAPV---SSPPPPVKSPPPPPAPVSSPPPP 279

 Score =  148 bits (373), Expect = 3e-34
 Identities = 99/215 (46%), Positives = 105/215 (48%), Gaps = 25/215 (11%)
 Frame = +2

Query: 5   KSPPPPP--KKPYKYPSPPPPVYKYNSPPPPYKYPSPP------PPPYKYPSPPPPVYKY 160
           K+PPP P    P    S PPP+   +S PP    P P       PPP    SPPP   K 
Sbjct: 40  KTPPPAPVSSPPPAVKSSPPPLTPKSSGPPAQVSPPPEDEEESSPPPVVKSSPPPETPKL 99

Query: 161 KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSP---PPPVYKYNSPP 331
             PP PV    S PPPV K   PP PV    S PPP  KP   P+P   PPPV K + PP
Sbjct: 100 SPPPAPV----SSPPPVVKSTPPPAPV----SSPPPAPKPSPPPAPVSSPPPVVKSSPPP 151

Query: 332 PPYKYPSP------PPPPYKYPSP---PPPVYKYKSPPPPVYKYKSPPPPAKKP---YKY 475
            P   P P      PP P   P P   PPP  K   PP PV    SPPPP K P      
Sbjct: 152 APVSLPPPAPKTLPPPAPVSSPPPEVKPPPAPKPLPPPAPV---SSPPPPVKSPPPPAPV 208

Query: 476 PSPPPPVYKYKSPPPP--VYSPPPPVYKYKSPPPP 574
            SPPPPV   KSPPPP  + SPPPPV   KSPPPP
Sbjct: 209 SSPPPPV---KSPPPPAPLSSPPPPV---KSPPPP 237

 Score =  143 bits (360), Expect = 1e-32
 Identities = 97/220 (44%), Positives = 101/220 (45%), Gaps = 28/220 (12%)
 Frame = +2

Query: 8   SPPPPPKKPYKYP-SPPPPVYKYNSPPPPYKYP-----SPPPPPYKYPSPPPPVYKYKSP 169
           SPPP    P   P S PPP  K + PP P K P       PPP     SPPP V    SP
Sbjct: 2   SPPPVKSSPPPAPVSSPPPTPKPSPPPAPVKSPPQVEKKTPPPA-PVSSPPPAV--KSSP 58

Query: 170 PPPVYKYKSP-----PPPVYKYKSPPPPVYKYKSPPPPPK--KPYKYPSPPPPVYKYNSP 328
           PP   K   P     PPP  + +S PPPV K   PP  PK   P    S PPPV K   P
Sbjct: 59  PPLTPKSSGPPAQVSPPPEDEEESSPPPVVKSSPPPETPKLSPPPAPVSSPPPVVKSTPP 118

Query: 329 PPPYKYPSPPPPPYKYPSP---PPPVYKYKSP------PPPVYKYKSP------PPPAKK 463
           P P   P P P P   P+P   PPPV K   P      PPP  K   P      PPP  K
Sbjct: 119 PAPVSSPPPAPKPSPPPAPVSSPPPVVKSSPPPAPVSLPPPAPKTLPPPAPVSSPPPEVK 178

Query: 464 PYKYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPPVYS 583
           P   P P PP     SPPPPV SPPPP     SPPPPV S
Sbjct: 179 PPPAPKPLPPPAPVSSPPPPVKSPPPPA-PVSSPPPPVKS 217

 Score =  141 bits (356), Expect = 3e-32
 Identities = 99/223 (44%), Positives = 102/223 (45%), Gaps = 34/223 (15%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSP---PPPVYKYNSPPPPYKYPSP---------------------PP 115
           S PPP  KP   P+P   PP V K   PP P   P P                     PP
Sbjct: 16  SSPPPTPKPSPPPAPVKSPPQVEKKTPPPAPVSSPPPAVKSSPPPLTPKSSGPPAQVSPP 75

Query: 116 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPS 295
           P  +  S PPPV K  SPPP   K   PP PV    S PPPV K   PP P   P   P 
Sbjct: 76  PEDEEESSPPPVVK-SSPPPETPKLSPPPAPV----SSPPPVVKSTPPPAPVSSPPPAPK 130

Query: 296 PPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPP----PVYKYKSPPPPVYKYKSPPPPAKK 463
           P PP    +SPPP  K  SPPP P   P P P    P     SPPP V      PPPA K
Sbjct: 131 PSPPPAPVSSPPPVVK-SSPPPAPVSLPPPAPKTLPPPAPVSSPPPEV-----KPPPAPK 184

Query: 464 PYKYP----SPPPPVYKYKSPPPPV-Y-SPPPPVYKYKSPPPP 574
           P   P    SPPPPV   KSPPPP    SPPPPV   KSPPPP
Sbjct: 185 PLPPPAPVSSPPPPV---KSPPPPAPVSSPPPPV---KSPPPP 221

 Score =  125 bits (315), Expect = 2e-27
 Identities = 81/171 (47%), Positives = 88/171 (51%), Gaps = 28/171 (16%)
 Frame = +2

Query: 5   KSPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYPSPP------PPPYKYPSPPPPV 151
           KSPPPP     P  P K P PP P+   +SPPPP K P PP      PPP K P PP PV
Sbjct: 200 KSPPPPAPVSSPPPPVKSPPPPAPL---SSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPV 256

Query: 152 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP---KKPYKYPSPPPPVYKYN 322
               SPPPPV   KSPPPP     SPPPP    KSPPPP      P K PS PPP    +
Sbjct: 257 ---SSPPPPV---KSPPPPPAPVSSPPPPE---KSPPPPAPVSSPPPKPPSLPPPAPVSS 307

Query: 323 SPP-----PPYKYPSPPPPPYKYPSPP-------PPVY--KYKSPPPPVYK 433
            PP     PP K  S P PP +   PP       PP+   KY SPPPP ++
Sbjct: 308 PPPAVTPAPPKKEESTPAPPAESLPPPSFNDIILPPIMANKYASPPPPQFQ 358

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 52/132 (39%), Positives = 56/132 (42%), Gaps = 39/132 (29%)
 Frame = +2

Query: 5   KSPPPP-----PKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPP----PPVYK 157
           KSPPPP     P  P K P PP PV   +SPPPP K P PPP P   P PP    PP   
Sbjct: 232 KSPPPPAPVSSPPPPVKSPPPPAPV---SSPPPPVKSPPPPPAPVSSPPPPEKSPPPPAP 288

Query: 158 YKSPPP------PVYKYKSPPP-------------PVYKYKSPPPPVY-----------K 247
             SPPP      P     SPPP             P    +S PPP +           K
Sbjct: 289 VSSPPPKPPSLPPPAPVSSPPPAVTPAPPKKEESTPAPPAESLPPPSFNDIILPPIMANK 348

Query: 248 YKSPPPPPKKPY 283
           Y SPPPP  + Y
Sbjct: 349 YASPPPPQFQGY 360

[123][TOP]
>UniRef100_B9RL73 LRX2, putative n=1 Tax=Ricinus communis RepID=B9RL73_RICCO
          Length = 766

 Score =  162 bits (410), Expect = 2e-38
 Identities = 104/234 (44%), Positives = 119/234 (50%), Gaps = 46/234 (19%)
 Frame = +2

Query: 11   PPPPPKKPYKY----PSPPPPVYKYNSP----PPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
            PPPPP+ P K     PSPPPP  K  SP    PPP     PPPPP    SPPPP + +  
Sbjct: 441  PPPPPQTPAKSYHPPPSPPPPPTKRVSPKTHLPPP-----PPPPPVVEQSPPPPAHYHSY 495

Query: 167  PPPPVYKYKS--------PPPPV----YKYKSPPPPVY------KYKSPPP----PPKKP 280
             PPP  K  S        PPPPV        SPPPPV       K+ SPPP    PP   
Sbjct: 496  APPPPTKKVSPSTHHAPPPPPPVDYTPTPKHSPPPPVEYTPSPPKHSSPPPVEYYPPPYQ 555

Query: 281  YKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKS--PPPPVY-KYKSPPP 451
            ++   PPPP  +Y SPP  +K P PPPPP +Y SPP   Y++K+  PPPP Y  Y SPPP
Sbjct: 556  HQTSPPPPPPVQYQSPPYHHK-PPPPPPPIEYQSPP---YQHKTSPPPPPGYDTYSSPPP 611

Query: 452  PAKKPY-------------KYPSPPPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
            P K  Y             K  SPPPP  +Y   PPP +   PP  K +SPPPP
Sbjct: 612  PPKNEYAHSPPPTHGHYPPKRESPPPPKNEYTHSPPPTHGHYPP--KRESPPPP 663

 Score =  159 bits (403), Expect = 1e-37
 Identities = 107/272 (39%), Positives = 128/272 (47%), Gaps = 84/272 (30%)
 Frame = +2

Query: 11   PPPPPKKPYKYPSPPPPVYKYN-SPPPPYKYPSP-------PPPPYKYP-----SPPPPV 151
            PPPPP  P    SPPPP + ++ +PPPP K  SP       PPPP  Y      SPPPPV
Sbjct: 473  PPPPPPPPVVEQSPPPPAHYHSYAPPPPTKKVSPSTHHAPPPPPPVDYTPTPKHSPPPPV 532

Query: 152  Y------KYKSPP-----PPVYKYKS--PPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYP 292
                   K+ SPP     PP Y++++  PPPP  +Y+SPP   Y +K PPPPP   Y+ P
Sbjct: 533  EYTPSPPKHSSPPPVEYYPPPYQHQTSPPPPPPVQYQSPP---YHHKPPPPPPPIEYQSP 589

Query: 293  -------SPPPPVY-KYNSPPPPYK--YPSPPPP-----PYKYPSPPPPVYKYKSPPPPV 427
                    PPPP Y  Y+SPPPP K  Y   PPP     P K  SPPPP  +Y   PPP 
Sbjct: 590  PYQHKTSPPPPPGYDTYSSPPPPPKNEYAHSPPPTHGHYPPKRESPPPPKNEYTHSPPPT 649

Query: 428  Y-----KYKSPPPPAKKP-----------------------------YKY---PSPPPPV 496
            +     K +SPPPP   P                             Y +   P PPPP 
Sbjct: 650  HGHYPPKRESPPPPPPPPPQEPFHPLPSPPPTGCITTPPSPPSSTPSYHHSPSPPPPPPE 709

Query: 497  YKYKSPPPPVYS------PPPPVYKYKSPPPP 574
              +  P PP YS      PPPP+  + SPPPP
Sbjct: 710  QHWHYPTPPSYSHHQSPPPPPPLSPFPSPPPP 741

 Score =  156 bits (395), Expect = 1e-36
 Identities = 103/256 (40%), Positives = 126/256 (49%), Gaps = 65/256 (25%)
 Frame = +2

Query: 2    YKSPPPPPKKPYKYP---SPPPPVY------KYNSPPPPYKYPSP--------PPPPYKY 130
            + +PPPPP   Y      SPPPPV       K++SPPP   YP P        PPPP +Y
Sbjct: 509  HHAPPPPPPVDYTPTPKHSPPPPVEYTPSPPKHSSPPPVEYYPPPYQHQTSPPPPPPVQY 568

Query: 131  --------PSPPPPVYKYKSPPPPVYKYKS--PPPPVY-KYKSPPPP---VYKYKSPPPP 268
                    P PPPP  +Y+SPP   Y++K+  PPPP Y  Y SPPPP    Y +  PP  
Sbjct: 569  QSPPYHHKPPPPPPPIEYQSPP---YQHKTSPPPPPGYDTYSSPPPPPKNEYAHSPPPTH 625

Query: 269  PKKPYKYPSPPPPVYKY-NSPPP-----PYKYPSPPPPP--------YKYPSPPP----- 391
               P K  SPPPP  +Y +SPPP     P K  SPPPPP        +  PSPPP     
Sbjct: 626  GHYPPKRESPPPPKNEYTHSPPPTHGHYPPKRESPPPPPPPPPQEPFHPLPSPPPTGCIT 685

Query: 392  ---------PVYKYK---SPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPVYSP 535
                     P Y +     PPPP   +  P PP+   ++ P PPPP+  + SPPPP  + 
Sbjct: 686  TPPSPPSSTPSYHHSPSPPPPPPEQHWHYPTPPSYSHHQSPPPPPPLSPFPSPPPPADNT 745

Query: 536  P-PPV--YKYKSPPPP 574
            P PP+    Y SPPPP
Sbjct: 746  PLPPIVGVSYASPPPP 761

 Score =  148 bits (373), Expect = 3e-34
 Identities = 103/264 (39%), Positives = 122/264 (46%), Gaps = 73/264 (27%)
 Frame = +2

Query: 8    SPPPPPKKPYKYPSPPPPV-------YKYNSPPPPYKYPS-------PPPPP-------- 121
            S P P +KP    +PP P        +   SPPPP    S       PPPPP        
Sbjct: 393  SSPSPRRKPRPVGNPPSPKLAPPRRPFVKPSPPPPPTSKSSPSTRSHPPPPPPQTPAKSY 452

Query: 122  YKYPSPPPPVYKYKSP----PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKK---- 277
            +  PSPPPP  K  SP    PPP      PPPPV +   PPP  Y   +PPPP KK    
Sbjct: 453  HPPPSPPPPPTKRVSPKTHLPPP-----PPPPPVVEQSPPPPAHYHSYAPPPPTKKVSPS 507

Query: 278  PYKYPSPPPPV----YKYNSPPPPYKY-PSPP-----------PPPYKY---PSPPPPV- 397
             +  P PPPPV       +SPPPP +Y PSPP           PPPY++   P PPPPV 
Sbjct: 508  THHAPPPPPPVDYTPTPKHSPPPPVEYTPSPPKHSSPPPVEYYPPPYQHQTSPPPPPPVQ 567

Query: 398  -----YKYKSPPP--------PVYKYKS--PPPPAKKPYKYPSPPPPVYKYKSPPPPVY- 529
                 Y +K PPP        P Y++K+  PPPP    Y  P PPPP  +Y   PPP + 
Sbjct: 568  YQSPPYHHKPPPPPPPIEYQSPPYQHKTSPPPPPGYDTYSSP-PPPPKNEYAHSPPPTHG 626

Query: 530  -------SPPPPVYKYKSPPPPVY 580
                   SPPPP  +Y   PPP +
Sbjct: 627  HYPPKRESPPPPKNEYTHSPPPTH 650

[124][TOP]
>UniRef100_Q40375 Repetitive proline-rich cell wall protein 2 n=1 Tax=Medicago
           truncatula RepID=PRP2_MEDTR
          Length = 371

 Score =  162 bits (410), Expect = 2e-38
 Identities = 107/222 (48%), Positives = 113/222 (50%), Gaps = 29/222 (13%)
 Frame = +2

Query: 2   YKSPP--------PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPP 148
           Y  PP        PP +KP  YK P   PPVYK     PP YK P   PP YK P   PP
Sbjct: 24  YDKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 83

Query: 149 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYK--YKSPP---PPPKKP--YKYPSPPPP 307
           VYK     PPVYK     PPVYK     PPVYK   + PP   PP +KP  YK P   PP
Sbjct: 84  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 143

Query: 308 VYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK--YKSPP---PPAKKP- 466
           VYK     PP YK P   PP YK P   PPVYK     PPVYK   + PP   PP +KP 
Sbjct: 144 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 203

Query: 467 -YKYPSPPPPVYKYKSPPPPVYSPP---PPVYKYKSPPPPVY 580
            YK P   PPVYK     PPVY PP   PP+YK     PPVY
Sbjct: 204 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVY 245

 Score =  162 bits (410), Expect = 2e-38
 Identities = 106/216 (49%), Positives = 113/216 (52%), Gaps = 24/216 (11%)
 Frame = +2

Query: 5   KSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           + PP   PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK   
Sbjct: 40  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 99

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYK--YKSPP---PPPKKP--YKYPSPPPPVYKYN- 322
             PPVYK     PPVYK     PPVYK   + PP   PP +KP  YK P   PPVYK   
Sbjct: 100 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 159

Query: 323 SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK--YKSPP---PPAKKP--YKYPS 481
             PP YK P   PP YK P   PPVYK     PPVYK   + PP   PP +KP  YK P 
Sbjct: 160 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 219

Query: 482 PPPPVYKYKSPPPPVYSPP---PPVYKYKSPPPPVY 580
             PPVYK     PP+Y PP   PPVYK     PPVY
Sbjct: 220 EKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVY 255

 Score =  162 bits (410), Expect = 2e-38
 Identities = 106/216 (49%), Positives = 113/216 (52%), Gaps = 24/216 (11%)
 Frame = +2

Query: 5   KSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           + PP   PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK   
Sbjct: 60  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 119

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYK--YKSPP---PPPKKP--YKYPSPPPPVYKYN- 322
             PPVYK     PPVYK     PPVYK   + PP   PP +KP  YK P   PPVYK   
Sbjct: 120 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 179

Query: 323 SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK--YKSPP---PPAKKP--YKYPS 481
             PP YK P   PP YK P   PPVYK     PPVYK   + PP   PP +KP  YK P 
Sbjct: 180 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPV 239

Query: 482 PPPPVYKYKSPPPPVYSPP---PPVYKYKSPPPPVY 580
             PPVYK     PPVY PP   PP+YK     PPVY
Sbjct: 240 EKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVY 275

 Score =  162 bits (410), Expect = 2e-38
 Identities = 106/216 (49%), Positives = 113/216 (52%), Gaps = 24/216 (11%)
 Frame = +2

Query: 5   KSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           + PP   PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK   
Sbjct: 70  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 129

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYK--YKSPP---PPPKKP--YKYPSPPPPVYKYN- 322
             PPVYK     PPVYK     PPVYK   + PP   PP +KP  YK P   PPVYK   
Sbjct: 130 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 189

Query: 323 SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK--YKSPP---PPAKKP--YKYPS 481
             PP YK P   PP YK P   PPVYK     PPVYK   + PP   PP +KP  YK P 
Sbjct: 190 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPV 249

Query: 482 PPPPVYKYKSPPPPVYSPP---PPVYKYKSPPPPVY 580
             PPVYK     PP+Y PP   PPVYK     PPVY
Sbjct: 250 EKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVY 285

 Score =  162 bits (410), Expect = 2e-38
 Identities = 106/216 (49%), Positives = 113/216 (52%), Gaps = 24/216 (11%)
 Frame = +2

Query: 5   KSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           + PP   PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK   
Sbjct: 90  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 149

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYK--YKSPP---PPPKKP--YKYPSPPPPVYKYN- 322
             PPVYK     PPVYK     PPVYK   + PP   PP +KP  YK P   PPVYK   
Sbjct: 150 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 209

Query: 323 SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK--YKSPP---PPAKKP--YKYPS 481
             PP YK P   PP YK P   PP+YK     PPVYK   + PP   PP +KP  YK P 
Sbjct: 210 EKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPV 269

Query: 482 PPPPVYKYKSPPPPVYSPP---PPVYKYKSPPPPVY 580
             PPVYK     PPVY PP   PPVYK     PPVY
Sbjct: 270 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 305

 Score =  162 bits (409), Expect = 2e-38
 Identities = 105/216 (48%), Positives = 113/216 (52%), Gaps = 24/216 (11%)
 Frame = +2

Query: 5   KSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           + PP   PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK   
Sbjct: 50  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 109

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYK--YKSPP---PPPKKP--YKYPSPPPPVYKYN- 322
             PPVYK     PPVYK     PPVYK   + PP   PP +KP  YK P   PPVYK   
Sbjct: 110 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 169

Query: 323 SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK--YKSPP---PPAKKP--YKYPS 481
             PP YK P   PP YK P   PPVYK     PPVYK   + PP   PP +KP  YK P 
Sbjct: 170 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 229

Query: 482 PPPPVYKYKSPPPPVYSPP---PPVYKYKSPPPPVY 580
             PP+YK     PPVY PP   PPVYK     PP+Y
Sbjct: 230 EKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIY 265

 Score =  162 bits (409), Expect = 2e-38
 Identities = 105/216 (48%), Positives = 113/216 (52%), Gaps = 24/216 (11%)
 Frame = +2

Query: 5   KSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           + PP   PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK   
Sbjct: 80  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 139

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYK--YKSPP---PPPKKP--YKYPSPPPPVYKYN- 322
             PPVYK     PPVYK     PPVYK   + PP   PP +KP  YK P   PPVYK   
Sbjct: 140 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 199

Query: 323 SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK--YKSPP---PPAKKP--YKYPS 481
             PP YK P   PP YK P   PPVYK     PP+YK   + PP   PP +KP  YK P 
Sbjct: 200 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPV 259

Query: 482 PPPPVYKYKSPPPPVYSPP---PPVYKYKSPPPPVY 580
             PP+YK     PPVY PP   PPVYK     PPVY
Sbjct: 260 EKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 295

 Score =  159 bits (403), Expect = 1e-37
 Identities = 108/216 (50%), Positives = 113/216 (52%), Gaps = 24/216 (11%)
 Frame = +2

Query: 5   KSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           + PP   PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK   
Sbjct: 140 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 199

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYK--YKSPP---PPPKKP--YKYPSPPPPVYKYNS 325
             PPVYK     PPVYK     PPVYK   + PP   PP +KP  YK P   PPVYK   
Sbjct: 200 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPV 259

Query: 326 PPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP--YKYPSPPPPV 496
             PP YK P   PP YK P   PPVYK     PPVYK     PP +KP  YK P   PPV
Sbjct: 260 EKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEKPPVYKPPVEKPPV 314

Query: 497 YKYKSPPPPVYSPP---PPVYK---YKSP--PPPVY 580
           YK     PPVY PP   PPVYK   YK P   PPVY
Sbjct: 315 YKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVY 350

 Score =  156 bits (394), Expect = 1e-36
 Identities = 104/216 (48%), Positives = 110/216 (50%), Gaps = 24/216 (11%)
 Frame = +2

Query: 5   KSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           + PP   PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK   
Sbjct: 160 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 219

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKP--YKYPSPPPPVYKYN-SPPPP 337
             PPVYK     PP+YK     PPVYK     PP +KP  YK P   PP+YK     PP 
Sbjct: 220 EKPPVYKPPVEKPPIYKPPVEKPPVYK-----PPVEKPPVYKPPVEKPPIYKPPVEKPPV 274

Query: 338 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP--YKYPSPPPPVYKYKS 511
           YK P   PP YK P   PPVYK     PPVYK     PP +KP  YK P   PPVYK   
Sbjct: 275 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEKPPVYKPPVYKPPVYKPPV 329

Query: 512 PPPPVYSPP--------PPVYK---YKSP--PPPVY 580
             PPVY PP        PPVYK   YK P   PPVY
Sbjct: 330 EKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVY 365

 Score =  154 bits (388), Expect = 6e-36
 Identities = 98/198 (49%), Positives = 101/198 (51%), Gaps = 12/198 (6%)
 Frame = +2

Query: 23  PKKPYKYPSPP---PPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 190
           P+    Y  PP   PPVYK     PP YK P   PP YK P   PPVYK     PPVYK 
Sbjct: 18  PRGLANYDKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 77

Query: 191 KSPPPPVYKYKSPPPPVYKYKSPPPPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPP 361
               PPVYK     PPVYK     PP +KP  YK P   PPVYK     PP YK P   P
Sbjct: 78  PVEKPPVYKPPVEKPPVYK-----PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 132

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP--YKYPSPPPPVYKYKSPPPPVYSP 535
           P YK P   PPVYK     PPVYK     PP +KP  YK P   PPVYK     PPVY P
Sbjct: 133 PVYKPPVEKPPVYKPPVEKPPVYK-----PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 187

Query: 536 P---PPVYKYKSPPPPVY 580
           P   PPVYK     PPVY
Sbjct: 188 PVEKPPVYKPPVEKPPVY 205

 Score =  144 bits (362), Expect = 7e-33
 Identities = 91/187 (48%), Positives = 96/187 (51%), Gaps = 9/187 (4%)
 Frame = +2

Query: 5   KSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           + PP   PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK   
Sbjct: 190 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPV 249

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKP--YKYPSPPPPVYKYN-SPPPP 337
             PPVYK     PP+YK     PPVYK     PP +KP  YK P   PPVYK     PP 
Sbjct: 250 EKPPVYKPPVEKPPIYKPPVEKPPVYK-----PPVEKPPVYKPPVEKPPVYKPPVEKPPV 304

Query: 338 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPP 517
           YK P   PP YK P   PPVYK     PPVYK     PP +KP   P   PPVYK     
Sbjct: 305 YKPPVEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKP---PVYKPPVYKPPVEK 361

Query: 518 PPVYSPP 538
           PPVY PP
Sbjct: 362 PPVYGPP 368

 Score = 79.7 bits (195), Expect = 2e-13
 Identities = 51/107 (47%), Positives = 54/107 (50%), Gaps = 6/107 (5%)
 Frame = +2

Query: 5   KSPP---PPPKKP--YKYPSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKS 166
           + PP   PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK   
Sbjct: 270 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPV 329

Query: 167 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPP 307
             PPVYK     PPVYK     PPVYK     PP +KP  Y  P  P
Sbjct: 330 EKPPVYK-----PPVYKPPVEKPPVYKPPVYKPPVEKPPVYGPPHHP 371

[125][TOP]
>UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2Z7_EHV86
          Length = 516

 Score =  161 bits (408), Expect = 3e-38
 Identities = 99/210 (47%), Positives = 101/210 (48%), Gaps = 21/210 (10%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPP---PVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 178
           SPPPP   P   P PPP   P     SPPPP   PSP PP    PSPPPP     SPP P
Sbjct: 31  SPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSP 90

Query: 179 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPP 358
                SPPPP     SPPPP     SPPPP   P   PSP PP     SPPPP   PSPP
Sbjct: 91  P---PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPP 147

Query: 359 PPPYKY-------PSPPPPVYKY-------KSPPPPVYKYKSPP----PPAKKPYKYPSP 484
           PPP  +       PSPPPP   +        SPPPP     SPP    P    P   PSP
Sbjct: 148 PPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSIS-PSPPSSASPTPPPPSASPSP 206

Query: 485 PPPVYKYKSPPPPVYSPPPPVYKYKSPPPP 574
           PPP     SPPPP   PPPP     SP PP
Sbjct: 207 PPPSPPPPSPPPPPPPPPPPPPSPPSPNPP 236

 Score =  157 bits (396), Expect = 8e-37
 Identities = 99/206 (48%), Positives = 103/206 (50%), Gaps = 19/206 (9%)
 Frame = +2

Query: 14  PPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK 193
           PPPP  P   PSPPPP     SPPPP   P  PPPP   PSPPP      SP PP     
Sbjct: 82  PPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP------SPSPP----- 130

Query: 194 SPPPPVYKYKSPPPPVYKYKSPPPPP---KKPYKYPSPPPPVYKY-------NSPPPPYK 343
           SPPPP     SPPPP      PPPPP   + P   PSPPPP   +        SPPPP  
Sbjct: 131 SPPPP-----SPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSI 185

Query: 344 YPSP-------PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYK 502
            PSP       PPPP   PSPPPP     SPPPP     SPPPP       P PPPP   
Sbjct: 186 SPSPPSSASPTPPPPSASPSPPPP-----SPPPP-----SPPPPP------PPPPPPPPS 229

Query: 503 YKSP-PPPVYSPPPPVYK-YKSPPPP 574
             SP PPP  SP PP  +  +SPPPP
Sbjct: 230 PPSPNPPPSASPSPPFGRSLRSPPPP 255

 Score =  143 bits (360), Expect = 1e-32
 Identities = 91/201 (45%), Positives = 95/201 (47%), Gaps = 23/201 (11%)
 Frame = +2

Query: 41  YPSPPPPVYKYNSPPPPYKYPSPP----------PPPYKYPSPPPPVYKYKSP---PPPV 181
           Y +PP       SPPPP   P PP          PPP   PSPPPP      P   PPP 
Sbjct: 16  YATPP-------SPPPP--SPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPS 66

Query: 182 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPP 361
               SPPPP     SPPPP      P PPP  P   PSPPPP     SPPPP   PSPPP
Sbjct: 67  PSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPSPPP 125

Query: 362 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPA---KKPYKYPSPPPPVYKY-------KS 511
            P   PSPPPP     SPPPP      PPPP    + P   PSPPPP   +        S
Sbjct: 126 SP-SPPSPPPP-----SPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPS 179

Query: 512 PPPPVYSPPPPVYKYKSPPPP 574
           PPPP  SP PP     +PPPP
Sbjct: 180 PPPPSISPSPPSSASPTPPPP 200

 Score =  119 bits (297), Expect = 2e-25
 Identities = 77/173 (44%), Positives = 80/173 (46%), Gaps = 20/173 (11%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKY-------PSPPPPVYKY-- 160
           SPPPP   P   PSP PP     SPPPP   PSPPPPP  +       PSPPPP   +  
Sbjct: 113 SPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQ 172

Query: 161 -----KSPPPPVYKYKSP------PPPVYKYKSPPPPVYKYKSPPPPPKKPYKYPSPPPP 307
                 SPPPP      P      PPP     SPPPP     SPPPP   P   P PPPP
Sbjct: 173 APSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPP-----SPPPPSPPP---PPPPPP 224

Query: 308 VYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPAKKP 466
                  PPP   PSP PPP   PSPP      +SPPPP      PPPP   P
Sbjct: 225 -------PPPPSPPSPNPPPSASPSPPFG-RSLRSPPPP----PPPPPPPGLP 265

[126][TOP]
>UniRef100_Q01942 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q01942_SOLLC
          Length = 132

 Score =  161 bits (408), Expect = 3e-38
 Identities = 94/159 (59%), Positives = 94/159 (59%)
 Frame = +2

Query: 50  PPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSP 229
           PP P     SPPPPY Y SPPPP    PSPPPP Y YKSPPPP     SPPPP Y YKSP
Sbjct: 1   PPSP-----SPPPPYYYKSPPPPS---PSPPPPYY-YKSPPPPS---PSPPPPYY-YKSP 47

Query: 230 PPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYK 409
           PPP     SP PPP  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP     
Sbjct: 48  PPP-----SPSPPP--PYYYKSPPPPD---PSPPPPYYYKSPPPPS---PSPPPPS---P 91

Query: 410 SPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKYKSPPPPV 526
           SPPPP Y   SPPPP       P PP     Y SPPPPV
Sbjct: 92  SPPPPTY--SSPPPPPPFYENIPLPPVIGVSYASPPPPV 128

 Score =  161 bits (408), Expect = 3e-38
 Identities = 94/154 (61%), Positives = 96/154 (62%)
 Frame = +2

Query: 44  PSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPVYKYK 223
           PSPPPP Y Y SPPPP   PS PPPPY Y SPPPP     SPPPP Y YKSPPPP     
Sbjct: 4   PSPPPPYY-YKSPPPPS--PS-PPPPYYYKSPPPP---SPSPPPPYY-YKSPPPP---SP 52

Query: 224 SPPPPVYKYKSPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYK 403
           SPPPP Y YKSPPPP       PSPPPP Y Y SPPPP   PSPPPP    PSPPPP   
Sbjct: 53  SPPPPYY-YKSPPPPD------PSPPPPYY-YKSPPPP--SPSPPPPS---PSPPPPT-- 97

Query: 404 YKSPPPPVYKYKSPPPPAKKPYKYPSPPPPVYKY 505
           Y SPPPP   Y++ P P      Y SPPPPV  Y
Sbjct: 98  YSSPPPPPPFYENIPLPPVIGVSYASPPPPVIPY 131

 Score =  151 bits (381), Expect = 4e-35
 Identities = 84/142 (59%), Positives = 85/142 (59%), Gaps = 9/142 (6%)
 Frame = +2

Query: 8   SPPPPPKKPYKYPSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 187
           SP PPP  PY Y SPPPP     SPPPPY Y SPPPP    PSPPPP Y YKSPPPP   
Sbjct: 3   SPSPPP--PYYYKSPPPPS---PSPPPPYYYKSPPPPS---PSPPPPYY-YKSPPPPS-- 51

Query: 188 YKSPPPPVYKYKSPPPP------VYKYKSPPPP-PKKPYKYPSPPPPVYKYNSPPPPY-- 340
             SPPPP Y YKSPPPP       Y YKSPPPP P  P   PSPPPP Y    PPPP+  
Sbjct: 52  -PSPPPPYY-YKSPPPPDPSPPP