BB904959 ( RCE02967 )

[UP]


[1][TOP]
>UniRef100_C6ZS10 Leucine rich repeat protein n=1 Tax=Glycine max RepID=C6ZS10_SOYBN
          Length = 365

 Score =  311 bits (796), Expect = 3e-83
 Identities = 149/192 (77%), Positives = 170/192 (88%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           PMS+V ++ L HLDLSNN++ GE+P DFGKL  LSRALLS NQL G+IP SV ++NRLAD
Sbjct: 170 PMSVVNLARLKHLDLSNNRLTGEIPYDFGKLAMLSRALLSENQLTGSIPKSVSRINRLAD 229

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LD+S NR++GSIPV LGKM+VLSTLKLDGNSMTG +PSTLLSNTGMGILNLSRNGF GTI
Sbjct: 230 LDVSSNRLSGSIPVELGKMKVLSTLKLDGNSMTGPVPSTLLSNTGMGILNLSRNGFSGTI 289

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PDVFG+ SYFMVLDLSFN  +GR+P SL+ +KFMGHLD+S NHLCG IPIGSPF+HLDAA
Sbjct: 290 PDVFGAGSYFMVLDLSFNNFSGRIPGSLSASKFMGHLDLSYNHLCGTIPIGSPFEHLDAA 349

Query: 543 SFSNNDCLCGNP 578
           SFSNNDCLCGNP
Sbjct: 350 SFSNNDCLCGNP 361

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 51/150 (34%), Positives = 85/150 (56%), Gaps = 1/150 (0%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSRNQLI-GTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G++  +   L  L+  +++  + + G IP  V  +  L  LDLS NRI+G IP  +G + 
Sbjct: 94  GKISPEICNLSNLTTLIVADWKAVSGEIPACVASLYTLQILDLSGNRISGKIPTDIGNLW 153

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L+ L L  N ++G+IP ++++   +  L+LS N   G IP  FG  +      LS N+L
Sbjct: 154 SLTLLSLGDNEISGEIPMSVVNLARLKHLDLSNNRLTGEIPYDFGKLAMLSRALLSENQL 213

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           TG +P S+++   +  LD+S+N L G+IP+
Sbjct: 214 TGSIPKSVSRINRLADLDVSSNRLSGSIPV 243

[2][TOP]
>UniRef100_C6ZRZ0 Leucine rich repeat protein n=1 Tax=Glycine max RepID=C6ZRZ0_SOYBN
          Length = 366

 Score =  306 bits (783), Expect = 1e-81
 Identities = 150/192 (78%), Positives = 166/192 (86%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+V++  L HLDLSNNQ+ GE+P +FG L  LSRALLS NQL G+I  SV KM RLAD
Sbjct: 171 PTSVVKLIRLKHLDLSNNQLSGEIPYNFGNLAMLSRALLSGNQLTGSISKSVSKMKRLAD 230

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LD+S NR+TGSIPV LGKMRVLSTLKLDGNSMTG +PSTLLSNTGMGILNLSRNGF GTI
Sbjct: 231 LDVSSNRLTGSIPVELGKMRVLSTLKLDGNSMTGPVPSTLLSNTGMGILNLSRNGFSGTI 290

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PDVFGS SYFMVLDLSFN  +GR+P SL+ +KFMGHLD+S NHLCG IPIGSPF+HLDAA
Sbjct: 291 PDVFGSGSYFMVLDLSFNNFSGRIPGSLSASKFMGHLDLSYNHLCGTIPIGSPFEHLDAA 350

Query: 543 SFSNNDCLCGNP 578
           SFSNNDCLCGNP
Sbjct: 351 SFSNNDCLCGNP 362

 Score = 87.0 bits (214), Expect = 9e-16
 Identities = 49/125 (39%), Positives = 74/125 (59%)
 Frame = +3

Query: 138 GTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG 317
           G IP  V  +  L  LDLS NRI+G I   +G +R L+ L L  N ++G+IP++++    
Sbjct: 120 GEIPACVASLYSLQILDLSGNRISGEISADIGNLRSLTLLSLADNEISGKIPTSVVKLIR 179

Query: 318 MGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLC 497
           +  L+LS N   G IP  FG+ +      LS N+LTG +  S++K K +  LD+S+N L 
Sbjct: 180 LKHLDLSNNQLSGEIPYNFGNLAMLSRALLSGNQLTGSISKSVSKMKRLADLDVSSNRLT 239

Query: 498 GNIPI 512
           G+IP+
Sbjct: 240 GSIPV 244

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 36/103 (34%), Positives = 60/103 (58%), Gaps = 1/103 (0%)
 Frame = +3

Query: 204 ITGSIPVRLGKMRVLSTLKL-DGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           +TG I   +  +  L+TL + D  +++G+IP+ + S   + IL+LS N   G I    G+
Sbjct: 93  MTGKISPEICNLSNLTTLVVADWKAVSGEIPACVASLYSLQILDLSGNRISGEISADIGN 152

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                +L L+ N+++G++P S+ K   + HLD+SNN L G IP
Sbjct: 153 LRSLTLLSLADNEISGKIPTSVVKLIRLKHLDLSNNQLSGEIP 195

[3][TOP]
>UniRef100_C6ZRY8 Leucine rich repeat protein n=1 Tax=Glycine max RepID=C6ZRY8_SOYBN
          Length = 274

 Score =  286 bits (732), Expect = 8e-76
 Identities = 139/192 (72%), Positives = 161/192 (83%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI ++  L HLDLSNNQ+ GE+P DFG L  LSR LLSRNQL G IP SV K+ RLAD
Sbjct: 79  PASITQLGSLKHLDLSNNQLCGEIPEDFGNLGMLSRMLLSRNQLTGKIPVSVSKIYRLAD 138

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS NR++GS+P  LG M VLSTL LD NS+ G IPS+LLSN GMGILNLSRNGFEG+I
Sbjct: 139 LDLSANRLSGSVPFELGTMPVLSTLNLDSNSLEGLIPSSLLSNGGMGILNLSRNGFEGSI 198

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PDVFGS SYFM LDLSFN L GRVP+SLA AKF+GHLD+S+NHLCG+IP+G+PFDHL+A+
Sbjct: 199 PDVFGSHSYFMALDLSFNNLKGRVPSSLASAKFIGHLDLSHNHLCGSIPLGAPFDHLEAS 258

Query: 543 SFSNNDCLCGNP 578
           SF++NDCLCGNP
Sbjct: 259 SFTSNDCLCGNP 270

 Score = 84.7 bits (208), Expect = 5e-15
 Identities = 46/126 (36%), Positives = 75/126 (59%)
 Frame = +3

Query: 132 LIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN 311
           + G IP  V  +  L  LDL  N+++G IP  +GK+  L+ L L  N+++G+IP+++   
Sbjct: 26  IAGEIPTCVTALPSLRILDLIGNKLSGEIPADVGKLSRLTVLNLADNALSGKIPASITQL 85

Query: 312 TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
             +  L+LS N   G IP+ FG+      + LS N+LTG++P S++K   +  LD+S N 
Sbjct: 86  GSLKHLDLSNNQLCGEIPEDFGNLGMLSRMLLSRNQLTGKIPVSVSKIYRLADLDLSANR 145

Query: 492 LCGNIP 509
           L G++P
Sbjct: 146 LSGSVP 151

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 37/103 (35%), Positives = 59/103 (57%), Gaps = 1/103 (0%)
 Frame = +3

Query: 204 ITGSIPVRLGKMRVLSTLKL-DGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           +TG +   +  +  L+TL + D   + G+IP+ + +   + IL+L  N   G IP   G 
Sbjct: 1   MTGKLSEAICGIDTLTTLVVADWKDIAGEIPTCVTALPSLRILDLIGNKLSGEIPADVGK 60

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            S   VL+L+ N L+G++P S+ +   + HLD+SNN LCG IP
Sbjct: 61  LSRLTVLNLADNALSGKIPASITQLGSLKHLDLSNNQLCGEIP 103

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 1/128 (0%)
 Frame = +3

Query: 132 LIGTIPDSVLKMNRLADLDLS-MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLS 308
           + G + +++  ++ L  L ++    I G IP  +  +  L  L L GN ++G+IP+ +  
Sbjct: 1   MTGKLSEAICGIDTLTTLVVADWKDIAGEIPTCVTALPSLRILDLIGNKLSGEIPADVGK 60

Query: 309 NTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNN 488
            + + +LNL+ N   G IP           LDLS N+L G +P        +  + +S N
Sbjct: 61  LSRLTVLNLADNALSGKIPASITQLGSLKHLDLSNNQLCGEIPEDFGNLGMLSRMLLSRN 120

Query: 489 HLCGNIPI 512
            L G IP+
Sbjct: 121 QLTGKIPV 128

[4][TOP]
>UniRef100_B7FJX9 Putative uncharacterized protein n=1 Tax=Medicago truncatula
           RepID=B7FJX9_MEDTR
          Length = 369

 Score =  283 bits (725), Expect = 5e-75
 Identities = 138/194 (71%), Positives = 163/194 (84%), Gaps = 2/194 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+V +  L HLDLS+N + G +P +FG L+ LSRALL+RNQL G+IP SV K+ RLAD
Sbjct: 172 PTSVVELCSLKHLDLSSNSLTGSIPVNFGNLQMLSRALLNRNQLTGSIPVSVTKIYRLAD 231

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLSMNR+TGS+P  LGKM VLSTL LD NS++GQIPS+LLSN+G+GILNLSRNGF GTI
Sbjct: 232 LDLSMNRLTGSLPYGLGKMPVLSTLNLDSNSLSGQIPSSLLSNSGLGILNLSRNGFSGTI 291

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLD 536
           PDVF   SYFMVLD+SFN L GRVP SL+ AK++GHLD+S+NHLCG+IP  +GSPFDHLD
Sbjct: 292 PDVFCPNSYFMVLDMSFNNLNGRVPGSLSSAKYIGHLDLSHNHLCGSIPLGVGSPFDHLD 351

Query: 537 AASFSNNDCLCGNP 578
           A SFSNNDCLCGNP
Sbjct: 352 ATSFSNNDCLCGNP 365

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 53/151 (35%), Positives = 89/151 (58%), Gaps = 1/151 (0%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSRNQLI-GTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G++  +  K+  L+  +L+  + I G IP  +  ++ L  LDL  N++TG IPV +GK++
Sbjct: 96  GKISPEICKIDSLTSFILADWKAISGEIPQCLTSLSNLRILDLIGNQLTGKIPVNIGKLQ 155

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L+ L L  NS++G+IP++++    +  L+LS N   G+IP  FG+        L+ N+L
Sbjct: 156 RLTVLNLAENSISGEIPTSVVELCSLKHLDLSSNSLTGSIPVNFGNLQMLSRALLNRNQL 215

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           TG +P S+ K   +  LD+S N L G++P G
Sbjct: 216 TGSIPVSVTKIYRLADLDLSMNRLTGSLPYG 246

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 62/168 (36%), Positives = 88/168 (52%), Gaps = 2/168 (1%)
 Frame = +3

Query: 12  IVRISGLMHLDLSN-NQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           I +I  L    L++   I GE+P     L  L    L  NQL G IP ++ K+ RL  L+
Sbjct: 102 ICKIDSLTSFILADWKAISGEIPQCLTSLSNLRILDLIGNQLTGKIPVNIGKLQRLTVLN 161

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           L+ N I+G IP  + ++  L  L L  NS+TG IP    +   +    L+RN   G+IP 
Sbjct: 162 LAENSISGEIPTSVVELCSLKHLDLSSNSLTGSIPVNFGNLQMLSRALLNRNQLTGSIP- 220

Query: 369 VFGSKSYFMV-LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           V  +K Y +  LDLS N+LTG +P  L K   +  L++ +N L G IP
Sbjct: 221 VSVTKIYRLADLDLSMNRLTGSLPYGLGKMPVLSTLNLDSNSLSGQIP 268

[5][TOP]
>UniRef100_Q708X5 Leucine rich repeat protein n=1 Tax=Cicer arietinum
           RepID=Q708X5_CICAR
          Length = 368

 Score =  283 bits (724), Expect = 7e-75
 Identities = 136/194 (70%), Positives = 164/194 (84%), Gaps = 2/194 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +  L HLDLSNN + G +P++FGKL+ LSRALL+RN+L G+IP S+  + RLAD
Sbjct: 171 PASIADLGSLKHLDLSNNVLTGSIPANFGKLQMLSRALLNRNKLTGSIPVSISNIYRLAD 230

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLSMNR+TGS+P  LGKM+VLSTL LD N ++GQIPS+LLSN+G+GILNLSRNGF GTI
Sbjct: 231 LDLSMNRLTGSVPSELGKMQVLSTLNLDSNLLSGQIPSSLLSNSGLGILNLSRNGFSGTI 290

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLD 536
           PDVFG KSYFM LD+SFN L GRVP SL  AK++GHLD+S+NHLCG+IP  +GSPFDHL+
Sbjct: 291 PDVFGPKSYFMALDMSFNNLNGRVPGSLLSAKYIGHLDLSHNHLCGSIPLGLGSPFDHLE 350

Query: 537 AASFSNNDCLCGNP 578
           A+SFSNNDCLCGNP
Sbjct: 351 ASSFSNNDCLCGNP 364

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 51/149 (34%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSRNQLI-GTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G++  +  K+ +L+  +++  + I G IP  V  ++ L  LDL  N+I G IP  +G ++
Sbjct: 95  GKISPEICKIDRLTSLIIADWKAITGDIPPCVTSLSNLRILDLIGNQIAGKIPSTIGNLQ 154

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            LS L L  NS++G+IP+++     +  L+LS N   G+IP  FG         L+ NKL
Sbjct: 155 SLSVLNLADNSISGEIPASIADLGSLKHLDLSNNVLTGSIPANFGKLQMLSRALLNRNKL 214

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           TG +P S++    +  LD+S N L G++P
Sbjct: 215 TGSIPVSISNIYRLADLDLSMNRLTGSVP 243

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 43/128 (33%), Positives = 66/128 (51%), Gaps = 1/128 (0%)
 Frame = +3

Query: 132 LIGTIPDSVLKMNRLADLDLS-MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLS 308
           + G I   + K++RL  L ++    ITG IP  +  +  L  L L GN + G+IPST+ +
Sbjct: 93  MTGKISPEICKIDRLTSLIIADWKAITGDIPPCVTSLSNLRILDLIGNQIAGKIPSTIGN 152

Query: 309 NTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNN 488
              + +LNL+ N   G IP           LDLS N LTG +P +  K + +    ++ N
Sbjct: 153 LQSLSVLNLADNSISGEIPASIADLGSLKHLDLSNNVLTGSIPANFGKLQMLSRALLNRN 212

Query: 489 HLCGNIPI 512
            L G+IP+
Sbjct: 213 KLTGSIPV 220

[6][TOP]
>UniRef100_B9RHG2 Serine-threonine protein kinase, plant-type, putative n=1
           Tax=Ricinus communis RepID=B9RHG2_RICCO
          Length = 422

 Score =  273 bits (698), Expect = 7e-72
 Identities = 130/192 (67%), Positives = 158/192 (82%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI +++ L HLDL NNQ+ GELPSDFG L+ LSRA+LSRNQ+ G+IP S+  M RLAD
Sbjct: 227 PASITKLANLKHLDLRNNQVSGELPSDFGSLKMLSRAMLSRNQISGSIPSSIANMYRLAD 286

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL+MNRI+G +P  LG M VLSTL LD N ++G++PS+LLS  G+GILNLSRN  EG I
Sbjct: 287 LDLAMNRISGWLPSWLGNMPVLSTLNLDSNMISGELPSSLLSCDGLGILNLSRNSIEGNI 346

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P+VFG KSYFM LDLSFNKL G +P+SL+ AK++GHLD+SNNHLCG IPIG+PFD L+ +
Sbjct: 347 PNVFGPKSYFMALDLSFNKLKGPIPSSLSSAKYIGHLDLSNNHLCGPIPIGAPFDRLEGS 406

Query: 543 SFSNNDCLCGNP 578
           SFSNNDCLCGNP
Sbjct: 407 SFSNNDCLCGNP 418

 Score = 84.0 bits (206), Expect = 8e-15
 Identities = 49/169 (28%), Positives = 84/169 (49%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +V +  L  LDL  N+I G++P+D G L++L+   L+ N++ G IP S+ K+  L  
Sbjct: 179 PECVVSLRSLRILDLVGNKISGKIPTDIGNLQRLTVLNLADNEIWGEIPASITKLANLKH 238

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL  N+++G +P   G +++LS   L                        SRN   G+I
Sbjct: 239 LDLRNNQVSGELPSDFGSLKMLSRAML------------------------SRNQISGSI 274

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P    +      LDL+ N+++G +P+ L     +  L++ +N + G +P
Sbjct: 275 PSSIANMYRLADLDLAMNRISGWLPSWLGNMPVLSTLNLDSNMISGELP 323

[7][TOP]
>UniRef100_A9PL23 Polygalacturonase-inhibiting protein n=1 Tax=Gossypium hirsutum
           RepID=A9PL23_GOSHI
          Length = 370

 Score =  273 bits (697), Expect = 9e-72
 Identities = 130/192 (67%), Positives = 156/192 (81%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SIV++S L HLDLSNN + GE+P++FG L+ LSRALLS NQL GTIP S+  M RLAD
Sbjct: 175 PSSIVQLSSLKHLDLSNNLLTGEVPANFGNLKMLSRALLSGNQLTGTIPISISNMYRLAD 234

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N+I G IP +LGKM+VL+TL L  N +TG+IP  +L +TG+GILNLSRN  EG I
Sbjct: 235 LDLSRNKIQGQIPAQLGKMKVLATLDLGSNMLTGEIPPAVLGSTGLGILNLSRNSLEGNI 294

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PDVFG KSYFM LDLSFN L G VP SL+ AKF+GHLD+S+NHLCG IP+G+PFDHL+A+
Sbjct: 295 PDVFGPKSYFMALDLSFNNLKGAVPGSLSSAKFVGHLDLSHNHLCGTIPVGTPFDHLEAS 354

Query: 543 SFSNNDCLCGNP 578
           SF +NDCLCGNP
Sbjct: 355 SFDSNDCLCGNP 366

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 47/132 (35%), Positives = 67/132 (50%), Gaps = 1/132 (0%)
 Frame = +3

Query: 120 SRNQLIGTIPDSVLKMNRLADLDLS-MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS 296
           S   + GTI  S+ +++R+  L ++    I G IP  L  +  L  L L GNS++G+IP 
Sbjct: 93  SSGYMTGTINPSICQLDRVTTLIIADWKGIAGEIPSCLASLPNLRVLDLIGNSLSGKIPD 152

Query: 297 TLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLD 476
            + +   + +LNL+ N   G IP      S    LDLS N LTG VP +    K +    
Sbjct: 153 QIGNLQKLTVLNLADNKINGEIPSSIVQLSSLKHLDLSNNLLTGEVPANFGNLKMLSRAL 212

Query: 477 ISNNHLCGNIPI 512
           +S N L G IPI
Sbjct: 213 LSGNQLTGTIPI 224

[8][TOP]
>UniRef100_B9HNM0 Predicted protein n=2 Tax=Populus RepID=B9HNM0_POPTR
          Length = 365

 Score =  268 bits (684), Expect = 3e-70
 Identities = 124/192 (64%), Positives = 159/192 (82%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ + HLDLS+N++ G+LP+DFG L+ LSRALLS+NQL G IP+S+  M RLAD
Sbjct: 170 PASLTALANMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQLSGAIPNSISGMYRLAD 229

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS+N+I+GS+P  LG MRVLSTL LD N ++GQ+P++LLS+TG+GILNLSRN  EG I
Sbjct: 230 LDLSVNKISGSVPGWLGSMRVLSTLNLDSNMISGQLPASLLSSTGLGILNLSRNAIEGNI 289

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PD FG KSYFM LDLS+N L G +P SL+ A ++GHLD+S+NHLCG IP+G+PFDHL+A+
Sbjct: 290 PDAFGPKSYFMALDLSYNNLKGPIPGSLSSAAYVGHLDLSHNHLCGTIPVGTPFDHLEAS 349

Query: 543 SFSNNDCLCGNP 578
           SFS NDCLCGNP
Sbjct: 350 SFSFNDCLCGNP 361

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 52/149 (34%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G +     KL +LS  +L+    + G IP  V  ++ L  LDL  N+I+G IP  +G ++
Sbjct: 94  GSINPSLCKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQ 153

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L+ L L  N +TG+IP++L +   M  L+LS N   G +P  FG+        LS N+L
Sbjct: 154 RLTVLNLADNGLTGEIPASLTALANMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQL 213

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +G +PNS++    +  LD+S N + G++P
Sbjct: 214 SGAIPNSISGMYRLADLDLSVNKISGSVP 242

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 52/164 (31%), Positives = 81/164 (49%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           R+S L+  D     + GE+P     L  L    L  NQ+ G IP ++  + RL  L+L+ 
Sbjct: 105 RLSTLILADWKG--VSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQRLTVLNLAD 162

Query: 198 NRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
           N +TG IP  L  +  +  L L  N +TGQ+P+   +   +    LS+N   G IP+   
Sbjct: 163 NGLTGEIPASLTALANMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQLSGAIPNSIS 222

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                  LDLS NK++G VP  L   + +  L++ +N + G +P
Sbjct: 223 GMYRLADLDLSVNKISGSVPGWLGSMRVLSTLNLDSNMISGQLP 266

[9][TOP]
>UniRef100_A9PD07 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
           RepID=A9PD07_POPTR
          Length = 365

 Score =  265 bits (678), Expect = 1e-69
 Identities = 123/192 (64%), Positives = 158/192 (82%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ + HLD S+N++ G+LP+DFG L+ LSRALLS+NQL G IP+S+  M RLAD
Sbjct: 170 PASLTALANMKHLDRSSNKLTGQLPADFGNLKMLSRALLSKNQLSGAIPNSISGMYRLAD 229

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS+N+I+GS+P  LG MRVLSTL LD N ++GQ+P++LLS+TG+GILNLSRN  EG I
Sbjct: 230 LDLSVNKISGSVPGWLGSMRVLSTLNLDSNMISGQLPASLLSSTGLGILNLSRNAIEGNI 289

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PD FG KSYFM LDLS+N L G +P SL+ A ++GHLD+S+NHLCG IP+G+PFDHL+A+
Sbjct: 290 PDAFGPKSYFMALDLSYNNLKGPIPGSLSSAAYVGHLDLSHNHLCGTIPVGTPFDHLEAS 349

Query: 543 SFSNNDCLCGNP 578
           SFS NDCLCGNP
Sbjct: 350 SFSFNDCLCGNP 361

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 51/149 (34%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G +     KL +LS  +L+    + G IP  V  ++ L  LDL  N+I+G IP  +G ++
Sbjct: 94  GSINPSLCKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQ 153

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L+ L L  N +TG+IP++L +   M  L+ S N   G +P  FG+        LS N+L
Sbjct: 154 RLTVLNLADNGLTGEIPASLTALANMKHLDRSSNKLTGQLPADFGNLKMLSRALLSKNQL 213

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +G +PNS++    +  LD+S N + G++P
Sbjct: 214 SGAIPNSISGMYRLADLDLSVNKISGSVP 242

 Score = 80.9 bits (198), Expect = 7e-14
 Identities = 51/164 (31%), Positives = 80/164 (48%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           R+S L+  D     + GE+P     L  L    L  NQ+ G IP ++  + RL  L+L+ 
Sbjct: 105 RLSTLILADWKG--VSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQRLTVLNLAD 162

Query: 198 NRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
           N +TG IP  L  +  +  L    N +TGQ+P+   +   +    LS+N   G IP+   
Sbjct: 163 NGLTGEIPASLTALANMKHLDRSSNKLTGQLPADFGNLKMLSRALLSKNQLSGAIPNSIS 222

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                  LDLS NK++G VP  L   + +  L++ +N + G +P
Sbjct: 223 GMYRLADLDLSVNKISGSVPGWLGSMRVLSTLNLDSNMISGQLP 266

[10][TOP]
>UniRef100_C7FE10 Polygalacturonase inhibiting protein n=1 Tax=Panax ginseng
           RepID=C7FE10_PANGI
          Length = 366

 Score =  255 bits (651), Expect = 2e-66
 Identities = 122/192 (63%), Positives = 155/192 (80%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +S LMHLDL NNQI G +P +FGKLR LSRALLS N++ G IP+S+  + RL+D
Sbjct: 172 PRSIANLSSLMHLDLRNNQIRGTIPRNFGKLRMLSRALLSGNRISGPIPNSISYVYRLSD 231

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS+NRI+GSIP  LGKM VL+TL LDGN+++G IP TL+ N+G+ ILNLS+N  EG I
Sbjct: 232 LDLSLNRISGSIPPSLGKMGVLATLNLDGNNISGLIPPTLI-NSGISILNLSKNSLEGDI 290

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PDVFG +SYF  LDLS+N+L G +P S++ A ++GHLD+S+NHLCG IP+GSPFDHL+A+
Sbjct: 291 PDVFGPRSYFTALDLSYNRLKGPIPKSISAASYVGHLDLSHNHLCGQIPVGSPFDHLEAS 350

Query: 543 SFSNNDCLCGNP 578
           SF +NDCLCG P
Sbjct: 351 SFMSNDCLCGKP 362

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 44/124 (35%), Positives = 69/124 (55%)
 Frame = +3

Query: 138 GTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG 317
           G IP  +  +  L  LDL  NRI G IP  +G++  L+ L +  N++TG IP ++ + + 
Sbjct: 121 GPIPSCITYLPYLRILDLIGNRINGQIPADIGRLSRLTVLNVADNNITGWIPRSIANLSS 180

Query: 318 MGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLC 497
           +  L+L  N   GTIP  FG         LS N+++G +PNS++    +  LD+S N + 
Sbjct: 181 LMHLDLRNNQIRGTIPRNFGKLRMLSRALLSGNRISGPIPNSISYVYRLSDLDLSLNRIS 240

Query: 498 GNIP 509
           G+IP
Sbjct: 241 GSIP 244

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 33/102 (32%), Positives = 53/102 (51%)
 Frame = +3

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           I+G IP  +  +  L  L L GN + GQIP+ +   + + +LN++ N   G IP    + 
Sbjct: 119 ISGPIPSCITYLPYLRILDLIGNRINGQIPADIGRLSRLTVLNVADNNITGWIPRSIANL 178

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           S  M LDL  N++ G +P +  K + +    +S N + G IP
Sbjct: 179 SSLMHLDLRNNQIRGTIPRNFGKLRMLSRALLSGNRISGPIP 220

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 37/104 (35%), Positives = 53/104 (50%), Gaps = 2/104 (1%)
 Frame = +3

Query: 204 ITGS-IPVRLGKMRVLSTLKL-DGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
           ITGS +P  L     L    + D   ++G IPS +     + IL+L  N   G IP   G
Sbjct: 93  ITGSGLPSYLWTYLALEVSTMADWKGISGPIPSCITYLPYLRILDLIGNRINGQIPADIG 152

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             S   VL+++ N +TG +P S+A    + HLD+ NN + G IP
Sbjct: 153 RLSRLTVLNVADNNITGWIPRSIANLSSLMHLDLRNNQIRGTIP 196

[11][TOP]
>UniRef100_B9GFQ7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GFQ7_POPTR
          Length = 366

 Score =  255 bits (651), Expect = 2e-66
 Identities = 118/192 (61%), Positives = 154/192 (80%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+ ++  + HLDLSNN + G+LPSDFG L+ LSRALLS+NQL G IP S+  M RLAD
Sbjct: 171 PSSLTKLENMKHLDLSNNMLTGQLPSDFGNLKMLSRALLSKNQLSGAIPSSISVMYRLAD 230

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS+N+I+G +P  +G M VLSTL LD N ++G +P +LLS+TG+G+LNLS+N  EG I
Sbjct: 231 LDLSVNQISGWLPDWIGSMPVLSTLNLDSNMISGPLPQSLLSSTGLGMLNLSKNAIEGNI 290

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PD FG K+YFM LDLS+N L G +P+SL+ A ++GHLD+S+N+LCG IP+GSPFDHL+A+
Sbjct: 291 PDAFGPKTYFMALDLSYNNLKGPIPSSLSSAAYVGHLDLSHNYLCGPIPVGSPFDHLEAS 350

Query: 543 SFSNNDCLCGNP 578
           S+S NDCLCGNP
Sbjct: 351 SYSFNDCLCGNP 362

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 55/154 (35%), Positives = 86/154 (55%), Gaps = 3/154 (1%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G +     KL +LS  +L+    + G IP+ V+ ++ L  LDL  N+I+G IP  +G ++
Sbjct: 95  GSINPSICKLDRLSTFILADWKGVSGEIPECVVSLSNLRILDLIGNKISGKIPANIGNLQ 154

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L+ L L  N +TG+IPS+L     M  L+LS N   G +P  FG+        LS N+L
Sbjct: 155 RLTVLNLADNGLTGEIPSSLTKLENMKHLDLSNNMLTGQLPSDFGNLKMLSRALLSKNQL 214

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS 518
           +G +P+S++    +  LD+S N + G +P  IGS
Sbjct: 215 SGAIPSSISVMYRLADLDLSVNQISGWLPDWIGS 248

[12][TOP]
>UniRef100_UPI0001984AE6 PREDICTED: similar to DRT100 n=1 Tax=Vitis vinifera
           RepID=UPI0001984AE6
          Length = 356

 Score =  254 bits (648), Expect = 4e-66
 Identities = 121/188 (64%), Positives = 150/188 (79%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+V ++ LMHLDL NNQI G +P DFGKL  LSRA+L RNQL GTIP S+  + RLAD
Sbjct: 168 PASVVNLASLMHLDLRNNQITGGIPQDFGKLTMLSRAMLGRNQLTGTIPSSISGLYRLAD 227

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            DLS+N+I+G IP  LG M VLSTL LD N ++G IP++LLSNTG+ ILNLSRN  EG +
Sbjct: 228 FDLSVNQISGVIPAELGSMPVLSTLNLDSNRLSGSIPASLLSNTGLNILNLSRNSLEGKL 287

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PDVFGSK+YF+ LDLS+N L G++P SL+ A ++GHLD+S+NHLCG+IP G PFDHL+A+
Sbjct: 288 PDVFGSKTYFIGLDLSYNNLKGQIPKSLSSAAYIGHLDLSHNHLCGSIPTGWPFDHLEAS 347

Query: 543 SFSNNDCL 566
           SFS NDCL
Sbjct: 348 SFSFNDCL 355

 Score = 87.0 bits (214), Expect = 9e-16
 Identities = 56/169 (33%), Positives = 81/169 (47%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +S L  LDL  N+I G +P+D GKL++L+   ++ N + G+IP SV+ +  L  
Sbjct: 120 PPCISSLSKLRILDLVGNKITGVIPADIGKLQRLTVLNVADNSISGSIPASVVNLASLMH 179

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL  N+ITG IP   GK+ +LS   L                         RN   GTI
Sbjct: 180 LDLRNNQITGGIPQDFGKLTMLSRAML------------------------GRNQLTGTI 215

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P            DLS N+++G +P  L     +  L++ +N L G+IP
Sbjct: 216 PSSISGLYRLADFDLSVNQISGVIPAELGSMPVLSTLNLDSNRLSGSIP 264

[13][TOP]
>UniRef100_A7NZU2 Chromosome chr6 scaffold_3, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7NZU2_VITVI
          Length = 364

 Score =  253 bits (646), Expect = 7e-66
 Identities = 126/192 (65%), Positives = 148/192 (77%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+ RIS L HLDL NN+I GELP DFG+L  LSRALLSRNQ  GTIP S+  + RLAD
Sbjct: 170 PSSLTRISTLTHLDLRNNRISGELPRDFGRLGMLSRALLSRNQFSGTIPSSISNIYRLAD 229

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS+NR +G IP  LGKM VLSTL LDGN ++GQIP TL+ N+ + ILNLSRN  +G I
Sbjct: 230 LDLSLNRFSGQIPASLGKMAVLSTLNLDGNLISGQIPITLI-NSAVSILNLSRNALDGEI 288

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PD FG  SYF  LDLS+NKL G +P S+A A ++GHLD+S+NHLCG IP GSPFDHL+A+
Sbjct: 289 PDAFGQGSYFTSLDLSYNKLRGPIPKSMAGAAYIGHLDLSHNHLCGRIPGGSPFDHLEAS 348

Query: 543 SFSNNDCLCGNP 578
           SF  NDCLCG P
Sbjct: 349 SFVYNDCLCGKP 360

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 44/141 (31%), Positives = 75/141 (53%), Gaps = 1/141 (0%)
 Frame = +3

Query: 90  KLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLD 266
           KLR+LS  +++    + G IP  +  +  L  LDL  N+++G IP  +G+++ L+ L + 
Sbjct: 102 KLRRLSSIIIADWKGISGEIPTCITSLPFLRILDLIGNKLSGPIPAGIGRLQRLTVLNVA 161

Query: 267 GNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSL 446
            N ++  IPS+L   + +  L+L  N   G +P  FG         LS N+ +G +P+S+
Sbjct: 162 DNLISATIPSSLTRISTLTHLDLRNNRISGELPRDFGRLGMLSRALLSRNQFSGTIPSSI 221

Query: 447 AKAKFMGHLDISNNHLCGNIP 509
           +    +  LD+S N   G IP
Sbjct: 222 SNIYRLADLDLSLNRFSGQIP 242

[14][TOP]
>UniRef100_A9P9B3 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P9B3_POPTR
          Length = 368

 Score =  248 bits (632), Expect = 3e-64
 Identities = 120/192 (62%), Positives = 149/192 (77%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +S LMHLDL NN+I G LP DFG+LR LSRALLSRN + GTIPDS+ K+ RLAD
Sbjct: 173 PRSLTNLSSLMHLDLRNNRIWGSLPRDFGRLRMLSRALLSRNYIGGTIPDSISKIYRLAD 232

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS+NR++G IP  LGKM VL+TL LD N+++G IP +L  N+ +G LNLS+N F G +
Sbjct: 233 LDLSLNRLSGEIPASLGKMAVLATLNLDANNLSGNIPYSLF-NSAIGNLNLSKNSFHGYL 291

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PDVFG  SYFMVLDLS+N   G +P SL++A F+GHLD+S+N LCG IP G PFDHL+A+
Sbjct: 292 PDVFGPGSYFMVLDLSYNNFWGLIPKSLSQASFIGHLDLSHNRLCGRIPAGPPFDHLEAS 351

Query: 543 SFSNNDCLCGNP 578
           SF+ N CLCG P
Sbjct: 352 SFAYNACLCGKP 363

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 53/173 (30%), Positives = 82/173 (47%), Gaps = 25/173 (14%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G +     KL++LS   ++    + G IP  +  +  L  LDL  NR++G IP  +G++ 
Sbjct: 97  GSISPSICKLKRLSSLTIADWKGISGPIPACITSLPFLRILDLIGNRLSGPIPEDIGRLH 156

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILN------------------------LSRNGF 350
            L+ L +  N +T +IP +L + + +  L+                        LSRN  
Sbjct: 157 RLTVLNIADNLVTSRIPRSLTNLSSLMHLDLRNNRIWGSLPRDFGRLRMLSRALLSRNYI 216

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            GTIPD          LDLS N+L+G +P SL K   +  L++  N+L GNIP
Sbjct: 217 GGTIPDSISKIYRLADLDLSLNRLSGEIPASLGKMAVLATLNLDANNLSGNIP 269

[15][TOP]
>UniRef100_B9GM86 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GM86_POPTR
          Length = 368

 Score =  246 bits (629), Expect = 7e-64
 Identities = 117/192 (60%), Positives = 150/192 (78%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +S LMHLDL NN+I G LP DFG+LR LSRALLSRN + GTIPDS+ K+ RLAD
Sbjct: 173 PRSLTNLSSLMHLDLRNNRIWGPLPLDFGRLRMLSRALLSRNYISGTIPDSISKIYRLAD 232

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS+N+++G IP  LGKM VL+TL LD N ++G+IP +L  N+ +G LNLS+N F+G +
Sbjct: 233 LDLSLNKLSGEIPASLGKMAVLATLNLDSNKLSGKIPDSLF-NSAIGNLNLSKNSFQGYL 291

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PDVFG +SYF VLDLS+N   G +P SL++A F+GH+D+S+N LCG IP G PFDHL+A+
Sbjct: 292 PDVFGPRSYFTVLDLSYNNFWGPIPKSLSQASFIGHMDLSHNRLCGRIPAGPPFDHLEAS 351

Query: 543 SFSNNDCLCGNP 578
           SF+ N CLCG P
Sbjct: 352 SFAYNACLCGKP 363

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 54/173 (31%), Positives = 81/173 (46%), Gaps = 25/173 (14%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G +     KL +LS   +S    + G IP  +  +  L  +DL  NRI+G IP  +G++ 
Sbjct: 97  GSISPSICKLERLSSLTISDWKGISGPIPACITSLPFLRIIDLIGNRISGEIPADIGRLE 156

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILN------------------------LSRNGF 350
            ++ L +  N +TG+IP +L + + +  L+                        LSRN  
Sbjct: 157 RMTVLNIADNLVTGRIPRSLTNLSSLMHLDLRNNRIWGPLPLDFGRLRMLSRALLSRNYI 216

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            GTIPD          LDLS NKL+G +P SL K   +  L++ +N L G IP
Sbjct: 217 SGTIPDSISKIYRLADLDLSLNKLSGEIPASLGKMAVLATLNLDSNKLSGKIP 269

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 36/104 (34%), Positives = 58/104 (55%), Gaps = 1/104 (0%)
 Frame = +3

Query: 204 ITGSIPVRLGKMRVLSTLKL-DGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           +TGSI   + K+  LS+L + D   ++G IP+ + S   + I++L  N   G IP   G 
Sbjct: 95  MTGSISPSICKLERLSSLTISDWKGISGPIPACITSLPFLRIIDLIGNRISGEIPADIGR 154

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
                VL+++ N +TGR+P SL     + HLD+ NN + G +P+
Sbjct: 155 LERMTVLNIADNLVTGRIPRSLTNLSSLMHLDLRNNRIWGPLPL 198

[16][TOP]
>UniRef100_Q00874 DNA-damage-repair/toleration protein DRT100 n=1 Tax=Arabidopsis
           thaliana RepID=DR100_ARATH
          Length = 372

 Score =  244 bits (624), Expect = 3e-63
 Identities = 118/192 (61%), Positives = 146/192 (76%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +  L HL+L+ N I G +P+DFG L+ LSR LL RN+L G+IP+S+  M RLAD
Sbjct: 176 PASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLAD 235

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N I G IP  +G M+VLS L LD NS+TG IP +LLSN+G+ + NLSRN  EGTI
Sbjct: 236 LDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEGTI 295

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PDVFGSK+Y + LDLS N L+GR+P+SL+ AKF+GHLDIS+N LCG IP G PFDHL+A 
Sbjct: 296 PDVFGSKTYLVSLDLSHNSLSGRIPDSLSSAKFVGHLDISHNKLCGRIPTGFPFDHLEAT 355

Query: 543 SFSNNDCLCGNP 578
           SFS+N CLCG P
Sbjct: 356 SFSDNQCLCGGP 367

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 54/144 (37%), Positives = 79/144 (54%)
 Frame = +3

Query: 132 LIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN 311
           + G IP  +  +  L  LDL+ N+ITG IP  +GK+  L+ L L  N M+G+IP++L S 
Sbjct: 123 ITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSL 182

Query: 312 TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
             +  L L+ NG  G IP  FGS      + L  N+LTG +P S++  + +  LD+S NH
Sbjct: 183 IELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADLDLSKNH 242

Query: 492 LCGNIPIGSPFDHLDAASFSNNDC 563
           + G  PI     ++   S  N DC
Sbjct: 243 IEG--PIPEWMGNMKVLSLLNLDC 264

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 62/187 (33%), Positives = 90/187 (48%), Gaps = 2/187 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++ L  LDL+ N+I GE+P++ GKL KL+   L+ NQ+ G IP S+  +  L  
Sbjct: 128 PPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKH 187

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L+ N ITG IP   G +++LS + L                         RN   G+I
Sbjct: 188 LELTENGITGVIPADFGSLKMLSRVLL------------------------GRNELTGSI 223

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDH--LD 536
           P+          LDLS N + G +P  +   K +  L++  N L G IP GS   +  LD
Sbjct: 224 PESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIP-GSLLSNSGLD 282

Query: 537 AASFSNN 557
            A+ S N
Sbjct: 283 VANLSRN 289

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 35/103 (33%), Positives = 58/103 (56%), Gaps = 1/103 (0%)
 Frame = +3

Query: 204 ITGSIPVRLGKMRVLSTLKL-DGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           ++GSI   +  +  L++L L D   +TG+IP  + S   + IL+L+ N   G IP   G 
Sbjct: 98  MSGSIDPAVCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGNKITGEIPAEIGK 157

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            S   VL+L+ N+++G +P SL     + HL+++ N + G IP
Sbjct: 158 LSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIP 200

[17][TOP]
>UniRef100_Q8GTD6 Polygalacturonase inhibitor-like protein (Fragment) n=1 Tax=Cicer
           arietinum RepID=Q8GTD6_CICAR
          Length = 322

 Score =  243 bits (620), Expect = 8e-63
 Identities = 116/192 (60%), Positives = 147/192 (76%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +  LMHLD+ NNQI G +P DFG+L  LSRALLS N++ G IPDS+ ++ RLAD
Sbjct: 126 PPSLTNLRSLMHLDIRNNQISGPIPKDFGRLPMLSRALLSGNKISGPIPDSISRIYRLAD 185

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N+++G IP  LGKM VLSTL LD N ++G IP++L  N+G+  LNLSRNG  G +
Sbjct: 186 LDLSRNQVSGPIPESLGKMAVLSTLNLDMNKLSGPIPASLF-NSGISDLNLSRNGLNGNL 244

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PDVFG++SYF VLDLS+N L G +P S+  A ++GHLD+S NHLCG IP+GSPFDHL+A+
Sbjct: 245 PDVFGARSYFTVLDLSYNSLKGPIPKSMGLASYIGHLDLSYNHLCGKIPVGSPFDHLEAS 304

Query: 543 SFSNNDCLCGNP 578
           SF  NDCLCG P
Sbjct: 305 SFVYNDCLCGKP 316

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 44/141 (31%), Positives = 76/141 (53%), Gaps = 1/141 (0%)
 Frame = +3

Query: 90  KLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLD 266
           KL +LS   ++    + G IP  +  +  L  +DL  NRI+ +IP  +G++  L+ L + 
Sbjct: 58  KLTRLSSITVADWKNISGEIPRCITSLPFLRIIDLIGNRISSTIPSDIGRLHRLTVLNVA 117

Query: 267 GNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSL 446
            N+++G IP +L +   +  L++  N   G IP  FG         LS NK++G +P+S+
Sbjct: 118 DNAISGNIPPSLTNLRSLMHLDIRNNQISGPIPKDFGRLPMLSRALLSGNKISGPIPDSI 177

Query: 447 AKAKFMGHLDISNNHLCGNIP 509
           ++   +  LD+S N + G IP
Sbjct: 178 SRIYRLADLDLSRNQVSGPIP 198

[18][TOP]
>UniRef100_Q6Z3T9 Os08g0505900 protein n=2 Tax=Oryza sativa RepID=Q6Z3T9_ORYSJ
          Length = 380

 Score =  241 bits (614), Expect = 4e-62
 Identities = 118/192 (61%), Positives = 146/192 (76%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  ++ L HLDL+NNQ+ G +P D G L  LSRALL RN+L G IP SV  + RLAD
Sbjct: 184 PSSITSLASLKHLDLTNNQLTGGIPDDVGDLTMLSRALLGRNKLTGAIPTSVGSLTRLAD 243

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL+ N +TG IP  LG   VL++L L GN ++G+IP++LL N G+GILNLSRN  EG I
Sbjct: 244 LDLAENGLTGGIPDSLGGAHVLTSLYLGGNRVSGRIPASLLQNKGLGILNLSRNAVEGAI 303

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PDVF ++SYFMVLDLS N+LTG VP SL+ A ++GHLD+S+N LCG+IP G PFDHLDAA
Sbjct: 304 PDVFTAESYFMVLDLSRNRLTGAVPRSLSAAAYVGHLDLSHNRLCGSIPAGPPFDHLDAA 363

Query: 543 SFSNNDCLCGNP 578
           SF++N CLCG P
Sbjct: 364 SFASNSCLCGGP 375

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 43/126 (34%), Positives = 69/126 (54%), Gaps = 2/126 (1%)
 Frame = +3

Query: 138 GTIPDSVLKMNRLADLDLS-MNRITGSIPVRLGK-MRVLSTLKLDGNSMTGQIPSTLLSN 311
           G I D+V ++ RL+ L L+   +I+G IP  +   +  L  L+L GN +TG+IP ++ S 
Sbjct: 107 GYISDAVCRLGRLSSLILADWKQISGPIPPCVATALPYLRILELPGNRLTGEIPRSIGSL 166

Query: 312 TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
           + + +LNL+ N   G IP    S +    LDL+ N+LTG +P+ +     +    +  N 
Sbjct: 167 SRLTVLNLADNLIAGEIPSSITSLASLKHLDLTNNQLTGGIPDDVGDLTMLSRALLGRNK 226

Query: 492 LCGNIP 509
           L G IP
Sbjct: 227 LTGAIP 232

[19][TOP]
>UniRef100_Q9LT39 Polygalacturonase inhibitor-like protein n=1 Tax=Arabidopsis
           thaliana RepID=Q9LT39_ARATH
          Length = 365

 Score =  236 bits (602), Expect = 9e-61
 Identities = 114/192 (59%), Positives = 149/192 (77%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +S LMHLDL NN I G +PSD G+L+ LSRALLS N++ G IP+S+  + RLAD
Sbjct: 168 PKSLTNLSSLMHLDLRNNLISGVIPSDVGRLKMLSRALLSGNRITGRIPESLTNIYRLAD 227

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +DLS N++ G+IP  LG+M VL+TL LDGN ++G+IP TL++++ M  LNLSRN  +G I
Sbjct: 228 VDLSGNQLYGTIPPSLGRMSVLATLNLDGNKISGEIPQTLMTSSVMN-LNLSRNLLQGKI 286

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P+ FG +SYF VLDLS+N L G +P S++ A F+GHLD+S+NHLCG IP+GSPFDHL+AA
Sbjct: 287 PEGFGPRSYFTVLDLSYNNLKGPIPRSISGASFIGHLDLSHNHLCGRIPVGSPFDHLEAA 346

Query: 543 SFSNNDCLCGNP 578
           SF  NDCLCG P
Sbjct: 347 SFMFNDCLCGKP 358

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 47/149 (31%), Positives = 77/149 (51%), Gaps = 1/149 (0%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G + +   +L +LS   ++    + G IP  + ++  L  LDL  N+I+G IP  +G++ 
Sbjct: 92  GHISASICELTRLSAITIADWKGISGEIPKCITRLPFLRTLDLIGNQISGGIPYDIGRLN 151

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L+ L +  N ++G IP +L + + +  L+L  N   G IP   G         LS N++
Sbjct: 152 RLAVLNVADNRISGSIPKSLTNLSSLMHLDLRNNLISGVIPSDVGRLKMLSRALLSGNRI 211

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           TGR+P SL     +  +D+S N L G IP
Sbjct: 212 TGRIPESLTNIYRLADVDLSGNQLYGTIP 240

[20][TOP]
>UniRef100_C5YIT6 Putative uncharacterized protein Sb07g027860 n=1 Tax=Sorghum
           bicolor RepID=C5YIT6_SORBI
          Length = 379

 Score =  235 bits (600), Expect = 2e-60
 Identities = 117/197 (59%), Positives = 150/197 (76%), Gaps = 5/197 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ L HLDL+NN++ G LPSDFGKLR LSRALL RN+L G IP SV  M RLAD
Sbjct: 178 PGSVTSLAELKHLDLANNRLTGRLPSDFGKLRMLSRALLGRNRLSGPIPASVASMPRLAD 237

Query: 183 LDLSMNRITGSIPVRLGKM-----RVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNG 347
           LDLS N++TG+IP  LG+       VL++L L GN ++G +P++LL+N+G+G+LNLSRN 
Sbjct: 238 LDLSENQLTGAIPEGLGRGSGNGGNVLTSLYLGGNRLSGGVPASLLANSGLGMLNLSRNA 297

Query: 348 FEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFD 527
             G IPD F  +SYFM+LDLS N+LTG VP SL+ A ++GHLD+S+N LCG+IP G PFD
Sbjct: 298 LGGGIPDAFTPRSYFMLLDLSRNRLTGGVPRSLSLAAYVGHLDLSHNRLCGSIPAGPPFD 357

Query: 528 HLDAASFSNNDCLCGNP 578
           HLDA SF++N CLCG P
Sbjct: 358 HLDAQSFASNSCLCGGP 374

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 50/144 (34%), Positives = 75/144 (52%), Gaps = 2/144 (1%)
 Frame = +3

Query: 90  KLRKLSRALLSR-NQLIGTIPDSVL-KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKL 263
           +L +LS  +L+   Q+ G +P  V   +  L  L+L  NR+TG+IP  L  +  L+ L L
Sbjct: 110 RLDRLSSLVLADWKQISGPVPACVATSLPYLRILELPGNRLTGAIPP-LAALSRLAVLNL 168

Query: 264 DGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNS 443
             N +TG IP ++ S   +  L+L+ N   G +P  FG         L  N+L+G +P S
Sbjct: 169 ADNQLTGGIPGSVTSLAELKHLDLANNRLTGRLPSDFGKLRMLSRALLGRNRLSGPIPAS 228

Query: 444 LAKAKFMGHLDISNNHLCGNIPIG 515
           +A    +  LD+S N L G IP G
Sbjct: 229 VASMPRLADLDLSENQLTGAIPEG 252

[21][TOP]
>UniRef100_B9RI89 Serine-threonine protein kinase, plant-type, putative n=1
           Tax=Ricinus communis RepID=B9RI89_RICCO
          Length = 366

 Score =  235 bits (600), Expect = 2e-60
 Identities = 113/192 (58%), Positives = 144/192 (75%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +S LMHLDL NN+I G LP DF +L  LSRALLS+N + GTIP ++ K+ RLAD
Sbjct: 172 PRSLTNLSSLMHLDLRNNRISGPLPRDFHRLTMLSRALLSQNYISGTIPSAISKIYRLAD 231

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS NR++G IP  LG+M VL TL LD N ++G+IP++L  N+G+  LNLS+N F G +
Sbjct: 232 LDLSSNRLSGPIPDSLGRMPVLGTLNLDANKLSGKIPASLF-NSGISNLNLSKNSFAGYL 290

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PDVF   SYF VLDLS+N   G +P SL+ A ++GHLD+S+NHLCG IP G PFDHL+A+
Sbjct: 291 PDVFSQGSYFTVLDLSYNNFRGPIPKSLSSASYIGHLDLSHNHLCGKIPAGDPFDHLEAS 350

Query: 543 SFSNNDCLCGNP 578
           SF+ NDCLCG P
Sbjct: 351 SFAYNDCLCGKP 362

[22][TOP]
>UniRef100_C6ZS03 Leucine rich repeat protein n=1 Tax=Glycine max RepID=C6ZS03_SOYBN
          Length = 368

 Score =  235 bits (599), Expect = 2e-60
 Identities = 116/192 (60%), Positives = 142/192 (73%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +S LMHLDL NN   G +P +FG L  LSRALLS N+L G IP SV ++ RLAD
Sbjct: 173 PTSLANLSSLMHLDLRNNLFSGPIPRNFGSLSMLSRALLSGNRLSGAIPSSVSQIYRLAD 232

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N+I+G IP  LGKM VLSTL LD N ++G IP +L S+ G+  LNLSRN  EG I
Sbjct: 233 LDLSRNQISGPIPESLGKMAVLSTLNLDMNKLSGPIPVSLFSS-GISDLNLSRNALEGNI 291

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PD FG +SYF  LDLS+N L G +P S++ A ++GHLD+S+NHLCG IP+GSPFDHL+A+
Sbjct: 292 PDAFGVRSYFTALDLSYNNLKGAIPKSISSASYIGHLDLSHNHLCGKIPLGSPFDHLEAS 351

Query: 543 SFSNNDCLCGNP 578
           SF  NDCLCG P
Sbjct: 352 SFVYNDCLCGKP 363

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 49/141 (34%), Positives = 81/141 (57%), Gaps = 1/141 (0%)
 Frame = +3

Query: 90  KLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLD 266
           KL +LS   ++    + G IP  +  +  L  +DL  NR++GSIP  +G++  L+ L + 
Sbjct: 105 KLARLSSITIADWKGISGEIPRCITTLPFLRIVDLIGNRLSGSIPAGIGRLHRLTVLNVA 164

Query: 267 GNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSL 446
            N ++G IP++L + + +  L+L  N F G IP  FGS S      LS N+L+G +P+S+
Sbjct: 165 DNLISGTIPTSLANLSSLMHLDLRNNLFSGPIPRNFGSLSMLSRALLSGNRLSGAIPSSV 224

Query: 447 AKAKFMGHLDISNNHLCGNIP 509
           ++   +  LD+S N + G IP
Sbjct: 225 SQIYRLADLDLSRNQISGPIP 245

[23][TOP]
>UniRef100_Q9LXU5 Putative uncharacterized protein T24H18_110 n=1 Tax=Arabidopsis
           thaliana RepID=Q9LXU5_ARATH
          Length = 371

 Score =  227 bits (578), Expect = 6e-58
 Identities = 111/192 (57%), Positives = 143/192 (74%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI R+  L HLDL NN I G +P D G+L+ +SR LLS N++ G IPDS+ ++ RLAD
Sbjct: 175 PPSITRLVSLSHLDLRNNNISGVIPRDIGRLKMVSRVLLSGNKISGQIPDSLTRIYRLAD 234

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LSMNR+TG IP   GKM VL+TL LDGN ++G IP +LL+++ +  LNLS N   G+I
Sbjct: 235 LELSMNRLTGPIPASFGKMSVLATLNLDGNLISGMIPGSLLASS-ISNLNLSGNLITGSI 293

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P+ FG +SYF VLDL+ N+L G +P S+  A F+GHLD+S+NHLCG IP+GSPFDHLDA 
Sbjct: 294 PNTFGPRSYFTVLDLANNRLQGPIPASITAASFIGHLDVSHNHLCGKIPMGSPFDHLDAT 353

Query: 543 SFSNNDCLCGNP 578
           SF+ N CLCG P
Sbjct: 354 SFAYNACLCGKP 365

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 47/149 (31%), Positives = 74/149 (49%), Gaps = 1/149 (0%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G +     KL +LS  +++    + G IP  +  +  L  LDL  N+ +G IP  +GK+ 
Sbjct: 99  GSISPSICKLTRLSGIIIADWKGISGVIPSCIENLPFLRHLDLVGNKFSGVIPANIGKLL 158

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L  L L  N + G IP ++     +  L+L  N   G IP   G       + LS NK+
Sbjct: 159 RLKVLNLADNHLYGVIPPSITRLVSLSHLDLRNNNISGVIPRDIGRLKMVSRVLLSGNKI 218

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +G++P+SL +   +  L++S N L G IP
Sbjct: 219 SGQIPDSLTRIYRLADLELSMNRLTGPIP 247

[24][TOP]
>UniRef100_Q94BN7 Putative uncharacterized protein At5g12940 n=1 Tax=Arabidopsis
           thaliana RepID=Q94BN7_ARATH
          Length = 371

 Score =  227 bits (578), Expect = 6e-58
 Identities = 111/192 (57%), Positives = 143/192 (74%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI R+  L HLDL NN I G +P D G+L+ +SR LLS N++ G IPDS+ ++ RLAD
Sbjct: 175 PPSITRLVSLSHLDLRNNNISGVIPRDIGRLKMVSRVLLSGNKISGQIPDSLTRIYRLAD 234

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LSMNR+TG IP   GKM VL+TL LDGN ++G IP +LL+++ +  LNLS N   G+I
Sbjct: 235 LELSMNRLTGPIPASFGKMSVLATLNLDGNLISGMIPGSLLASS-ISNLNLSGNLITGSI 293

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P+ FG +SYF VLDL+ N+L G +P S+  A F+GHLD+S+NHLCG IP+GSPFDHLDA 
Sbjct: 294 PNTFGPRSYFTVLDLANNRLQGLIPASITAASFIGHLDVSHNHLCGKIPMGSPFDHLDAT 353

Query: 543 SFSNNDCLCGNP 578
           SF+ N CLCG P
Sbjct: 354 SFAYNACLCGKP 365

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 47/149 (31%), Positives = 74/149 (49%), Gaps = 1/149 (0%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G +     KL +LS  +++    + G IP  +  +  L  LDL  N+ +G IP  +GK+ 
Sbjct: 99  GSISPSICKLTRLSGIIIADWKGISGVIPSCIENLPFLRHLDLVGNKFSGVIPANIGKLL 158

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L  L L  N + G IP ++     +  L+L  N   G IP   G       + LS NK+
Sbjct: 159 RLKVLNLADNHLYGVIPPSITRLVSLSHLDLRNNNISGVIPRDIGRLKMVSRVLLSGNKI 218

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +G++P+SL +   +  L++S N L G IP
Sbjct: 219 SGQIPDSLTRIYRLADLELSMNRLTGPIP 247

[25][TOP]
>UniRef100_Q8LA03 Leucine rich repeat protein, putative n=1 Tax=Arabidopsis thaliana
           RepID=Q8LA03_ARATH
          Length = 371

 Score =  225 bits (574), Expect = 2e-57
 Identities = 110/192 (57%), Positives = 143/192 (74%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI R+  L HLDL NN I G +P D G+L+ +SR LLS N++ G IP+S+ ++ RLAD
Sbjct: 175 PPSITRLVSLSHLDLRNNNISGVIPRDIGRLKMVSRVLLSGNKISGQIPESLTRIYRLAD 234

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LSMNR+TG IP   GKM VL+TL LDGN ++G IP +LL+++ +  LNLS N   G+I
Sbjct: 235 LELSMNRLTGPIPASFGKMSVLATLNLDGNLISGMIPGSLLASS-ISNLNLSGNLITGSI 293

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P+ FG +SYF VLDL+ N+L G +P S+  A F+GHLD+S+NHLCG IP+GSPFDHLDA 
Sbjct: 294 PNTFGPRSYFTVLDLANNRLQGPIPASITAASFIGHLDVSHNHLCGKIPMGSPFDHLDAT 353

Query: 543 SFSNNDCLCGNP 578
           SF+ N CLCG P
Sbjct: 354 SFAYNACLCGKP 365

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 47/149 (31%), Positives = 73/149 (48%), Gaps = 1/149 (0%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G +     KL +LS  +++    + G IP  +  +  L  LDL  N+ +G IP  +GK+ 
Sbjct: 99  GSISPSICKLTRLSGIIIADWKGISGVIPSCIENLPFLRHLDLVGNKFSGVIPANIGKLL 158

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L  L L  N + G IP ++     +  L+L  N   G IP   G       + LS NK+
Sbjct: 159 RLKVLNLADNHLYGVIPPSITRLVSLSHLDLRNNNISGVIPRDIGRLKMVSRVLLSGNKI 218

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +G++P SL +   +  L++S N L G IP
Sbjct: 219 SGQIPESLTRIYRLADLELSMNRLTGPIP 247

[26][TOP]
>UniRef100_B6TS69 Polygalacturonase inhibitor 2 n=1 Tax=Zea mays RepID=B6TS69_MAIZE
          Length = 425

 Score =  217 bits (552), Expect = 6e-55
 Identities = 109/196 (55%), Positives = 140/196 (71%), Gaps = 4/196 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ L HLDL+ N++ G +P D G+LR LSRALL+RN+L G IP SV  + RLAD
Sbjct: 225 PASLTSLTELKHLDLAGNRLSGRVPPDLGRLRMLSRALLARNRLSGPIPASVASLPRLAD 284

Query: 183 LDLSMNRITGSIPVRLG----KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           LDLS N++TG+IP  LG       VL+TL L GN ++G +P++LL + G+G+LNLSRN  
Sbjct: 285 LDLSENQLTGAIPEGLGAGPGNSGVLTTLYLGGNRLSGGVPASLLRSGGLGMLNLSRNAL 344

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDH 530
            G +PD F  +SYFM+LDLS N+LTG VP SLA A ++GHLD+S+N LCG IP G PFD 
Sbjct: 345 GGGVPDAFTPRSYFMLLDLSRNRLTGGVPRSLASAAYVGHLDLSHNRLCGTIPAGPPFDR 404

Query: 531 LDAASFSNNDCLCGNP 578
           L A SF  N CLCG P
Sbjct: 405 LGAESFVGNSCLCGGP 420

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 50/144 (34%), Positives = 77/144 (53%), Gaps = 2/144 (1%)
 Frame = +3

Query: 90  KLRKLSRALLSR-NQLIGTIPDSVL-KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKL 263
           +L +LS  +L+   ++ G IP  V   +  L  L+L  NR+TG++P   G    L+ L L
Sbjct: 156 RLDRLSTLVLADWKRISGPIPACVATSLPYLRVLELPGNRLTGAVPPLGGGQSRLAVLNL 215

Query: 264 DGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNS 443
            GN ++G IP++L S T +  L+L+ N   G +P   G         L+ N+L+G +P S
Sbjct: 216 AGNQLSGGIPASLTSLTELKHLDLAGNRLSGRVPPDLGRLRMLSRALLARNRLSGPIPAS 275

Query: 444 LAKAKFMGHLDISNNHLCGNIPIG 515
           +A    +  LD+S N L G IP G
Sbjct: 276 VASLPRLADLDLSENQLTGAIPEG 299

[27][TOP]
>UniRef100_B4G1D7 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4G1D7_MAIZE
          Length = 381

 Score =  217 bits (552), Expect = 6e-55
 Identities = 109/196 (55%), Positives = 140/196 (71%), Gaps = 4/196 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ L HLDL+ N++ G +P D G+LR LSRALL+RN+L G IP SV  + RLAD
Sbjct: 181 PASLTSLTELKHLDLAGNRLSGRVPPDLGRLRMLSRALLARNRLSGPIPASVASLPRLAD 240

Query: 183 LDLSMNRITGSIPVRLG----KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           LDLS N++TG+IP  LG       VL+TL L GN ++G +P++LL + G+G+LNLSRN  
Sbjct: 241 LDLSENQLTGAIPEGLGAGPGNSGVLTTLYLGGNRLSGGVPASLLRSGGLGMLNLSRNAL 300

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDH 530
            G +PD F  +SYFM+LDLS N+LTG VP SLA A ++GHLD+S+N LCG IP G PFD 
Sbjct: 301 GGGVPDAFTPRSYFMLLDLSRNRLTGGVPRSLASAAYVGHLDLSHNRLCGTIPAGPPFDR 360

Query: 531 LDAASFSNNDCLCGNP 578
           L A SF  N CLCG P
Sbjct: 361 LGAESFVGNSCLCGGP 376

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 50/144 (34%), Positives = 77/144 (53%), Gaps = 2/144 (1%)
 Frame = +3

Query: 90  KLRKLSRALLSR-NQLIGTIPDSVL-KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKL 263
           +L +LS  +L+   ++ G IP  V   +  L  L+L  NR+TG++P   G    L+ L L
Sbjct: 112 RLDRLSTLVLADWKRISGPIPACVATSLPYLRVLELPGNRLTGAVPPLGGGQSRLAVLNL 171

Query: 264 DGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNS 443
            GN ++G IP++L S T +  L+L+ N   G +P   G         L+ N+L+G +P S
Sbjct: 172 AGNQLSGGIPASLTSLTELKHLDLAGNRLSGRVPPDLGRLRMLSRALLARNRLSGPIPAS 231

Query: 444 LAKAKFMGHLDISNNHLCGNIPIG 515
           +A    +  LD+S N L G IP G
Sbjct: 232 VASLPRLADLDLSENQLTGAIPEG 255

[28][TOP]
>UniRef100_Q5YJS2 Leucine-rich repeat protein (Fragment) n=1 Tax=Hyacinthus
           orientalis RepID=Q5YJS2_HYAOR
          Length = 220

 Score =  209 bits (533), Expect = 9e-53
 Identities = 99/169 (58%), Positives = 130/169 (76%), Gaps = 1/169 (0%)
 Frame = +3

Query: 75  PSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLST 254
           P DFG L+ LSRALL++N + G+IP S++ M RLADLD+S NR+TG IP  +G+M+V+ST
Sbjct: 46  PKDFGSLKMLSRALLAKNHISGSIPASIVGMKRLADLDISSNRLTGKIPYNIGRMQVMST 105

Query: 255 LKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRV 434
           L LDGN+++G IP++LL+  G+GILNLS N   G IPDVFG + YFM+LDL  N+LTG V
Sbjct: 106 LNLDGNALSGGIPASLLAMRGLGILNLSGNSLGGAIPDVFGERPYFMMLDLPHNRLTGHV 165

Query: 435 PNSLAKAKFMGHLDISNNHLCGNIPIGSPFD-HLDAASFSNNDCLCGNP 578
           P +L+ A ++GHLD+S+NHLCG IP G P    L+A SF+ NDCLCG P
Sbjct: 166 PKTLSAAAYVGHLDLSHNHLCGRIPAGDPVSIILEADSFAGNDCLCGAP 214

[29][TOP]
>UniRef100_B7FNF6 Putative uncharacterized protein n=1 Tax=Medicago truncatula
           RepID=B7FNF6_MEDTR
          Length = 367

 Score =  206 bits (525), Expect = 8e-52
 Identities = 102/192 (53%), Positives = 135/192 (70%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ L HLD+ NN+I G +P  FG+L+ L RALLS NQL G IP S+ ++ RL+D
Sbjct: 172 PRSLTNLTSLTHLDIRNNRISGYIPMGFGRLQYLGRALLSGNQLHGPIPGSISRIKRLSD 231

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N+++G IP  LG M VL TLKLD N ++G IP +L   +G+  LNLS N  EG I
Sbjct: 232 LDLSRNQLSGPIPESLGLMSVLGTLKLDTNKLSGMIPKSLF-GSGISDLNLSHNLLEGNI 290

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PD FG +SYF  LD+S+N L G +P S++ A ++G++D+S+NHLCG  PI    DHLDA+
Sbjct: 291 PDAFGGRSYFTSLDISYNNLKGPIPKSISSAAYIGYMDLSHNHLCG--PIPKVLDHLDAS 348

Query: 543 SFSNNDCLCGNP 578
           SF  NDCLCG P
Sbjct: 349 SFEVNDCLCGKP 360

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 54/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G++  +  KL KLS   ++  N + G IP  +  ++ L  +DL+ NR +G+IP  +GK+R
Sbjct: 96  GQISPEICKLTKLSSITITDWNGISGEIPKCISSLSFLRIIDLAGNRFSGNIPSDIGKLR 155

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L+ L +  N +TG IP +L + T +  L++  N   G IP  FG   Y     LS N+L
Sbjct: 156 HLNRLSIADNVITGGIPRSLTNLTSLTHLDIRNNRISGYIPMGFGRLQYLGRALLSGNQL 215

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G +P S+++ K +  LD+S N L G IP
Sbjct: 216 HGPIPGSISRIKRLSDLDLSRNQLSGPIP 244

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 2/120 (1%)
 Frame = +3

Query: 204 ITGSIPVRLGKMRVLSTLKL-DGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           +TG I   + K+  LS++ + D N ++G+IP  + S + + I++L+ N F G IP   G 
Sbjct: 94  MTGQISPEICKLTKLSSITITDWNGISGEIPKCISSLSFLRIIDLAGNRFSGNIPSDIGK 153

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
             +   L ++ N +TG +P SL     + HLDI NN + G IP+G     +L  A  S N
Sbjct: 154 LRHLNRLSIADNVITGGIPRSLTNLTSLTHLDIRNNRISGYIPMGFGRLQYLGRALLSGN 213

[30][TOP]
>UniRef100_B3VVJ8 Leucine rich repeat protein (Fragment) n=1 Tax=Populus tremula
           RepID=B3VVJ8_POPTN
          Length = 267

 Score =  197 bits (501), Expect = 5e-49
 Identities = 94/155 (60%), Positives = 124/155 (80%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ + HLDLS+N++ G+LP+DFG L+ LSRALLS+NQL G IP+S+  M RLAD
Sbjct: 113 PASLTALANMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQLSGAIPNSISGMYRLAD 172

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS+N+I+GS+P  +G MRVLSTL LD N ++GQ+P++LLS+TG+GI+NLSRN  EG I
Sbjct: 173 LDLSVNKISGSVPGWIGSMRVLSTLNLDSNMISGQLPASLLSSTGLGIVNLSRNAIEGNI 232

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
           PD FG KSYFM LDLS+N L G +P SL+ A F+G
Sbjct: 233 PDAFGPKSYFMALDLSYNNLKGPIPGSLSSAAFVG 267

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 55/154 (35%), Positives = 86/154 (55%), Gaps = 3/154 (1%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G +     KL +LS  +L+    + G IP  V  ++ L  LDL  N+I+G IP  +G ++
Sbjct: 37  GSINPSICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQ 96

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L+ L L  N +TG+IP++L +   M  L+LS N   G +P  FG+        LS N+L
Sbjct: 97  RLTVLNLADNRLTGEIPASLTALANMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQL 156

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS 518
           +G +PNS++    +  LD+S N + G++P  IGS
Sbjct: 157 SGAIPNSISGMYRLADLDLSVNKISGSVPGWIGS 190

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 53/168 (31%), Positives = 85/168 (50%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSN-NQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           SI ++  L  L L++   + GE+P     L  L    L  NQ+ G IP ++  + RL  L
Sbjct: 42  SICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQRLTVL 101

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           +L+ NR+TG IP  L  +  +  L L  N +TGQ+P+   +   +    LS+N   G IP
Sbjct: 102 NLADNRLTGEIPASLTALANMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQLSGAIP 161

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +          LDLS NK++G VP  +   + +  L++ +N + G +P
Sbjct: 162 NSISGMYRLADLDLSVNKISGSVPGWIGSMRVLSTLNLDSNMISGQLP 209

[31][TOP]
>UniRef100_B3VVI7 Leucine rich repeat protein (Fragment) n=1 Tax=Populus tremula
           RepID=B3VVI7_POPTN
          Length = 267

 Score =  197 bits (501), Expect = 5e-49
 Identities = 94/155 (60%), Positives = 124/155 (80%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ + HLDLS+N++ G+LP+DFG L+ LSRALLS+NQL G IP+S+  M RLAD
Sbjct: 113 PASLTALANMKHLDLSSNKLTGQLPADFGSLKMLSRALLSKNQLSGAIPNSISGMYRLAD 172

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS+N+I+GS+P  +G MRVLSTL LD N ++GQ+P++LLS+TG+GI+NLSRN  EG I
Sbjct: 173 LDLSVNKISGSVPGWIGSMRVLSTLNLDSNMISGQLPASLLSSTGLGIVNLSRNAIEGNI 232

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
           PD FG KSYFM LDLS+N L G +P SL+ A F+G
Sbjct: 233 PDAFGPKSYFMALDLSYNNLKGPIPGSLSSAAFVG 267

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 56/154 (36%), Positives = 86/154 (55%), Gaps = 3/154 (1%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G +     KL +LS  +L+    + G IP  V  ++ L  LDL  N+I+G IP  +G ++
Sbjct: 37  GSINPSICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQ 96

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L+ L L  N +TG+IP++L +   M  L+LS N   G +P  FGS        LS N+L
Sbjct: 97  RLTVLNLADNRLTGEIPASLTALANMKHLDLSSNKLTGQLPADFGSLKMLSRALLSKNQL 156

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS 518
           +G +PNS++    +  LD+S N + G++P  IGS
Sbjct: 157 SGAIPNSISGMYRLADLDLSVNKISGSVPGWIGS 190

 Score = 87.0 bits (214), Expect = 9e-16
 Identities = 54/168 (32%), Positives = 85/168 (50%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSN-NQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           SI ++  L  L L++   + GE+P     L  L    L  NQ+ G IP ++  + RL  L
Sbjct: 42  SICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQRLTVL 101

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           +L+ NR+TG IP  L  +  +  L L  N +TGQ+P+   S   +    LS+N   G IP
Sbjct: 102 NLADNRLTGEIPASLTALANMKHLDLSSNKLTGQLPADFGSLKMLSRALLSKNQLSGAIP 161

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +          LDLS NK++G VP  +   + +  L++ +N + G +P
Sbjct: 162 NSISGMYRLADLDLSVNKISGSVPGWIGSMRVLSTLNLDSNMISGQLP 209

[32][TOP]
>UniRef100_B3VVI4 Leucine rich repeat protein (Fragment) n=1 Tax=Populus tremula
           RepID=B3VVI4_POPTN
          Length = 267

 Score =  197 bits (501), Expect = 5e-49
 Identities = 94/155 (60%), Positives = 124/155 (80%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ + HLDLS+N++ G+LP+DFG L+ LSRALLS+NQL G IP+S+  M RLAD
Sbjct: 113 PASLTALANMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQLSGAIPNSISGMYRLAD 172

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS+N+I+GS+P  +G MRVLSTL LD N ++GQ+P++LLS+TG+GI+NLSRN  EG I
Sbjct: 173 LDLSVNKISGSVPGWIGSMRVLSTLNLDSNMISGQLPASLLSSTGLGIVNLSRNAIEGNI 232

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
           PD FG KSYFM LDLS+N L G +P SL+ A F+G
Sbjct: 233 PDAFGPKSYFMALDLSYNNLKGPIPGSLSSAAFVG 267

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 55/154 (35%), Positives = 86/154 (55%), Gaps = 3/154 (1%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G +     KL +LS  +L+    + G IP  V  ++ L  LDL  N+I+G IP  +G ++
Sbjct: 37  GSINPSICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQ 96

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L+ L L  N +TG+IP++L +   M  L+LS N   G +P  FG+        LS N+L
Sbjct: 97  RLTVLNLADNRLTGEIPASLTALANMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQL 156

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS 518
           +G +PNS++    +  LD+S N + G++P  IGS
Sbjct: 157 SGAIPNSISGMYRLADLDLSVNKISGSVPGWIGS 190

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 53/168 (31%), Positives = 85/168 (50%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSN-NQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           SI ++  L  L L++   + GE+P     L  L    L  NQ+ G IP ++  + RL  L
Sbjct: 42  SICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQRLTVL 101

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           +L+ NR+TG IP  L  +  +  L L  N +TGQ+P+   +   +    LS+N   G IP
Sbjct: 102 NLADNRLTGEIPASLTALANMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQLSGAIP 161

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +          LDLS NK++G VP  +   + +  L++ +N + G +P
Sbjct: 162 NSISGMYRLADLDLSVNKISGSVPGWIGSMRVLSTLNLDSNMISGQLP 209

[33][TOP]
>UniRef100_B3VVI5 Leucine rich repeat protein (Fragment) n=1 Tax=Populus tremula
           RepID=B3VVI5_POPTN
          Length = 267

 Score =  197 bits (500), Expect = 6e-49
 Identities = 94/155 (60%), Positives = 123/155 (79%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +  + HLDLS+N++ G+LP+DFG L+ LSRALLS+NQL G IP+S+  M RLAD
Sbjct: 113 PASLTALGNMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQLSGAIPNSISGMYRLAD 172

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS+N+I+GS+P  +G MRVLSTL LD N ++GQ+P++LLS+TG+GI+NLSRN  EG I
Sbjct: 173 LDLSVNKISGSVPGWIGSMRVLSTLNLDSNMISGQLPASLLSSTGLGIVNLSRNAIEGNI 232

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
           PD FG KSYFM LDLS+N L G +P SL+ A F+G
Sbjct: 233 PDAFGPKSYFMALDLSYNNLKGPIPGSLSSAAFVG 267

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 55/154 (35%), Positives = 86/154 (55%), Gaps = 3/154 (1%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G +     KL +LS  +L+    + G IP  V  ++ L  LDL  N+I+G IP  +G ++
Sbjct: 37  GSINPSICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQ 96

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L+ L L  N +TG+IP++L +   M  L+LS N   G +P  FG+        LS N+L
Sbjct: 97  RLTVLNLADNRLTGEIPASLTALGNMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQL 156

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS 518
           +G +PNS++    +  LD+S N + G++P  IGS
Sbjct: 157 SGAIPNSISGMYRLADLDLSVNKISGSVPGWIGS 190

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 53/168 (31%), Positives = 85/168 (50%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSN-NQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           SI ++  L  L L++   + GE+P     L  L    L  NQ+ G IP ++  + RL  L
Sbjct: 42  SICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQRLTVL 101

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           +L+ NR+TG IP  L  +  +  L L  N +TGQ+P+   +   +    LS+N   G IP
Sbjct: 102 NLADNRLTGEIPASLTALGNMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQLSGAIP 161

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +          LDLS NK++G VP  +   + +  L++ +N + G +P
Sbjct: 162 NSISGMYRLADLDLSVNKISGSVPGWIGSMRVLSTLNLDSNMISGQLP 209

[34][TOP]
>UniRef100_B3VVI2 Leucine rich repeat protein (Fragment) n=1 Tax=Populus tremula
           RepID=B3VVI2_POPTN
          Length = 267

 Score =  196 bits (497), Expect = 1e-48
 Identities = 93/155 (60%), Positives = 123/155 (79%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +  + HLDLS+N++ G+LP+DFG L+ LSRALLS+NQL G IP+S+  M RLAD
Sbjct: 113 PASLTALGNMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQLSGAIPNSISGMYRLAD 172

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS+N+I+GS+P  +G MRVLSTL LD N ++GQ+P++LLS+TG+GI+NLSRN  EG I
Sbjct: 173 LDLSVNKISGSVPGWIGSMRVLSTLNLDSNMISGQLPASLLSSTGLGIVNLSRNAIEGNI 232

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
           PD FG KSYFM LDLS+N L G +P SL+ A ++G
Sbjct: 233 PDAFGPKSYFMALDLSYNNLKGPIPGSLSSAAYVG 267

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 55/154 (35%), Positives = 86/154 (55%), Gaps = 3/154 (1%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           G +     KL +LS  +L+    + G IP  V  ++ L  LDL  N+I+G IP  +G ++
Sbjct: 37  GSINPSICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQ 96

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L+ L L  N +TG+IP++L +   M  L+LS N   G +P  FG+        LS N+L
Sbjct: 97  RLTVLNLADNRLTGEIPASLTALGNMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQL 156

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS 518
           +G +PNS++    +  LD+S N + G++P  IGS
Sbjct: 157 SGAIPNSISGMYRLADLDLSVNKISGSVPGWIGS 190

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 53/168 (31%), Positives = 85/168 (50%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSN-NQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           SI ++  L  L L++   + GE+P     L  L    L  NQ+ G IP ++  + RL  L
Sbjct: 42  SICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQRLTVL 101

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           +L+ NR+TG IP  L  +  +  L L  N +TGQ+P+   +   +    LS+N   G IP
Sbjct: 102 NLADNRLTGEIPASLTALGNMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKNQLSGAIP 161

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +          LDLS NK++G VP  +   + +  L++ +N + G +P
Sbjct: 162 NSISGMYRLADLDLSVNKISGSVPGWIGSMRVLSTLNLDSNMISGQLP 209

[35][TOP]
>UniRef100_B4YYC5 ST27-4 (Fragment) n=1 Tax=Thellungiella halophila
           RepID=B4YYC5_THEHA
          Length = 141

 Score =  182 bits (463), Expect = 1e-44
 Identities = 85/131 (64%), Positives = 106/131 (80%)
 Frame = +3

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           DLS N I G IP  +G M+VLS L LD NS++G IP +LLSN+G G++NLSRN  EG+IP
Sbjct: 6   DLSNNHIEGPIPDWVGNMKVLSLLNLDCNSLSGPIPGSLLSNSGFGVMNLSRNALEGSIP 65

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAAS 545
           DVFG  +YF+ LDLS N L+GR+P+SL  AKF+GHLDIS+N LCG IP+GSPFDHL+A+S
Sbjct: 66  DVFGXTTYFVALDLSHNSLSGRIPDSLTSAKFVGHLDISHNKLCGPIPMGSPFDHLEASS 125

Query: 546 FSNNDCLCGNP 578
           FS+N+CLCG P
Sbjct: 126 FSDNECLCGGP 136

[36][TOP]
>UniRef100_A2WU16 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2WU16_ORYSI
          Length = 994

 Score =  139 bits (351), Expect = 1e-31
 Identities = 74/192 (38%), Positives = 112/192 (58%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ I  ++ L+ L L+NNQ++G +PS  G L +L   +LS+N L  TIP S+  + +L +
Sbjct: 420 PVEISGLTSLVKLHLANNQLVGPIPSTIGSLNQLQVVVLSQNSLSSTIPISLWHLQKLIE 479

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N ++GS+P  +GK+  ++ + L  N ++G IP +      M  +NLS N  +G+I
Sbjct: 480 LDLSQNSLSGSLPADVGKLTAITKMDLSRNQLSGDIPFSFGELQMMIYMNLSSNLLQGSI 539

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PD  G       LDLS N L+G +P SLA   ++ +L++S N L G IP G  F ++   
Sbjct: 540 PDSVGKLLSIEELDLSSNVLSGVIPKSLANLTYLANLNLSFNRLEGQIPEGGVFSNITVK 599

Query: 543 SFSNNDCLCGNP 578
           S   N  LCG P
Sbjct: 600 SLMGNKALCGLP 611

 Score =  116 bits (291), Expect = 1e-24
 Identities = 65/189 (34%), Positives = 111/189 (58%), Gaps = 4/189 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ +   +GL+ LDLS N++ GE+P +FG+LR L     + NQ+ GTIP+S+  ++ L  
Sbjct: 225 PVELSNHTGLLALDLSENKLEGEIPPEFGQLRNLRYISFANNQITGTIPESIGNLSDLTT 284

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIP--STLLSNTGMGILNLSRNGFEG 356
           +DL  N +TGS+P+  G +R L  + +DGN ++G +   + L + + +  + +S N FEG
Sbjct: 285 IDLFGNGLTGSVPMSFGNLRNLRRIFVDGNQLSGNLEFLAALSNCSNLNTIGMSYNAFEG 344

Query: 357 TIPDVFGSKSYFM-VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDH 530
           ++    G+ S  M +     N++TG +P++LAK   +  L +S N L G IP   +  ++
Sbjct: 345 SLLPYVGNLSTLMEIFVADNNRITGSIPSTLAKLTNLLMLSLSGNQLSGMIPTQITSMNN 404

Query: 531 LDAASFSNN 557
           L   + SNN
Sbjct: 405 LQELNLSNN 413

 Score =  107 bits (267), Expect = 7e-22
 Identities = 63/164 (38%), Positives = 91/164 (55%), Gaps = 1/164 (0%)
 Frame = +3

Query: 21  ISGLMHLDLS-NNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           +S LM + ++ NN+I G +PS   KL  L    LS NQL G IP  +  MN L +L+LS 
Sbjct: 353 LSTLMEIFVADNNRITGSIPSTLAKLTNLLMLSLSGNQLSGMIPTQITSMNNLQELNLSN 412

Query: 198 NRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
           N ++G+IPV +  +  L  L L  N + G IPST+ S   + ++ LS+N    TIP    
Sbjct: 413 NTLSGTIPVEISGLTSLVKLHLANNQLVGPIPSTIGSLNQLQVVVLSQNSLSSTIPISLW 472

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                + LDLS N L+G +P  + K   +  +D+S N L G+IP
Sbjct: 473 HLQKLIELDLSQNSLSGSLPADVGKLTAITKMDLSRNQLSGDIP 516

 Score =  104 bits (259), Expect = 6e-21
 Identities = 66/197 (33%), Positives = 98/197 (49%), Gaps = 16/197 (8%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  +S L  L LSN  +IG LP++ G+L +L   +LS N L GTIP  +  + RL  L L
Sbjct: 94  IGNLSFLSSLVLSNTSLIGPLPTELGRLPRLQTLVLSYNSLSGTIPSILGNLTRLESLYL 153

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT--------------GMGIL 329
           + N++ G IP  L  +  L  L+L  N+++G IP  L +NT               +  +
Sbjct: 154 NSNKVFGGIPQELANLNNLQILRLSDNNLSGPIPQGLFNNTPNLSSVPSWLATMPNLTAI 213

Query: 330 NLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            LS N   G IP    + +  + LDLS NKL G +P    + + + ++  +NN + G IP
Sbjct: 214 YLSTNELTGKIPVELSNHTGLLALDLSENKLEGEIPPEFGQLRNLRYISFANNQITGTIP 273

Query: 510 --IGSPFDHLDAASFSN 554
             IG+  D      F N
Sbjct: 274 ESIGNLSDLTTIDLFGN 290

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 59/184 (32%), Positives = 92/184 (50%), Gaps = 14/184 (7%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + R+  L  L LS N + G +PS  G L +L    L+ N++ G IP  +  +N L  
Sbjct: 115 PTELGRLPRLQTLVLSYNSLSGTIPSILGNLTRLESLYLNSNKVFGGIPQELANLNNLQI 174

Query: 183 LDLSMNRITG--------------SIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGM 320
           L LS N ++G              S+P  L  M  L+ + L  N +TG+IP  L ++TG+
Sbjct: 175 LRLSDNNLSGPIPQGLFNNTPNLSSVPSWLATMPNLTAIYLSTNELTGKIPVELSNHTGL 234

Query: 321 GILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCG 500
             L+LS N  EG IP  FG       +  + N++TG +P S+     +  +D+  N L G
Sbjct: 235 LALDLSENKLEGEIPPEFGQLRNLRYISFANNQITGTIPESIGNLSDLTTIDLFGNGLTG 294

Query: 501 NIPI 512
           ++P+
Sbjct: 295 SVPM 298

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 62/197 (31%), Positives = 90/197 (45%), Gaps = 27/197 (13%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIP--DSVLKMNRL 176
           P SI  +S L  +DL  N + G +P  FG LR L R  +  NQL G +    ++   + L
Sbjct: 273 PESIGNLSDLTTIDLFGNGLTGSVPMSFGNLRNLRRIFVDGNQLSGNLEFLAALSNCSNL 332

Query: 177 ADLDLSMN-------------------------RITGSIPVRLGKMRVLSTLKLDGNSMT 281
             + +S N                         RITGSIP  L K+  L  L L GN ++
Sbjct: 333 NTIGMSYNAFEGSLLPYVGNLSTLMEIFVADNNRITGSIPSTLAKLTNLLMLSLSGNQLS 392

Query: 282 GQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF 461
           G IP+ + S   +  LNLS N   GTIP      +  + L L+ N+L G +P+++     
Sbjct: 393 GMIPTQITSMNNLQELNLSNNTLSGTIPVEISGLTSLVKLHLANNQLVGPIPSTIGSLNQ 452

Query: 462 MGHLDISNNHLCGNIPI 512
           +  + +S N L   IPI
Sbjct: 453 LQVVVLSQNSLSSTIPI 469

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 54/182 (29%), Positives = 80/182 (43%), Gaps = 14/182 (7%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLK------ 164
           P  +  ++ L  L L++N++ G +P +   L  L    LS N L G IP  +        
Sbjct: 139 PSILGNLTRLESLYLNSNKVFGGIPQELANLNNLQILRLSDNNLSGPIPQGLFNNTPNLS 198

Query: 165 --------MNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGM 320
                   M  L  + LS N +TG IPV L     L  L L  N + G+IP        +
Sbjct: 199 SVPSWLATMPNLTAIYLSTNELTGKIPVELSNHTGLLALDLSENKLEGEIPPEFGQLRNL 258

Query: 321 GILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCG 500
             ++ + N   GTIP+  G+ S    +DL  N LTG VP S    + +  + +  N L G
Sbjct: 259 RYISFANNQITGTIPESIGNLSDLTTIDLFGNGLTGSVPMSFGNLRNLRRIFVDGNQLSG 318

Query: 501 NI 506
           N+
Sbjct: 319 NL 320

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 59/188 (31%), Positives = 89/188 (47%), Gaps = 15/188 (7%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+  +  + G +    G L  LS  +LS   LIG +P  + ++ RL  L LS N ++G+I
Sbjct: 79  LEFEDMALEGTISPQIGNLSFLSSLVLSNTSLIGPLPTELGRLPRLQTLVLSYNSLSGTI 138

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEG-------------- 356
           P  LG +  L +L L+ N + G IP  L +   + IL LS N   G              
Sbjct: 139 PSILGNLTRLESLYLNSNKVFGGIPQELANLNNLQILRLSDNNLSGPIPQGLFNNTPNLS 198

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHL 533
           ++P    +      + LS N+LTG++P  L+    +  LD+S N L G IP       +L
Sbjct: 199 SVPSWLATMPNLTAIYLSTNELTGKIPVELSNHTGLLALDLSENKLEGEIPPEFGQLRNL 258

Query: 534 DAASFSNN 557
              SF+NN
Sbjct: 259 RYISFANN 266

[37][TOP]
>UniRef100_Q0JK64 Os01g0694100 protein (Fragment) n=2 Tax=Oryza sativa Japonica Group
           RepID=Q0JK64_ORYSJ
          Length = 717

 Score =  139 bits (349), Expect = 2e-31
 Identities = 73/192 (38%), Positives = 112/192 (58%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ I  ++ L+ L+L+NNQ++  +PS  G L +L   +LS+N L  TIP S+  + +L +
Sbjct: 143 PVEITGLTSLVKLNLANNQLVSPIPSTIGSLNQLQVVVLSQNSLSSTIPISLWHLQKLIE 202

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N ++GS+P  +GK+  ++ + L  N ++G IP +      M  +NLS N  +G+I
Sbjct: 203 LDLSQNSLSGSLPADVGKLTAITKMDLSRNQLSGDIPFSFGELQMMIYMNLSSNLLQGSI 262

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PD  G       LDLS N L+G +P SLA   ++ +L++S N L G IP G  F ++   
Sbjct: 263 PDSVGKLLSIEELDLSSNVLSGVIPKSLANLTYLANLNLSFNRLEGQIPEGGVFSNITVK 322

Query: 543 SFSNNDCLCGNP 578
           S   N  LCG P
Sbjct: 323 SLMGNKALCGLP 334

 Score =  102 bits (253), Expect = 3e-20
 Identities = 58/153 (37%), Positives = 82/153 (53%)
 Frame = +3

Query: 51  NNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRL 230
           NN+I G +PS   KL  L    L  NQL G IP  +  MN L +L+LS N ++G+IPV +
Sbjct: 87  NNRITGSIPSTLAKLTNLLMLSLRGNQLSGMIPTQITSMNNLQELNLSNNTLSGTIPVEI 146

Query: 231 GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLS 410
             +  L  L L  N +   IPST+ S   + ++ LS+N    TIP         + LDLS
Sbjct: 147 TGLTSLVKLNLANNQLVSPIPSTIGSLNQLQVVVLSQNSLSSTIPISLWHLQKLIELDLS 206

Query: 411 FNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            N L+G +P  + K   +  +D+S N L G+IP
Sbjct: 207 QNSLSGSLPADVGKLTAITKMDLSRNQLSGDIP 239

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 60/184 (32%), Positives = 89/184 (48%), Gaps = 5/184 (2%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIP--DSVLKMNRLADLDLS 194
           IS L  +DL  N + G +P  FG L  L    +  NQL G +    ++   + L  + +S
Sbjct: 2   ISDLTTIDLFVNGLTGSVPMSFGNLWNLRDIYVDGNQLSGNLEFLAALSNCSNLNTIGMS 61

Query: 195 MNRITGSIPVRLGKMRVLSTLKL-DGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
            NR  GS+   +G +  L  + + D N +TG IPSTL   T + +L+L  N   G IP  
Sbjct: 62  YNRFEGSLLPCVGNLSTLIEIFVADNNRITGSIPSTLAKLTNLLMLSLRGNQLSGMIPTQ 121

Query: 372 FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAAS 545
             S +    L+LS N L+G +P  +     +  L+++NN L   IP  IGS  + L    
Sbjct: 122 ITSMNNLQELNLSNNTLSGTIPVEITGLTSLVKLNLANNQLVSPIPSTIGS-LNQLQVVV 180

Query: 546 FSNN 557
            S N
Sbjct: 181 LSQN 184

 Score = 77.8 bits (190), Expect = 6e-13
 Identities = 53/173 (30%), Positives = 87/173 (50%), Gaps = 3/173 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELP--SDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRL 176
           PMS   +  L  + +  NQ+ G L   +       L+   +S N+  G++   V  ++ L
Sbjct: 20  PMSFGNLWNLRDIYVDGNQLSGNLEFLAALSNCSNLNTIGMSYNRFEGSLLPCVGNLSTL 79

Query: 177 ADLDLS-MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
            ++ ++  NRITGSIP  L K+  L  L L GN ++G IP+ + S   +  LNLS N   
Sbjct: 80  IEIFVADNNRITGSIPSTLAKLTNLLMLSLRGNQLSGMIPTQITSMNNLQELNLSNNTLS 139

Query: 354 GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           GTIP      +  + L+L+ N+L   +P+++     +  + +S N L   IPI
Sbjct: 140 GTIPVEITGLTSLVKLNLANNQLVSPIPSTIGSLNQLQVVVLSQNSLSSTIPI 192

[38][TOP]
>UniRef100_B9EYY3 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=B9EYY3_ORYSJ
          Length = 1027

 Score =  139 bits (349), Expect = 2e-31
 Identities = 73/192 (38%), Positives = 112/192 (58%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P+ I  ++ L+ L+L+NNQ++  +PS  G L +L   +LS+N L  TIP S+  + +L +
Sbjct: 453  PVEITGLTSLVKLNLANNQLVSPIPSTIGSLNQLQVVVLSQNSLSSTIPISLWHLQKLIE 512

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N ++GS+P  +GK+  ++ + L  N ++G IP +      M  +NLS N  +G+I
Sbjct: 513  LDLSQNSLSGSLPADVGKLTAITKMDLSRNQLSGDIPFSFGELQMMIYMNLSSNLLQGSI 572

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            PD  G       LDLS N L+G +P SLA   ++ +L++S N L G IP G  F ++   
Sbjct: 573  PDSVGKLLSIEELDLSSNVLSGVIPKSLANLTYLANLNLSFNRLEGQIPEGGVFSNITVK 632

Query: 543  SFSNNDCLCGNP 578
            S   N  LCG P
Sbjct: 633  SLMGNKALCGLP 644

 Score =  102 bits (253), Expect = 3e-20
 Identities = 58/153 (37%), Positives = 82/153 (53%)
 Frame = +3

Query: 51  NNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRL 230
           NN+I G +PS   KL  L    L  NQL G IP  +  MN L +L+LS N ++G+IPV +
Sbjct: 397 NNRITGSIPSTLAKLTNLLMLSLRGNQLSGMIPTQITSMNNLQELNLSNNTLSGTIPVEI 456

Query: 231 GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLS 410
             +  L  L L  N +   IPST+ S   + ++ LS+N    TIP         + LDLS
Sbjct: 457 TGLTSLVKLNLANNQLVSPIPSTIGSLNQLQVVVLSQNSLSSTIPISLWHLQKLIELDLS 516

Query: 411 FNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            N L+G +P  + K   +  +D+S N L G+IP
Sbjct: 517 QNSLSGSLPADVGKLTAITKMDLSRNQLSGDIP 549

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 61/174 (35%), Positives = 97/174 (55%), Gaps = 4/174 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRAL---LSRNQLIGTIPDSVLKMNR 173
           P+ +   +GL+ LDLS N + GE+P +FG+LR LS      +S N+  G++   V  ++ 
Sbjct: 329 PVELSNHTGLLALDLSENNLEGEIPPEFGQLRNLSNLNTIGMSYNRFEGSLLPCVGNLST 388

Query: 174 LADLDLS-MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           L ++ ++  NRITGSIP  L K+  L  L L GN ++G IP+ + S   +  LNLS N  
Sbjct: 389 LIEIFVADNNRITGSIPSTLAKLTNLLMLSLRGNQLSGMIPTQITSMNNLQELNLSNNTL 448

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
            GTIP      +  + L+L+ N+L   +P+++     +  + +S N L   IPI
Sbjct: 449 SGTIPVEITGLTSLVKLNLANNQLVSPIPSTIGSLNQLQVVVLSQNSLSSTIPI 502

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 62/180 (34%), Positives = 93/180 (51%), Gaps = 1/180 (0%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  +S L  L LSN  +IG +P++  +L +L   +LS N L GTIP  +  + RL  L L
Sbjct: 90  IGNLSFLSSLVLSNTTLIGPVPTELDRLPRLQTLVLSYNSLSGTIPSILGNLTRLESLYL 149

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT-GMGILNLSRNGFEGTIPD 368
           + N+  G IP  L  +  L  L+L  N ++G IP  L +NT  +  + L  N   G IP 
Sbjct: 150 NSNKFFGGIPQELANLNNLQILRLSDNDLSGPIPQGLFNNTPNLSRIQLGSNRLTGAIPG 209

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASF 548
             GS S   +L L  N L+G +P ++    ++  + ++ N+L G IP G+   HL    F
Sbjct: 210 SVGSLSKLEMLVLENNLLSGSMPAAIFNMSYLQAIAVTRNNLRGPIP-GNESFHLPMLEF 268

 Score = 86.3 bits (212), Expect = 2e-15
 Identities = 53/158 (33%), Positives = 80/158 (50%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+  +  + G +    G L  LS  +LS   LIG +P  + ++ RL  L LS N ++G+I
Sbjct: 75  LEFEDMALEGTISPQIGNLSFLSSLVLSNTTLIGPVPTELDRLPRLQTLVLSYNSLSGTI 134

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD-VFGSKSYFM 395
           P  LG +  L +L L+ N   G IP  L +   + IL LS N   G IP  +F +     
Sbjct: 135 PSILGNLTRLESLYLNSNKFFGGIPQELANLNNLQILRLSDNDLSGPIPQGLFNNTPNLS 194

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            + L  N+LTG +P S+     +  L + NN L G++P
Sbjct: 195 RIQLGSNRLTGAIPGSVGSLSKLEMLVLENNLLSGSMP 232

 Score = 80.9 bits (198), Expect = 7e-14
 Identities = 63/215 (29%), Positives = 97/215 (45%), Gaps = 30/215 (13%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  +S L  + ++ N + G +P +    L  L    L  N   G IP    K   L 
Sbjct: 232 PAAIFNMSYLQAIAVTRNNLRGPIPGNESFHLPMLEFFSLGENWFDGPIPSGPSKCQNLD 291

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
              L++N  TGS+P  L  M  L+ + L  N +TG+IP  L ++TG+  L+LS N  EG 
Sbjct: 292 LFSLAVNNFTGSVPSWLATMPNLTAIYLSTNELTGKIPVELSNHTGLLALDLSENNLEGE 351

Query: 360 IPDVFG---SKSYFMVLDLSF-------------------------NKLTGRVPNSLAKA 455
           IP  FG   + S    + +S+                         N++TG +P++LAK 
Sbjct: 352 IPPEFGQLRNLSNLNTIGMSYNRFEGSLLPCVGNLSTLIEIFVADNNRITGSIPSTLAKL 411

Query: 456 KFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
             +  L +  N L G IP   +  ++L   + SNN
Sbjct: 412 TNLLMLSLRGNQLSGMIPTQITSMNNLQELNLSNN 446

[39][TOP]
>UniRef100_Q53PD4 Leucine Rich Repeat family protein, expressed n=1 Tax=Oryza sativa
            Japonica Group RepID=Q53PD4_ORYSJ
          Length = 1024

 Score =  138 bits (348), Expect = 3e-31
 Identities = 69/190 (36%), Positives = 108/190 (56%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P S+  ++ L+HL L +N+  G+LP+ FG L  L R  +S N   GT+P+ + ++  +  
Sbjct: 432  PSSLFNLTNLVHLFLYSNKFSGQLPASFGNLEALERLGISNNNFDGTVPEDIFRIPTIQY 491

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            +DLS N + G +P  +G  + L  L L  N+++G+IP+TL ++  + I+    N F G I
Sbjct: 492  IDLSFNNLEGLLPFYVGNAKHLIYLVLSSNNLSGEIPNTLGNSESLQIIKFDHNIFTGGI 551

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P   G      +L+LS+N LTG +P+SL+  K++G LD S NHL G +P    F +  A 
Sbjct: 552  PTSLGKLLSLTLLNLSYNNLTGPIPDSLSNLKYLGQLDFSFNHLNGEVPTKGIFKNATAI 611

Query: 543  SFSNNDCLCG 572
                N  LCG
Sbjct: 612  QLGGNQGLCG 621

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 59/192 (30%), Positives = 93/192 (48%), Gaps = 25/192 (13%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           SI   + L    +S N++ G LP+ FG    +L    + +NQL G  P  +  ++ L  +
Sbjct: 337 SIANCTELQMFSISWNRLEGRLPNSFGNHSFQLQYVHMGQNQLSGQFPSGLTNLHNLVVI 396

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGM--------------- 320
           +LS NR +G +P  LG ++ L  L +  N+ TG IPS+L + T +               
Sbjct: 397 ELSGNRFSGVLPDWLGALKSLQKLTVGDNNFTGLIPSSLFNLTNLVHLFLYSNKFSGQLP 456

Query: 321 ---------GILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHL 473
                      L +S N F+GT+P+          +DLSFN L G +P  +  AK + +L
Sbjct: 457 ASFGNLEALERLGISNNNFDGTVPEDIFRIPTIQYIDLSFNNLEGLLPFYVGNAKHLIYL 516

Query: 474 DISNNHLCGNIP 509
            +S+N+L G IP
Sbjct: 517 VLSSNNLSGEIP 528

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 55/176 (31%), Positives = 89/176 (50%), Gaps = 7/176 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  I+ L +    N  I G +P +F KL  L    L  N+L G+ P++VL ++ L +
Sbjct: 184 PASLANITRLKYFACVNTSIEGNIPDEFSKLSALKFLHLGINKLTGSFPEAVLNISALTE 243

Query: 183 LDLSMNRITGSIPVRLGK-MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           L  ++N + G +P  LG  +  L   +L GN   G+IPS++ + + + ++++S N F G 
Sbjct: 244 LSFAINDLHGEVPPDLGNSLPNLQAFELGGNHFNGKIPSSITNASNLYLIDVSNNNFSGG 303

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGR------VPNSLAKAKFMGHLDISNNHLCGNIP 509
           +    G  +    L+L  NKL GR        NS+A    +    IS N L G +P
Sbjct: 304 LASSIGKLTKLSWLNLEENKLHGRNNEDQEFLNSIANCTELQMFSISWNRLEGRLP 359

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 57/185 (30%), Positives = 86/185 (46%), Gaps = 2/185 (1%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S+  ++ L HL+L+ N   G++P+    L +L    L+ N L G IP+ +   + L  LD
Sbjct: 93  SLGNLTFLKHLNLTGNAFTGQIPASLAHLHRLQTLSLASNTLQGRIPN-LANYSDLMVLD 151

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           L  N + G  P  L     L  L+L  N++ G IP++L + T +          EG IPD
Sbjct: 152 LYRNNLAGKFPADLPHS--LEKLRLSFNNIMGTIPASLANITRLKYFACVNTSIEGNIPD 209

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAA 542
            F   S    L L  NKLTG  P ++     +  L  + N L G +P  +G+   +L A 
Sbjct: 210 EFSKLSALKFLHLGINKLTGSFPEAVLNISALTELSFAINDLHGEVPPDLGNSLPNLQAF 269

Query: 543 SFSNN 557
               N
Sbjct: 270 ELGGN 274

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 41/114 (35%), Positives = 63/114 (55%)
 Frame = +3

Query: 168 NRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNG 347
           N +  L+L+   + G+I   LG +  L  L L GN+ TGQIP++L     +  L+L+ N 
Sbjct: 74  NHVVALNLTNRDLVGTISPSLGNLTFLKHLNLTGNAFTGQIPASLAHLHRLQTLSLASNT 133

Query: 348 FEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +G IP++  + S  MVLDL  N L G+ P  L  +  +  L +S N++ G IP
Sbjct: 134 LQGRIPNL-ANYSDLMVLDLYRNNLAGKFPADLPHS--LEKLRLSFNNIMGTIP 184

[40][TOP]
>UniRef100_UPI0001985E6A PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001985E6A
          Length = 1246

 Score =  137 bits (345), Expect = 6e-31
 Identities = 81/192 (42%), Positives = 112/192 (58%), Gaps = 4/192 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++ ++  L HLDLS NQ+ G +P   GK+  LS   LS NQL G+IPD+V KM  L+ 
Sbjct: 382 PDTVGKMVSLSHLDLSGNQLQGSIPDTVGKMVLLSHLDLSFNQLWGSIPDTVGKMVLLSH 441

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N++ GSIP  +GKM +LS L L GN + G IP+T+ +   +    LS N   G+I
Sbjct: 442 LDLSYNQLHGSIPDAVGKMVLLSHLDLSGNQLQGSIPNTVGNMVLLSHFGLSYNQLRGSI 501

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSP--FDH 530
           PD  G       LDLS N+L G VP+++ K   + HLD+S N L G++P  +G      H
Sbjct: 502 PDTVGKMVLLSRLDLSNNQLQGSVPDTVGKMVLLSHLDLSGNQLQGSVPDTVGKMVLLSH 561

Query: 531 LDAASFSNNDCL 566
           LD +      C+
Sbjct: 562 LDLSRNQLQGCI 573

 Score =  127 bits (320), Expect = 5e-28
 Identities = 74/169 (43%), Positives = 101/169 (59%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++ ++  L HLDLS NQ+ G +P   GK+  LS   LS NQL G+IPD+V KM  L+ 
Sbjct: 406 PDTVGKMVLLSHLDLSFNQLWGSIPDTVGKMVLLSHLDLSYNQLHGSIPDAVGKMVLLSH 465

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N++ GSIP  +G M +LS   L  N + G IP T+     +  L+LS N  +G++
Sbjct: 466 LDLSGNQLQGSIPNTVGNMVLLSHFGLSYNQLRGSIPDTVGKMVLLSRLDLSNNQLQGSV 525

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           PD  G       LDLS N+L G VP+++ K   + HLD+S N L G IP
Sbjct: 526 PDTVGKMVLLSHLDLSGNQLQGSVPDTVGKMVLLSHLDLSRNQLQGCIP 574

 Score =  127 bits (318), Expect = 8e-28
 Identities = 70/163 (42%), Positives = 100/163 (61%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L +LDLS NQ+ G +P   GK+  LS   LS NQL G+IPD+V KM  L+ LDLS N
Sbjct: 364 MSSLAYLDLSENQLRGSIPDTVGKMVSLSHLDLSGNQLQGSIPDTVGKMVLLSHLDLSFN 423

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           ++ GSIP  +GKM +LS L L  N + G IP  +     +  L+LS N  +G+IP+  G+
Sbjct: 424 QLWGSIPDTVGKMVLLSHLDLSYNQLHGSIPDAVGKMVLLSHLDLSGNQLQGSIPNTVGN 483

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                   LS+N+L G +P+++ K   +  LD+SNN L G++P
Sbjct: 484 MVLLSHFGLSYNQLRGSIPDTVGKMVLLSRLDLSNNQLQGSVP 526

 Score =  123 bits (309), Expect = 9e-27
 Identities = 75/188 (39%), Positives = 108/188 (57%), Gaps = 3/188 (1%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P ++ ++  L HLDLS NQ+ G +P+  G +  LS   LS NQL G+IPD+V KM  L+ 
Sbjct: 454  PDAVGKMVLLSHLDLSGNQLQGSIPNTVGNMVLLSHFGLSYNQLRGSIPDTVGKMVLLSR 513

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N++ GS+P  +GKM +LS L L GN + G +P T+     +  L+LSRN  +G I
Sbjct: 514  LDLSNNQLQGSVPDTVGKMVLLSHLDLSGNQLQGSVPDTVGKMVLLSHLDLSRNQLQGCI 573

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP---IGSPFDHL 533
            PD+ G+      L LS N L G +P S +    +  L++  N+L G I    +    D L
Sbjct: 574  PDIVGNMVSLEKLYLSQNHLQGEIPKSPSNLCNLQELELDRNNLSGQIALDFVACANDTL 633

Query: 534  DAASFSNN 557
            +  S S+N
Sbjct: 634  ETLSLSDN 641

 Score =  120 bits (301), Expect = 8e-26
 Identities = 70/161 (43%), Positives = 96/161 (59%), Gaps = 1/161 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPS-DFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L+HLDLS N + G +P   FG +  L    LS +QL G I +++  M+ LA LDLS N++
Sbjct: 318 LLHLDLSFNDLNGSIPEYAFGNMNSLEYLDLSGSQLDGEILNAIRDMSSLAYLDLSENQL 377

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
            GSIP  +GKM  LS L L GN + G IP T+     +  L+LS N   G+IPD  G   
Sbjct: 378 RGSIPDTVGKMVSLSHLDLSGNQLQGSIPDTVGKMVLLSHLDLSFNQLWGSIPDTVGKMV 437

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
               LDLS+N+L G +P+++ K   + HLD+S N L G+IP
Sbjct: 438 LLSHLDLSYNQLHGSIPDAVGKMVLLSHLDLSGNQLQGSIP 478

 Score =  116 bits (291), Expect = 1e-24
 Identities = 68/163 (41%), Positives = 96/163 (58%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           ++ L +LDLS +Q+ GE+ +    +  L+   LS NQL G+IPD+V KM  L+ LDLS N
Sbjct: 340 MNSLEYLDLSGSQLDGEILNAIRDMSSLAYLDLSENQLRGSIPDTVGKMVSLSHLDLSGN 399

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           ++ GSIP  +GKM +LS L L  N + G IP T+     +  L+LS N   G+IPD  G 
Sbjct: 400 QLQGSIPDTVGKMVLLSHLDLSFNQLWGSIPDTVGKMVLLSHLDLSYNQLHGSIPDAVGK 459

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                 LDLS N+L G +PN++     + H  +S N L G+IP
Sbjct: 460 MVLLSHLDLSGNQLQGSIPNTVGNMVLLSHFGLSYNQLRGSIP 502

 Score =  116 bits (290), Expect = 1e-24
 Identities = 68/169 (40%), Positives = 97/169 (57%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++ ++  L HLDLS NQ+ G +P   GK+  LS   LS NQL G+IP++V  M  L+ 
Sbjct: 430 PDTVGKMVLLSHLDLSYNQLHGSIPDAVGKMVLLSHLDLSGNQLQGSIPNTVGNMVLLSH 489

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
             LS N++ GSIP  +GKM +LS L L  N + G +P T+     +  L+LS N  +G++
Sbjct: 490 FGLSYNQLRGSIPDTVGKMVLLSRLDLSNNQLQGSVPDTVGKMVLLSHLDLSGNQLQGSV 549

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           PD  G       LDLS N+L G +P+ +     +  L +S NHL G IP
Sbjct: 550 PDTVGKMVLLSHLDLSRNQLQGCIPDIVGNMVSLEKLYLSQNHLQGEIP 598

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 55/164 (33%), Positives = 90/164 (54%), Gaps = 2/164 (1%)
 Frame = +3

Query: 24   SGLMHLDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLADLDLSMN 200
            S +  LDLSNN++ G +      +      L LS N L G +P+   +  RL  L+L  N
Sbjct: 821  SDVRWLDLSNNKLSGSISLLCAVVNPPLVLLDLSNNSLTGGLPNCWAQWERLVVLNLENN 880

Query: 201  RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD-VFG 377
            R +G IP   G +R + TL L  N++TG++P +  + T +  ++L +N   G IP+ + G
Sbjct: 881  RFSGQIPNSFGSLRSIRTLHLRNNNLTGELPLSFKNCTKLRFIDLGKNRLSGKIPEWIGG 940

Query: 378  SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            S    +VL+L  N+ +G +   L + K +  LD+SNN++ G +P
Sbjct: 941  SLPNLIVLNLGSNRFSGVICPELCQLKNIQILDLSNNNILGVVP 984

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 58/216 (26%), Positives = 97/216 (44%), Gaps = 30/216 (13%)
 Frame = +3

Query: 21   ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSV---LKMNRLADLDL 191
            +  L+ L+L +N+  G +  +  +L+ +    LS N ++G +P  V     M +   L +
Sbjct: 942  LPNLIVLNLGSNRFSGVICPELCQLKNIQILDLSNNNILGVVPRCVGGFTAMTKKGSLVI 1001

Query: 192  SMN---------RITGSIPVRLG------------------KMRVLSTLKLDGNSMTGQI 290
            + N         R  G +P+                      + ++ ++ L  N ++G+I
Sbjct: 1002 AYNYSFTQNGRCRDDGCMPINASYVDRAMVRWKEREFDFKSTLGLVKSIDLSSNKLSGEI 1061

Query: 291  PSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGH 470
            P  ++    +  LNLSRN     IP   G      VLDLS N+L G +P SL +   +  
Sbjct: 1062 PEEVIDLIELVSLNLSRNNLTRLIPTRIGQLKSLEVLDLSQNQLFGEIPASLVEISDLSV 1121

Query: 471  LDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCGNP 578
            LD+S+N+L G IP G+     +  S+  N  LCG P
Sbjct: 1122 LDLSDNNLSGKIPQGTQLQSFNIDSYKGNPALCGLP 1157

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 49/163 (30%), Positives = 86/163 (52%), Gaps = 2/163 (1%)
 Frame = +3

Query: 30   LMHLDLSNNQIIGELPSDFGKLRK-LSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
            L+ LD+SN++I   LP  F  +   +S   +S N++ GT+ +  L    L+++D+S N  
Sbjct: 753  LIELDISNSEISDVLPDWFWNVTSTISTLSISNNRIKGTLQNLPLNFGSLSNIDMSSNYF 812

Query: 207  TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGTIPDVFGSK 383
             G IP     +R L    L  N ++G I     + N  + +L+LS N   G +P+ +   
Sbjct: 813  EGLIPQLPSDVRWLD---LSNNKLSGSISLLCAVVNPPLVLLDLSNNSLTGGLPNCWAQW 869

Query: 384  SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               +VL+L  N+ +G++PNS    + +  L + NN+L G +P+
Sbjct: 870  ERLVVLNLENNRFSGQIPNSFGSLRSIRTLHLRNNNLTGELPL 912

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 54/185 (29%), Positives = 84/185 (45%), Gaps = 28/185 (15%)
 Frame = +3

Query: 39   LDLSNNQIIGELPS--DFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITG 212
            L LS+NQ  G +P+   F  LRKL    L  NQL GT+P+SV ++  L  LD++ N +  
Sbjct: 636  LSLSDNQFSGSVPALIGFSSLRKLH---LDFNQLNGTLPESVGQLANLQSLDIASNSLQD 692

Query: 213  SI-PVRLGKMRVLSTLKLDGNSMT------------------------GQIPSTLLSNTG 317
            +I    L  +  LS L L  NS+T                           PS L +   
Sbjct: 693  TINEAHLFNLSRLSYLDLSSNSLTFNMSFEWVPPFQLYSLRLASCKLGPHFPSWLRTQNL 752

Query: 318  MGILNLSRNGFEGTIPDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHL 494
            +  L++S +     +PD F +  S    L +S N++ G + N       + ++D+S+N+ 
Sbjct: 753  LIELDISNSEISDVLPDWFWNVTSTISTLSISNNRIKGTLQNLPLNFGSLSNIDMSSNYF 812

Query: 495  CGNIP 509
             G IP
Sbjct: 813  EGLIP 817

 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 28/73 (38%), Positives = 47/73 (64%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  ++ +  L+ L+LS N +   +P+  G+L+ L    LS+NQL G IP S+++++ L+ 
Sbjct: 1062 PEEVIDLIELVSLNLSRNNLTRLIPTRIGQLKSLEVLDLSQNQLFGEIPASLVEISDLSV 1121

Query: 183  LDLSMNRITGSIP 221
            LDLS N ++G IP
Sbjct: 1122 LDLSDNNLSGKIP 1134

[41][TOP]
>UniRef100_B9HDJ0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HDJ0_POPTR
          Length = 965

 Score =  135 bits (339), Expect = 3e-30
 Identities = 75/187 (40%), Positives = 109/187 (58%)
 Frame = +3

Query: 15  VRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLS 194
           V I GL  LDLS+N   GE+PSD G L  L    +SRNQL G+IP S+  +  +  LDLS
Sbjct: 382 VSIQGLQVLDLSSNVFSGEIPSDIGVLSSLLLLNVSRNQLFGSIPSSIGDLTMIRALDLS 441

Query: 195 MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVF 374
            NR+ GSIP  +G    L+ L+L+ N +TG+IP+ +   + +  L LS N   G IP   
Sbjct: 442 DNRLNGSIPSEIGGAISLTELRLEKNLLTGKIPTQIKKCSSLASLILSWNNLTGPIPVAV 501

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSN 554
            +      +DLSFN+L+G +P  L     +   +IS+N+L G++P+G  F+ +  +S S 
Sbjct: 502 ANLINLQYVDLSFNRLSGSLPKELTNLSHLLSFNISHNNLQGDLPLGGFFNTVSPSSVSG 561

Query: 555 NDCLCGN 575
           N  LCG+
Sbjct: 562 NPSLCGS 568

 Score =  107 bits (266), Expect = 9e-22
 Identities = 60/169 (35%), Positives = 92/169 (54%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  + GL  LDLS+N + GE+P     L  L    L  N+  G +P  +     L  
Sbjct: 182 PSGLWYLRGLQSLDLSDNLLEGEIPEGIANLYDLRVINLKNNRFTGQLPVDIGGSQVLKL 241

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LD S N ++GS+P  L ++   +T++L GNS TG++P  +   T +  L+LS N F G I
Sbjct: 242 LDFSENSLSGSLPESLRRLSSCATVRLGGNSFTGEVPGWIGELTDLESLDLSANRFSGRI 301

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+ +    L+LS N+LTG +P S+     +  +D+S+N L GN+P
Sbjct: 302 PVSIGNLNVLKELNLSMNQLTGGLPESMMNCLNLLAIDVSHNRLTGNLP 350

 Score =  101 bits (251), Expect = 5e-20
 Identities = 58/169 (34%), Positives = 87/169 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+     L  ++ S+N + GELPS    LR L    LS N L G IP+ +  +  L  
Sbjct: 158 PGSLSSCMTLSLVNFSSNGLCGELPSGLWYLRGLQSLDLSDNLLEGEIPEGIANLYDLRV 217

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           ++L  NR TG +PV +G  +VL  L    NS++G +P +L   +    + L  N F G +
Sbjct: 218 INLKNNRFTGQLPVDIGGSQVLKLLDFSENSLSGSLPESLRRLSSCATVRLGGNSFTGEV 277

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G  +    LDLS N+ +GR+P S+     +  L++S N L G +P
Sbjct: 278 PGWIGELTDLESLDLSANRFSGRIPVSIGNLNVLKELNLSMNQLTGGLP 326

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 62/197 (31%), Positives = 97/197 (49%), Gaps = 28/197 (14%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+ R+S    + L  N   GE+P   G+L  L    LS N+  G IP S+  +N L +
Sbjct: 254 PESLRRLSSCATVRLGGNSFTGEVPGWIGELTDLESLDLSANRFSGRIPVSIGNLNVLKE 313

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-------------------- 302
           L+LSMN++TG +P  +     L  + +  N +TG +PS +                    
Sbjct: 314 LNLSMNQLTGGLPESMMNCLNLLAIDVSHNRLTGNLPSWIFKSGLNRVSPSGNRFDESKQ 373

Query: 303 --------LSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAK 458
                   +S  G+ +L+LS N F G IP   G  S  ++L++S N+L G +P+S+    
Sbjct: 374 HPSGVSLAVSIQGLQVLDLSSNVFSGEIPSDIGVLSSLLLLNVSRNQLFGSIPSSIGDLT 433

Query: 459 FMGHLDISNNHLCGNIP 509
            +  LD+S+N L G+IP
Sbjct: 434 MIRALDLSDNRLNGSIP 450

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 54/167 (32%), Positives = 85/167 (50%), Gaps = 1/167 (0%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKM-NRLADLD 188
           ++R+  L  L L+NN+  G +  D  +L  L    LS N L G+IPD   +    L  + 
Sbjct: 88  LLRLQFLQVLSLANNKFNGTINPDLPRLGGLQVIDLSDNSLSGSIPDGFFQQCGSLRSVS 147

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
            + N +TG IP  L     LS +    N + G++PS L    G+  L+LS N  EG IP+
Sbjct: 148 FARNDLTGMIPGSLSSCMTLSLVNFSSNGLCGELPSGLWYLRGLQSLDLSDNLLEGEIPE 207

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              +     V++L  N+ TG++P  +  ++ +  LD S N L G++P
Sbjct: 208 GIANLYDLRVINLKNNRFTGQLPVDIGGSQVLKLLDFSENSLSGSLP 254

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 55/190 (28%), Positives = 83/190 (43%), Gaps = 25/190 (13%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDF----GKLRKLSRAL---------------------LS 122
           R+ GL  +DLS+N + G +P  F    G LR +S A                       S
Sbjct: 114 RLGGLQVIDLSDNSLSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSSCMTLSLVNFS 173

Query: 123 RNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL 302
            N L G +P  +  +  L  LDLS N + G IP  +  +  L  + L  N  TGQ+P  +
Sbjct: 174 SNGLCGELPSGLWYLRGLQSLDLSDNLLEGEIPEGIANLYDLRVINLKNNRFTGQLPVDI 233

Query: 303 LSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDIS 482
             +  + +L+ S N   G++P+     S    + L  N  TG VP  + +   +  LD+S
Sbjct: 234 GGSQVLKLLDFSENSLSGSLPESLRRLSSCATVRLGGNSFTGEVPGWIGELTDLESLDLS 293

Query: 483 NNHLCGNIPI 512
            N   G IP+
Sbjct: 294 ANRFSGRIPV 303

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 48/162 (29%), Positives = 78/162 (48%), Gaps = 4/162 (2%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L    + G +     +L+ L    L+ N+  GTI   + ++  L  +DLS N ++GSI
Sbjct: 73  LFLDGFSLSGHIGRGLLRLQFLQVLSLANNKFNGTINPDLPRLGGLQVIDLSDNSLSGSI 132

Query: 219 P----VRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           P     + G +R +S  +   N +TG IP +L S   + ++N S NG  G +P       
Sbjct: 133 PDGFFQQCGSLRSVSFAR---NDLTGMIPGSLSSCMTLSLVNFSSNGLCGELPSGLWYLR 189

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               LDLS N L G +P  +A    +  +++ NN   G +P+
Sbjct: 190 GLQSLDLSDNLLEGEIPEGIANLYDLRVINLKNNRFTGQLPV 231

[42][TOP]
>UniRef100_B9IGT6 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IGT6_POPTR
          Length = 965

 Score =  134 bits (337), Expect = 5e-30
 Identities = 73/185 (39%), Positives = 109/185 (58%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +  L  LDLS+N   GE+PSD G L  L    +SRNQL G+IP SV ++  +  LDLS N
Sbjct: 383 LESLQVLDLSSNVFSGEIPSDIGVLSSLQLFNVSRNQLFGSIPPSVGELTMIQALDLSDN 442

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           R+TGSIP  +G    L  L+L+ N +TG+IP+ +   + +  L +S N   G IP    +
Sbjct: 443 RLTGSIPSEIGGAVSLKELRLEMNFLTGKIPTQIKKCSSLTSLIISGNNLSGPIPVAIAN 502

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNND 560
            +    +DLSFN+ +G +P  LA    +   +IS+N+L G++P+G  F+ +  +S S N 
Sbjct: 503 LTNLQYVDLSFNRFSGSLPKELANLSHLLSFNISHNNLKGDLPLGGFFNTISPSSVSRNP 562

Query: 561 CLCGN 575
            LCG+
Sbjct: 563 SLCGS 567

 Score =  107 bits (268), Expect = 5e-22
 Identities = 64/185 (34%), Positives = 97/185 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  + GL  LDLS+N + GE+P     L  L    L RN+  G +P  +     L  
Sbjct: 181 PSGLWYLRGLQSLDLSDNLLEGEIPEGIANLYALRAINLRRNRFTGQLPVDIGGCQVLKL 240

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LD S N ++G +P  L ++   +T++L GNS TG++P  +   T +  L+LS N   G I
Sbjct: 241 LDFSENALSGGLPESLQRLSSCATVRLGGNSFTGEVPGWIGELTSLESLDLSVNRLSGRI 300

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P   G+ +    L+LS N+LTG +P S+A    +  +D+S+N L GN+P       L + 
Sbjct: 301 PVSIGNLNVLKELNLSMNQLTGGLPESMANCVNLLAIDVSHNRLTGNLPSWIFKTGLKSV 360

Query: 543 SFSNN 557
           S S N
Sbjct: 361 SLSGN 365

 Score =  102 bits (253), Expect = 3e-20
 Identities = 58/169 (34%), Positives = 88/169 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+     L  ++ S+N + GELPS    LR L    LS N L G IP+ +  +  L  
Sbjct: 157 PGSLSFCMSLSVVNFSSNGLSGELPSGLWYLRGLQSLDLSDNLLEGEIPEGIANLYALRA 216

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           ++L  NR TG +PV +G  +VL  L    N+++G +P +L   +    + L  N F G +
Sbjct: 217 INLRRNRFTGQLPVDIGGCQVLKLLDFSENALSGGLPESLQRLSSCATVRLGGNSFTGEV 276

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G  +    LDLS N+L+GR+P S+     +  L++S N L G +P
Sbjct: 277 PGWIGELTSLESLDLSVNRLSGRIPVSIGNLNVLKELNLSMNQLTGGLP 325

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 61/174 (35%), Positives = 92/174 (52%), Gaps = 5/174 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++ L  LDLS N++ G +P   G L  L    LS NQL G +P+S+     L  
Sbjct: 277 PGWIGELTSLESLDLSVNRLSGRIPVSIGNLNVLKELNLSMNQLTGGLPESMANCVNLLA 336

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIP-----STLLSNTGMGILNLSRNG 347
           +D+S NR+TG++P  + K   L ++ L GN +   I      S   S   + +L+LS N 
Sbjct: 337 IDVSHNRLTGNLPSWIFKTG-LKSVSLSGNKLDESIEHPSGVSLAASLESLQVLDLSSNV 395

Query: 348 FEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           F G IP   G  S   + ++S N+L G +P S+ +   +  LD+S+N L G+IP
Sbjct: 396 FSGEIPSDIGVLSSLQLFNVSRNQLFGSIPPSVGELTMIQALDLSDNRLTGSIP 449

 Score = 84.0 bits (206), Expect = 8e-15
 Identities = 53/167 (31%), Positives = 82/167 (49%), Gaps = 1/167 (0%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKM-NRLADLD 188
           ++R+  L  L L+NN   G +  D  +L  L    LS N L G+IPD   +    L  + 
Sbjct: 87  LLRLQFLQVLSLANNNFNGTINPDLPRLGGLQVIDLSENGLSGSIPDGFFQQCGSLRSVS 146

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
            + N +TG IP  L     LS +    N ++G++PS L    G+  L+LS N  EG IP+
Sbjct: 147 FARNDLTGMIPGSLSFCMSLSVVNFSSNGLSGELPSGLWYLRGLQSLDLSDNLLEGEIPE 206

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              +      ++L  N+ TG++P  +   + +  LD S N L G +P
Sbjct: 207 GIANLYALRAINLRRNRFTGQLPVDIGGCQVLKLLDFSENALSGGLP 253

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 56/190 (29%), Positives = 81/190 (42%), Gaps = 25/190 (13%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDF----GKLRKLSRAL---------------------LS 122
           R+ GL  +DLS N + G +P  F    G LR +S A                       S
Sbjct: 113 RLGGLQVIDLSENGLSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSFCMSLSVVNFS 172

Query: 123 RNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL 302
            N L G +P  +  +  L  LDLS N + G IP  +  +  L  + L  N  TGQ+P  +
Sbjct: 173 SNGLSGELPSGLWYLRGLQSLDLSDNLLEGEIPEGIANLYALRAINLRRNRFTGQLPVDI 232

Query: 303 LSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDIS 482
                + +L+ S N   G +P+     S    + L  N  TG VP  + +   +  LD+S
Sbjct: 233 GGCQVLKLLDFSENALSGGLPESLQRLSSCATVRLGGNSFTGEVPGWIGELTSLESLDLS 292

Query: 483 NNHLCGNIPI 512
            N L G IP+
Sbjct: 293 VNRLSGRIPV 302

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 46/162 (28%), Positives = 75/162 (46%), Gaps = 4/162 (2%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L    + G +     +L+ L    L+ N   GTI   + ++  L  +DLS N ++GSI
Sbjct: 72  LVLDGFSLSGHIGRGLLRLQFLQVLSLANNNFNGTINPDLPRLGGLQVIDLSENGLSGSI 131

Query: 219 P----VRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           P     + G +R +S  +   N +TG IP +L     + ++N S NG  G +P       
Sbjct: 132 PDGFFQQCGSLRSVSFAR---NDLTGMIPGSLSFCMSLSVVNFSSNGLSGELPSGLWYLR 188

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               LDLS N L G +P  +A    +  +++  N   G +P+
Sbjct: 189 GLQSLDLSDNLLEGEIPEGIANLYALRAINLRRNRFTGQLPV 230

 Score = 58.5 bits (140), Expect = 4e-07
 Identities = 35/114 (30%), Positives = 57/114 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I     L  L L  N + G++P+   K   L+  ++S N L G IP ++  +  L  
Sbjct: 449 PSEIGGAVSLKELRLEMNFLTGKIPTQIKKCSSLTSLIISGNNLSGPIPVAIANLTNLQY 508

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRN 344
           +DLS NR +GS+P  L  +  L +  +  N++ G +P     NT +   ++SRN
Sbjct: 509 VDLSFNRFSGSLPKELANLSHLLSFNISHNNLKGDLPLGGFFNT-ISPSSVSRN 561

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 36/117 (30%), Positives = 60/117 (51%), Gaps = 1/117 (0%)
 Frame = +3

Query: 168 NRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNG 347
           +R+ +L L    ++G I   L +++ L  L L  N+  G I   L    G+ +++LS NG
Sbjct: 67  HRVTELVLDGFSLSGHIGRGLLRLQFLQVLSLANNNFNGTINPDLPRLGGLQVIDLSENG 126

Query: 348 FEGTIPDVFGSK-SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
             G+IPD F  +      +  + N LTG +P SL+    +  ++ S+N L G +P G
Sbjct: 127 LSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSFCMSLSVVNFSSNGLSGELPSG 183

[43][TOP]
>UniRef100_UPI000198449F PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
            RepID=UPI000198449F
          Length = 1519

 Score =  134 bits (336), Expect = 7e-30
 Identities = 74/192 (38%), Positives = 110/192 (57%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P ++ ++  L  L ++ N+I G +P+  G L  L    LS NQL G +P S+  +NRL  
Sbjct: 577  PTTLGQLKKLQRLYIAGNRIHGSVPNGIGHLANLVYLFLSSNQLSGLVPSSLWSLNRLLV 636

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            ++LS N +TG +PV +G M+ ++ L L  N  +G IPST+    G+  L+LS+N  +G I
Sbjct: 637  VNLSSNFLTGDLPVEVGSMKTITKLDLSQNQFSGHIPSTMGQLGGLVELSLSKNRLQGPI 696

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  FG+      LDLS+N L+G +P SL     + +L++S N L G IP   PF +    
Sbjct: 697  PREFGNLLSLESLDLSWNNLSGAIPRSLEALVSLKYLNVSFNKLEGEIPDKGPFANFTTE 756

Query: 543  SFSNNDCLCGNP 578
            SF +N  LCG P
Sbjct: 757  SFISNAGLCGAP 768

 Score =  104 bits (259), Expect = 6e-21
 Identities = 66/173 (38%), Positives = 91/173 (52%), Gaps = 2/173 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  IS L ++ L+ N + G LP D    L KL    LS NQL G IP S+ K  RL 
Sbjct: 189 PSAIFNISSLQYIGLTYNSLSGTLPMDMCYSLPKLRGLYLSGNQLSGKIPTSLGKCGRLE 248

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           ++ LS N   GSIP  +G + VL  L L  N++ G+IP TL + + +    L  N   G 
Sbjct: 249 EISLSFNEFMGSIPRGIGSLSVLEVLYLGSNNLEGEIPQTLFNLSSLRNFELGSNNLGGI 308

Query: 360 IP-DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           +P D+  S     V++LS N+L G +P SL+    +  L +S N   G IP G
Sbjct: 309 LPADMCYSLPRLQVINLSQNQLKGEIPPSLSNCGELQVLGLSINEFIGRIPSG 361

 Score =  102 bits (254), Expect = 2e-20
 Identities = 62/174 (35%), Positives = 95/174 (54%), Gaps = 3/174 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  IS L  + L++N + G LPS  G  L +L   L+  N L G IP S+  + +L 
Sbjct: 431 PEAIFNISNLQFIVLADNHLSGNLPSSIGTSLPQLEELLIGGNYLSGIIPASISNITKLT 490

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGI--LNLSRNGFE 353
            LDLS N +TG +P  LG +R L  L    N ++G +P++ L N  + +  +N S   F+
Sbjct: 491 RLDLSYNLLTGFVPKDLGNLRSLQHLGFGNNQLSGTLPNS-LGNLSLSLQSINASACQFK 549

Query: 354 GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           G IP   G+ +  + L L  N LTG +P +L + K +  L I+ N + G++P G
Sbjct: 550 GVIPAGIGNLTNLIELGLGDNDLTGMIPTTLGQLKKLQRLYIAGNRIHGSVPNG 603

 Score =  101 bits (251), Expect = 5e-20
 Identities = 62/188 (32%), Positives = 97/188 (51%), Gaps = 3/188 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P ++  +S L + +L +N + G LP+D    L +L    LS+NQL G IP S+     L 
Sbjct: 286 PQTLFNLSSLRNFELGSNNLGGILPADMCYSLPRLQVINLSQNQLKGEIPPSLSNCGELQ 345

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L LS+N   G IP  +G +  +  + L GN++ G IPS+  + + +  L L +N  +G 
Sbjct: 346 VLGLSINEFIGRIPSGIGNLSGIEKIYLGGNNLMGTIPSSFGNLSALKTLYLEKNKIQGN 405

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHL 533
           IP   G  S    L L+ N LTG VP ++     +  + +++NHL GN+P  IG+    L
Sbjct: 406 IPKELGHLSELQYLSLASNILTGSVPEAIFNISNLQFIVLADNHLSGNLPSSIGTSLPQL 465

Query: 534 DAASFSNN 557
           +      N
Sbjct: 466 EELLIGGN 473

 Score =  100 bits (249), Expect = 8e-20
 Identities = 56/166 (33%), Positives = 92/166 (55%), Gaps = 1/166 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L+ LDLSNN     +P++  K R+L +  L  N+L G+IP ++  +++L  L L  N
Sbjct: 99  LSFLVTLDLSNNSFHASIPNEIAKCRELRQLYLFNNRLTGSIPQAIGNLSKLEQLYLGGN 158

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFG 377
           ++TG IP  +  +  L  L    N++T  IPS + + + +  + L+ N   GT+P D+  
Sbjct: 159 QLTGEIPREISHLLSLKILSFRSNNLTASIPSAIFNISSLQYIGLTYNSLSGTLPMDMCY 218

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           S      L LS N+L+G++P SL K   +  + +S N   G+IP G
Sbjct: 219 SLPKLRGLYLSGNQLSGKIPTSLGKCGRLEEISLSFNEFMGSIPRG 264

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 60/171 (35%), Positives = 94/171 (54%), Gaps = 1/171 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMN-RLA 179
           P SI  I+ L  LDLS N + G +P D G LR L       NQL GT+P+S+  ++  L 
Sbjct: 480 PASISNITKLTRLDLSYNLLTGFVPKDLGNLRSLQHLGFGNNQLSGTLPNSLGNLSLSLQ 539

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            ++ S  +  G IP  +G +  L  L L  N +TG IP+TL     +  L ++ N   G+
Sbjct: 540 SINASACQFKGVIPAGIGNLTNLIELGLGDNDLTGMIPTTLGQLKKLQRLYIAGNRIHGS 599

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           +P+  G  +  + L LS N+L+G VP+SL     +  +++S+N L G++P+
Sbjct: 600 VPNGIGHLANLVYLFLSSNQLSGLVPSSLWSLNRLLVVNLSSNFLTGDLPV 650

 Score = 87.0 bits (214), Expect = 9e-16
 Identities = 60/183 (32%), Positives = 86/183 (46%), Gaps = 3/183 (1%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           LDLSN  + G +    G L  L    LS N    +IP+ + K   L  L L  NR+TGSI
Sbjct: 81  LDLSNMDLEGTIAPQVGNLSFLVTLDLSNNSFHASIPNEIAKCRELRQLYLFNNRLTGSI 140

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  +G +  L  L L GN +TG+IP  +     + IL+   N    +IP    + S    
Sbjct: 141 PQAIGNLSKLEQLYLGGNQLTGEIPREISHLLSLKILSFRSNNLTASIPSAIFNISSLQY 200

Query: 399 LDLSFNKLTGRVPNSLAKA--KFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSNNDCLC 569
           + L++N L+G +P  +  +  K  G L +S N L G IP        L+  S S N+ + 
Sbjct: 201 IGLTYNSLSGTLPMDMCYSLPKLRG-LYLSGNQLSGKIPTSLGKCGRLEEISLSFNEFMG 259

Query: 570 GNP 578
             P
Sbjct: 260 SIP 262

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 54/170 (31%), Positives = 78/170 (45%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I +   L  L L NN++ G +P   G L KL +  L  NQL G IP  +  +  L  
Sbjct: 117 PNEIAKCRELRQLYLFNNRLTGSIPQAIGNLSKLEQLYLGGNQLTGEIPREISHLLSLKI 176

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGT 359
           L    N +T SIP  +  +  L  + L  NS++G +P  +  S   +  L LS N   G 
Sbjct: 177 LSFRSNNLTASIPSAIFNISSLQYIGLTYNSLSGTLPMDMCYSLPKLRGLYLSGNQLSGK 236

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G       + LSFN+  G +P  +     +  L + +N+L G IP
Sbjct: 237 IPTSLGKCGRLEEISLSFNEFMGSIPRGIGSLSVLEVLYLGSNNLEGEIP 286

 Score = 58.2 bits (139), Expect = 5e-07
 Identities = 36/113 (31%), Positives = 55/113 (48%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  LDLS   + G+I  ++G +  L TL L  NS    IP+ +     +  L L  N  
Sbjct: 77  RVIALDLSNMDLEGTIAPQVGNLSFLVTLDLSNNSFHASIPNEIAKCRELRQLYLFNNRL 136

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G+IP   G+ S    L L  N+LTG +P  ++    +  L   +N+L  +IP
Sbjct: 137 TGSIPQAIGNLSKLEQLYLGGNQLTGEIPREISHLLSLKILSFRSNNLTASIP 189

[44][TOP]
>UniRef100_C5XSE3 Putative uncharacterized protein Sb04g001470 n=1 Tax=Sorghum bicolor
            RepID=C5XSE3_SORBI
          Length = 1064

 Score =  132 bits (332), Expect = 2e-29
 Identities = 77/191 (40%), Positives = 107/191 (56%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLA 179
            P S+ ++  L +LDLS+N++ G +P +  +L  LS  L LS N L G IP  V  +  L 
Sbjct: 460  PASLGKLQKLYYLDLSHNRLNGSIPKEILELPSLSSLLDLSANFLSGPIPSEVGTLANLN 519

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
             L LS N+++G+IP  +G   VL  L LD NS+ G IP +L    G+  LNL+ N   G 
Sbjct: 520  TLSLSGNQLSGNIPDSIGDCEVLEFLLLDSNSLQGGIPQSLTKLKGLNTLNLTMNSLSGR 579

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
            IPD  GS      L L+ N  +G VP +L   K +G+LD+S N+L G +P    F +L  
Sbjct: 580  IPDALGSIGNLQQLGLAHNNFSGPVPETLQNLKLLGNLDVSFNNLQGKLPDEGVFRNLTY 639

Query: 540  ASFSNNDCLCG 572
            A+   ND LCG
Sbjct: 640  AAVEGNDGLCG 650

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 70/194 (36%), Positives = 99/194 (51%), Gaps = 5/194 (2%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLADL 185
           S+   S L  L LSNN   G+LP     L    + L L  N+L G+IP+ +  +  L  L
Sbjct: 340 SLANCSQLQELTLSNNYFSGQLPRSIVNLSSTMQMLYLHNNRLSGSIPEDMGNLIGLNLL 399

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN-TGMGILNLSRNGFEGTI 362
            L +N I+G IP   GK+  L+TL L   S++G IPS+ + N T +  L+   + F G I
Sbjct: 400 SLGINSISGVIPESFGKLTNLATLDLHNTSLSGLIPSSAVGNLTNLVFLDAYNSNFGGPI 459

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGH-LDISNNHLCGNIP--IGSPFDHL 533
           P   G       LDLS N+L G +P  + +   +   LD+S N L G IP  +G+   +L
Sbjct: 460 PASLGKLQKLYYLDLSHNRLNGSIPKEILELPSLSSLLDLSANFLSGPIPSEVGT-LANL 518

Query: 534 DAASFSNNDCLCGN 575
           +  S S N  L GN
Sbjct: 519 NTLSLSGNQ-LSGN 531

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 59/168 (35%), Positives = 90/168 (53%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           +I  ++ L  LDLS+N + GE+P   G+LR+L    +SRN + G +  ++     L DL 
Sbjct: 88  AIGNLTFLRVLDLSSNGLHGEIPESVGRLRRLRALNMSRNHISGALLANLSSCVSLTDLR 147

Query: 189 LSMNRITGSIPVRLG-KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           L  N++ G IP  LG  +  L  L L  NS+TG IP++L + + +  L +  N   G IP
Sbjct: 148 LHHNQLGGRIPADLGTTLTRLQILVLRNNSLTGPIPASLANLSSLRYLLVDINHLGGPIP 207

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              GS +    L L  N L+G +P SL     +  L+++ N L G+IP
Sbjct: 208 AGIGSIAGLQQLGLVDNSLSGVLPPSLWNLSSLVQLEVNYNMLHGSIP 255

 Score = 86.3 bits (212), Expect = 2e-15
 Identities = 56/180 (31%), Positives = 91/180 (50%), Gaps = 11/180 (6%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +S L +L +  N + G +P+  G +  L +  L  N L G +P S+  ++ L  
Sbjct: 183 PASLANLSSLRYLLVDINHLGGPIPAGIGSIAGLQQLGLVDNSLSGVLPPSLWNLSSLVQ 242

Query: 183 LDLSMNRITGSIPVRLG-KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           L+++ N + GSIP  +G K+  +  L L+ N  +G IPS+L + + +  L+LS N F G 
Sbjct: 243 LEVNYNMLHGSIPPDIGDKLPTIQFLWLNSNRFSGAIPSSLSNLSALVSLDLSENNFTGL 302

Query: 360 IPDVFGSKS----YFMVLDLSFNKLTG------RVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P  FG +S       +L L  N+L            SLA    +  L +SNN+  G +P
Sbjct: 303 VPPTFGCRSGKLHSLEILFLGGNQLEADNSKGWEFITSLANCSQLQELTLSNNYFSGQLP 362

 Score = 84.7 bits (208), Expect = 5e-15
 Identities = 53/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  L L +NQ+ G +P+D G  L +L   +L  N L G IP S+  ++ L  L + +N +
Sbjct: 143 LTDLRLHHNQLGGRIPADLGTTLTRLQILVLRNNSLTGPIPASLANLSSLRYLLVDINHL 202

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK- 383
            G IP  +G +  L  L L  NS++G +P +L + + +  L ++ N   G+IP   G K 
Sbjct: 203 GGPIPAGIGSIAGLQQLGLVDNSLSGVLPPSLWNLSSLVQLEVNYNMLHGSIPPDIGDKL 262

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                L L+ N+ +G +P+SL+    +  LD+S N+  G +P
Sbjct: 263 PTIQFLWLNSNRFSGAIPSSLSNLSALVSLDLSENNFTGLVP 304

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 46/134 (34%), Positives = 69/134 (51%), Gaps = 1/134 (0%)
 Frame = +3

Query: 117 LSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS 296
           L  + L GT+  ++  +  L  LDLS N + G IP  +G++R L  L +  N ++G + +
Sbjct: 76  LPSSNLAGTLSPAIGNLTFLRVLDLSSNGLHGEIPESVGRLRRLRALNMSRNHISGALLA 135

Query: 297 TLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHL 473
            L S   +  L L  N   G IP D+  + +   +L L  N LTG +P SLA    + +L
Sbjct: 136 NLSSCVSLTDLRLHHNQLGGRIPADLGTTLTRLQILVLRNNSLTGPIPASLANLSSLRYL 195

Query: 474 DISNNHLCGNIPIG 515
            +  NHL G IP G
Sbjct: 196 LVDINHLGGPIPAG 209

[45][TOP]
>UniRef100_B9NFQ7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFQ7_POPTR
          Length = 1178

 Score =  132 bits (332), Expect = 2e-29
 Identities = 74/191 (38%), Positives = 107/191 (56%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  + ++  L  L L +N + G +P++ G L +L    LS NQL G +P S+  +  L  
Sbjct: 644  PAELGKLPQLRVLSLGSNDLAGRIPAELGNLSRLFMLNLSNNQLTGEVPQSLTSLEGLES 703

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLS-NTGMGILNLSRNGFEGT 359
            LDLS N++TG+I   LG    LS+L L  N++ G+IP  L + N+   +L+LS N   G 
Sbjct: 704  LDLSDNKLTGNISKELGSYEKLSSLDLSHNNLAGEIPFELGNLNSLRYLLDLSSNSLSGA 763

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
            IP  F   S   +L++S N L+GR+P+SL+  + +   D S N L G IP GS F +  A
Sbjct: 764  IPQNFAKLSQLEILNVSHNHLSGRIPDSLSSMRSLSSFDFSYNELTGPIPTGSIFKNASA 823

Query: 540  ASFSNNDCLCG 572
             SF  N  LCG
Sbjct: 824  RSFVRNSGLCG 834

 Score =  103 bits (256), Expect = 1e-20
 Identities = 62/169 (36%), Positives = 85/169 (50%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +   S L  + L  N+  G +   FG L  L    LS NQ IG I     +   L +
Sbjct: 572  PTCLRNCSELSRVRLEKNRFTGNITDAFGVLPNLVFVALSDNQFIGEISPDWGECKNLTN 631

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L +  NRI+G IP  LGK+  L  L L  N + G+IP+ L + + + +LNLS N   G +
Sbjct: 632  LQMDGNRISGEIPAELGKLPQLRVLSLGSNDLAGRIPAELGNLSRLFMLNLSNNQLTGEV 691

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            P    S      LDLS NKLTG +   L   + +  LD+S+N+L G IP
Sbjct: 692  PQSLTSLEGLESLDLSDNKLTGNISKELGSYEKLSSLDLSHNNLAGEIP 740

 Score =  102 bits (254), Expect = 2e-20
 Identities = 61/188 (32%), Positives = 99/188 (52%), Gaps = 3/188 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGEL-PSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P+S+  ++ +  + LS N + GE+ P+      +L    +  N   G IP  + K+  L 
Sbjct: 354 PLSLSNLAKIADMGLSENSLSGEISPTLISNWTELISLQVQNNLFSGNIPPEIGKLTMLQ 413

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N  +GSIP  +G ++ L +L L GN ++G +P  L + T + ILNL  N   G 
Sbjct: 414 YLFLYNNTFSGSIPPEIGNLKELLSLDLSGNQLSGPLPPALWNLTNLQILNLFSNNINGK 473

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHL 533
           IP   G+ +   +LDL+ N+L G +P +++    +  +++  N+L G+IP   G     L
Sbjct: 474 IPPEVGNLTMLQILDLNTNQLHGELPLTISDITSLTSINLFGNNLSGSIPSDFGKYMPSL 533

Query: 534 DAASFSNN 557
             ASFSNN
Sbjct: 534 AYASFSNN 541

 Score =  102 bits (253), Expect = 3e-20
 Identities = 63/188 (33%), Positives = 101/188 (53%), Gaps = 2/188 (1%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  + R   L    +++N   G LP+      +LSR  L +N+  G I D+   +  L  
Sbjct: 548  PPELCRGRSLQQFTVNSNSFTGSLPTCLRNCSELSRVRLEKNRFTGNITDAFGVLPNLVF 607

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            + LS N+  G I    G+ + L+ L++DGN ++G+IP+ L     + +L+L  N   G I
Sbjct: 608  VALSDNQFIGEISPDWGECKNLTNLQMDGNRISGEIPAELGKLPQLRVLSLGSNDLAGRI 667

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI--PIGSPFDHLD 536
            P   G+ S   +L+LS N+LTG VP SL   + +  LD+S+N L GNI   +GS ++ L 
Sbjct: 668  PAELGNLSRLFMLNLSNNQLTGEVPQSLTSLEGLESLDLSDNKLTGNISKELGS-YEKLS 726

Query: 537  AASFSNND 560
            +   S+N+
Sbjct: 727  SLDLSHNN 734

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 57/170 (33%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  ISGL  ++L  N   G +P   G+L+ L +  L  N L  TIP  +     L  
Sbjct: 282 PESIGSISGLQIVELFGNSFQGNIPPSIGQLKHLEKLDLRMNALNSTIPPELGLCTNLTY 341

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN-TGMGILNLSRNGFEGT 359
           L L+ N+++G +P+ L  +  ++ + L  NS++G+I  TL+SN T +  L +  N F G 
Sbjct: 342 LTLADNQLSGELPLSLSNLAKIADMGLSENSLSGEISPTLISNWTELISLQVQNNLFSGN 401

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G  +    L L  N  +G +P  +   K +  LD+S N L G +P
Sbjct: 402 IPPEIGKLTMLQYLFLYNNTFSGSIPPEIGNLKELLSLDLSGNQLSGPLP 451

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 49/162 (30%), Positives = 79/162 (48%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVL-KMNRLADLDLSMNRI 206
           L +L    N++  E P      R L+   LS N+  G IP+ V   + +L  L+L  N  
Sbjct: 194 LEYLSFFLNELTAEFPHFITNCRNLTFLDLSLNKFTGQIPELVYTNLGKLEALNLYNNSF 253

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
            G +   + K+  L  + L  N ++GQIP ++ S +G+ I+ L  N F+G IP   G   
Sbjct: 254 QGPLSSNISKLSNLKNISLQYNLLSGQIPESIGSISGLQIVELFGNSFQGNIPPSIGQLK 313

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           +   LDL  N L   +P  L     + +L +++N L G +P+
Sbjct: 314 HLEKLDLRMNALNSTIPPELGLCTNLTYLTLADNQLSGELPL 355

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 52/169 (30%), Positives = 82/169 (48%), Gaps = 1/169 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPS-DFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I     L  LDLS N+  G++P   +  L KL    L  N   G +  ++ K++ L 
Sbjct: 209 PHFITNCRNLTFLDLSLNKFTGQIPELVYTNLGKLEALNLYNNSFQGPLSSNISKLSNLK 268

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           ++ L  N ++G IP  +G +  L  ++L GNS  G IP ++     +  L+L  N    T
Sbjct: 269 NISLQYNLLSGQIPESIGSISGLQIVELFGNSFQGNIPPSIGQLKHLEKLDLRMNALNST 328

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           IP   G  +    L L+ N+L+G +P SL+    +  + +S N L G I
Sbjct: 329 IPPELGLCTNLTYLTLADNQLSGELPLSLSNLAKIADMGLSENSLSGEI 377

 Score = 74.7 bits (182), Expect = 5e-12
 Identities = 50/158 (31%), Positives = 77/158 (48%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+L NN   G L S+  KL  L    L  N L G IP+S+  ++ L  ++L  N   G+I
Sbjct: 246 LNLYNNSFQGPLSSNISKLSNLKNISLQYNLLSGQIPESIGSISGLQIVELFGNSFQGNI 305

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  +G+++ L  L L  N++   IP  L   T +  L L+ N   G +P    + +    
Sbjct: 306 PPSIGQLKHLEKLDLRMNALNSTIPPELGLCTNLTYLTLADNQLSGELPLSLSNLAKIAD 365

Query: 399 LDLSFNKLTGRV-PNSLAKAKFMGHLDISNNHLCGNIP 509
           + LS N L+G + P  ++    +  L + NN   GNIP
Sbjct: 366 MGLSENSLSGEISPTLISNWTELISLQVQNNLFSGNIP 403

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 55/210 (26%), Positives = 84/210 (40%), Gaps = 48/210 (22%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           +GL   D+ NN++ G +PS  G L  L+   LS N   G+IP  + ++  L  L L  N 
Sbjct: 97  TGLTRFDIQNNKVNGTIPSAIGSLSNLTHLDLSVNFFEGSIPVEISQLTELQYLSLYNNN 156

Query: 204 ITGSIPVRLGKM-----------------------------------------------R 242
           + G IP +L  +                                               R
Sbjct: 157 LNGIIPFQLANLPKVRHLDLGANYLENPDWSNFSMPSLEYLSFFLNELTAEFPHFITNCR 216

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNK 419
            L+ L L  N  TGQIP  + +N G +  LNL  N F+G +       S    + L +N 
Sbjct: 217 NLTFLDLSLNKFTGQIPELVYTNLGKLEALNLYNNSFQGPLSSNISKLSNLKNISLQYNL 276

Query: 420 LTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           L+G++P S+     +  +++  N   GNIP
Sbjct: 277 LSGQIPESIGSISGLQIVELFGNSFQGNIP 306

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 49/161 (30%), Positives = 77/161 (47%), Gaps = 2/161 (1%)
 Frame = +3

Query: 81  DFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLK 260
           +F     L+R  +  N++ GTIP ++  ++ L  LDLS+N   GSIPV + ++  L  L 
Sbjct: 92  NFTPFTGLTRFDIQNNKVNGTIPSAIGSLSNLTHLDLSVNFFEGSIPVEISQLTELQYLS 151

Query: 261 LDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPN 440
           L  N++ G IP  L +   +  L+L  N  E      F   S    L    N+LT   P+
Sbjct: 152 LYNNNLNGIIPFQLANLPKVRHLDLGANYLENPDWSNFSMPS-LEYLSFFLNELTAEFPH 210

Query: 441 SLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAASFSNN 557
            +   + +  LD+S N   G IP  + +    L+A +  NN
Sbjct: 211 FITNCRNLTFLDLSLNKFTGQIPELVYTNLGKLEALNLYNN 251

[46][TOP]
>UniRef100_A9TJD6 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
            RepID=A9TJD6_PHYPA
          Length = 1197

 Score =  132 bits (332), Expect = 2e-29
 Identities = 74/193 (38%), Positives = 107/193 (55%), Gaps = 3/193 (1%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  + R++ L  LD+S N +IG +P   G+LR L    L+ NQ  G IP  +  +N L  
Sbjct: 609  PPELGRLANLTSLDVSGNDLIGTIPPQLGELRTLQGINLANNQFSGPIPSELGNINSLVK 668

Query: 183  LDLSMNRITGSIPVRLGKMRVLS---TLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
            L+L+ NR+TG +P  LG +  LS   +L L GN ++G+IP+ + + +G+ +L+LS N F 
Sbjct: 669  LNLTGNRLTGDLPEALGNLTSLSHLDSLNLSGNKLSGEIPAVVGNLSGLAVLDLSSNHFS 728

Query: 354  GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHL 533
            G IPD          LDLS N L G  P+ +   + M +L++SNN L G IP       L
Sbjct: 729  GVIPDEVSEFYQLAFLDLSSNDLVGSFPSKICDLRSMEYLNVSNNKLVGRIPDIGSCHSL 788

Query: 534  DAASFSNNDCLCG 572
              +SF  N  LCG
Sbjct: 789  TPSSFLGNAGLCG 801

 Score =  102 bits (253), Expect = 3e-20
 Identities = 60/168 (35%), Positives = 87/168 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I   + L+ LDL  N+  G +P+  G+L++L    L    L G IP S+ +   L  
Sbjct: 213 PEEITLCTKLVKLDLGGNKFSGSMPTYIGELKRLVTLNLPSTGLTGPIPPSIGQCTNLQV 272

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL+ N +TGS P  L  ++ L +L  +GN ++G + S +     M  L LS N F GTI
Sbjct: 273 LDLAFNELTGSPPEELAALQSLRSLSFEGNKLSGPLGSWISKLQNMSTLLLSTNQFNGTI 332

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P   G+ S    L L  N+L+G +P  L  A  +  + +S N L GNI
Sbjct: 333 PAAIGNCSKLRSLGLDDNQLSGPIPPELCNAPVLDVVTLSKNFLTGNI 380

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 68/208 (32%), Positives = 97/208 (46%), Gaps = 39/208 (18%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLK------ 164
            P+ +   S L  L+L NN + G +P   G L  L   +LS N L G IP  + +      
Sbjct: 501  PVELCYCSQLTTLNLGNNSLTGTIPHQIGNLVNLDYLVLSHNNLTGEIPSEICRDFQVTT 560

Query: 165  ------MNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL--LSN-TG 317
                  +     LDLS N +TGSIP +LG  +VL  L L GN  +G +P  L  L+N T 
Sbjct: 561  IPVSTFLQHRGTLDLSWNYLTGSIPPQLGDCKVLVELILAGNLFSGGLPPELGRLANLTS 620

Query: 318  MGI---------------------LNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRV 434
            + +                     +NL+ N F G IP   G+ +  + L+L+ N+LTG +
Sbjct: 621  LDVSGNDLIGTIPPQLGELRTLQGINLANNQFSGPIPSELGNINSLVKLNLTGNRLTGDL 680

Query: 435  PNSLAKAKFMGHLD---ISNNHLCGNIP 509
            P +L     + HLD   +S N L G IP
Sbjct: 681  PEALGNLTSLSHLDSLNLSGNKLSGEIP 708

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 54/169 (31%), Positives = 86/169 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI + + L  LDL+ N++ G  P +   L+ L       N+L G +   + K+  ++ 
Sbjct: 261 PPSIGQCTNLQVLDLAFNELTGSPPEELAALQSLRSLSFEGNKLSGPLGSWISKLQNMST 320

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N+  G+IP  +G    L +L LD N ++G IP  L +   + ++ LS+N   G I
Sbjct: 321 LLLSTNQFNGTIPAAIGNCSKLRSLGLDDNQLSGPIPPELCNAPVLDVVTLSKNFLTGNI 380

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            D F        LDL+ N+LTG +P  LA+   +  L +  N   G++P
Sbjct: 381 TDTFRRCLTMTQLDLTSNRLTGAIPAYLAELPSLVMLSLGANQFSGSVP 429

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 54/170 (31%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDL-SNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  I  L+ L L SN+ + G +P + G L  L+   L  ++L G IP+ +    +L 
Sbjct: 164 PSEIWSIRSLVELSLGSNSALTGSIPKEIGNLVNLTSLFLGESKLGGPIPEEITLCTKLV 223

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            LDL  N+ +GS+P  +G+++ L TL L    +TG IP ++   T + +L+L+ N   G+
Sbjct: 224 KLDLGGNKFSGSMPTYIGELKRLVTLNLPSTGLTGPIPPSIGQCTNLQVLDLAFNELTGS 283

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            P+   +      L    NKL+G + + ++K + M  L +S N   G IP
Sbjct: 284 PPEELAALQSLRSLSFEGNKLSGPLGSWISKLQNMSTLLLSTNQFNGTIP 333

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 56/168 (33%), Positives = 83/168 (49%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +  L  L    N++ G L S   KL+ +S  LLS NQ  GTIP ++   ++L  
Sbjct: 285 PEELAALQSLRSLSFEGNKLSGPLGSWISKLQNMSTLLLSTNQFNGTIPAAIGNCSKLRS 344

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+++G IP  L    VL  + L  N +TG I  T      M  L+L+ N   G I
Sbjct: 345 LGLDDNQLSGPIPPELCNAPVLDVVTLSKNFLTGNITDTFRRCLTMTQLDLTSNRLTGAI 404

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P         ++L L  N+ +G VP+SL  +K +  L + NN+L G +
Sbjct: 405 PAYLAELPSLVMLSLGANQFSGSVPDSLWSSKTILELQLENNNLVGRL 452

 Score = 91.7 bits (226), Expect = 4e-17
 Identities = 54/170 (31%), Positives = 82/170 (48%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I   S L  L L +NQ+ G +P +      L    LS+N L G I D+  +   +  
Sbjct: 333 PAAIGNCSKLRSLGLDDNQLSGPIPPELCNAPVLDVVTLSKNFLTGNITDTFRRCLTMTQ 392

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL+ NR+TG+IP  L ++  L  L L  N  +G +P +L S+  +  L L  N   G +
Sbjct: 393 LDLTSNRLTGAIPAYLAELPSLVMLSLGANQFSGSVPDSLWSSKTILELQLENNNLVGRL 452

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
             + G+ +  M L L  N L G +P  + K   +       N L G+IP+
Sbjct: 453 SPLIGNSASLMFLVLDNNNLEGPIPPEIGKVSTLMKFSAQGNSLNGSIPV 502

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 58/173 (33%), Positives = 85/173 (49%), Gaps = 4/173 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  ++ L HLDL+ N   G LPS  G    L    L+ N + G +P S+  M  L  
Sbjct: 65  PPVLCTLTNLQHLDLNTNSFSGTLPSQIGAFVSLQYLDLNSNHISGALPPSIFTMLALQY 124

Query: 183 LDLSMNR---ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNL-SRNGF 350
           +DLS N     +GSI  RL +++ L  L L  NS+TG IPS + S   +  L+L S +  
Sbjct: 125 IDLSFNSGNLFSGSISPRLAQLKNLQALDLSNNSLTGTIPSEIWSIRSLVELSLGSNSAL 184

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G+IP   G+      L L  +KL G +P  +     +  LD+  N   G++P
Sbjct: 185 TGSIPKEIGNLVNLTSLFLGESKLGGPIPEEITLCTKLVKLDLGGNKFSGSMP 237

 Score = 87.0 bits (214), Expect = 9e-16
 Identities = 56/181 (30%), Positives = 81/181 (44%), Gaps = 12/181 (6%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +  L+ L L  NQ  G +P      + +    L  N L+G +   +     L  
Sbjct: 405 PAYLAELPSLVMLSLGANQFSGSVPDSLWSSKTILELQLENNNLVGRLSPLIGNSASLMF 464

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N + G IP  +GK+  L      GNS+ G IP  L   + +  LNL  N   GTI
Sbjct: 465 LVLDNNNLEGPIPPEIGKVSTLMKFSAQGNSLNGSIPVELCYCSQLTTLNLGNNSLTGTI 524

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAK---------AKFMGH---LDISNNHLCGNI 506
           P   G+      L LS N LTG +P+ + +         + F+ H   LD+S N+L G+I
Sbjct: 525 PHQIGNLVNLDYLVLSHNNLTGEIPSEICRDFQVTTIPVSTFLQHRGTLDLSWNYLTGSI 584

Query: 507 P 509
           P
Sbjct: 585 P 585

 Score = 84.3 bits (207), Expect = 6e-15
 Identities = 54/166 (32%), Positives = 80/166 (48%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I ++  +  L LS NQ  G +P+  G   KL    L  NQL G IP  +     L  + L
Sbjct: 312 ISKLQNMSTLLLSTNQFNGTIPAAIGNCSKLRSLGLDDNQLSGPIPPELCNAPVLDVVTL 371

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
           S N +TG+I     +   ++ L L  N +TG IP+ L     + +L+L  N F G++PD 
Sbjct: 372 SKNFLTGNITDTFRRCLTMTQLDLTSNRLTGAIPAYLAELPSLVMLSLGANQFSGSVPDS 431

Query: 372 FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             S    + L L  N L GR+   +  +  +  L + NN+L G IP
Sbjct: 432 LWSSKTILELQLENNNLVGRLSPLIGNSASLMFLVLDNNNLEGPIP 477

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 47/152 (30%), Positives = 79/152 (51%), Gaps = 4/152 (2%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRV 245
           G + +  G++ +LS   L R  L GTIP  +  +  L  LDL+ N  +G++P ++G    
Sbjct: 41  GVICNTLGQVTELS---LPRLGLTGTIPPVLCTLTNLQHLDLNTNSFSGTLPSQIGAFVS 97

Query: 246 LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNG---FEGTIPDVFGSKSYFMVLDLSFN 416
           L  L L+ N ++G +P ++ +   +  ++LS N    F G+I            LDLS N
Sbjct: 98  LQYLDLNSNHISGALPPSIFTMLALQYIDLSFNSGNLFSGSISPRLAQLKNLQALDLSNN 157

Query: 417 KLTGRVPNSLAKAKFMGHLDI-SNNHLCGNIP 509
            LTG +P+ +   + +  L + SN+ L G+IP
Sbjct: 158 SLTGTIPSEIWSIRSLVELSLGSNSALTGSIP 189

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 48/161 (29%), Positives = 68/161 (42%), Gaps = 4/161 (2%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L    + G +P     L  L    L+ N   GT+P  +     L  LDL+ N I+G++
Sbjct: 53  LSLPRLGLTGTIPPVLCTLTNLQHLDLNTNSFSGTLPSQIGAFVSLQYLDLNSNHISGAL 112

Query: 219 PVRLGKMRVLSTLKL---DGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           P  +  M  L  + L    GN  +G I   L     +  L+LS N   GTIP    S   
Sbjct: 113 PPSIFTMLALQYIDLSFNSGNLFSGSISPRLAQLKNLQALDLSNNSLTGTIPSEIWSIRS 172

Query: 390 FMVLDLSFNK-LTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            + L L  N  LTG +P  +     +  L +  + L G IP
Sbjct: 173 LVELSLGSNSALTGSIPKEIGNLVNLTSLFLGESKLGGPIP 213

[47][TOP]
>UniRef100_A7Q694 Chromosome chr11 scaffold_56, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7Q694_VITVI
          Length = 928

 Score =  132 bits (332), Expect = 2e-29
 Identities = 72/190 (37%), Positives = 103/190 (54%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +S L  ++L  N + G +PS  G LR L R +LS N L  +IP S+  +  L  
Sbjct: 378 PSEICLLSNLGEMNLGYNNLSGSIPSCIGNLRYLQRMILSSNSLSSSIPSSLWSLQNLLF 437

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LD S N ++GS+   +  +++L T+ L  N ++G IP+ L     +  LNLSRN F G I
Sbjct: 438 LDFSFNSLSGSLDANMRALKLLETMDLYWNKISGNIPTILGGFQSLRSLNLSRNSFWGPI 497

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P+  G       +DLS N L+G +P SL     + +L++S N L G IP   PF +  A 
Sbjct: 498 PESLGEMITLDYMDLSHNNLSGLIPKSLVALSNLHYLNLSFNKLSGEIPSEGPFGNFTAT 557

Query: 543 SFSNNDCLCG 572
           SF  N+ LCG
Sbjct: 558 SFMENEALCG 567

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 57/168 (33%), Positives = 88/168 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ +   S L  L L++NQ  G +P+  G+L  L   +L+ N L G IP  +  +  L  
Sbjct: 282 PLYLSNCSQLTQLILTSNQFTGPVPTSLGRLEHLQTLILAGNHLTGPIPKEIGSLRNLNL 341

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L+ N + GSIP  +  M+ L  L L GN +   IPS +   + +G +NL  N   G+I
Sbjct: 342 LNLADNNLIGSIPSTIKGMKSLQRLFLGGNQLEQIIPSEICLLSNLGEMNLGYNNLSGSI 401

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P   G+  Y   + LS N L+  +P+SL   + +  LD S N L G++
Sbjct: 402 PSCIGNLRYLQRMILSSNSLSSSIPSSLWSLQNLLFLDFSFNSLSGSL 449

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 57/163 (34%), Positives = 84/163 (51%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L+ L LSNN   G L  + G+L +L   ++ RN+L G IP S+    +L  + L+ N
Sbjct: 96  LSFLVGLVLSNNSFHGHLVPEIGRLHRLRALIVERNKLEGEIPASIQHCQKLKIISLNSN 155

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
             TG IP  L     L TL L  N+ TG IP++L + + +  L L  N   G IPD  G+
Sbjct: 156 EFTGVIPAWLSNFSSLGTLFLGENNFTGTIPASLGNISKLEWLGLGENNLHGIIPDEIGN 215

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +    + L+ N LTG +P S+     +  +  S N L G +P
Sbjct: 216 LN-LQAIALNLNHLTGSIPPSIFNISSLTQIVFSYNSLSGTLP 257

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 49/163 (30%), Positives = 85/163 (52%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +  L  L +  NQ+ G +P       +L++ +L+ NQ  G +P S+ ++  L  L L+ N
Sbjct: 264 LPNLQQLFIEANQLHGNIPLYLSNCSQLTQLILTSNQFTGPVPTSLGRLEHLQTLILAGN 323

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
            +TG IP  +G +R L+ L L  N++ G IPST+     +  L L  N  E  IP     
Sbjct: 324 HLTGPIPKEIGSLRNLNLLNLADNNLIGSIPSTIKGMKSLQRLFLGGNQLEQIIPSEICL 383

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            S    ++L +N L+G +P+ +   +++  + +S+N L  +IP
Sbjct: 384 LSNLGEMNLGYNNLSGSIPSCIGNLRYLQRMILSSNSLSSSIP 426

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 64/199 (32%), Positives = 100/199 (50%), Gaps = 7/199 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +   S L  L L  N   G +P+  G + KL    L  N L G IPD +  +N L  
Sbjct: 162 PAWLSNFSSLGTLFLGENNFTGTIPASLGNISKLEWLGLGENNLHGIIPDEIGNLN-LQA 220

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR-----NG 347
           + L++N +TGSIP  +  +  L+ +    NS++G +PS+L    G+ + NL +     N 
Sbjct: 221 IALNLNHLTGSIPPSIFNISSLTQIVFSYNSLSGTLPSSL----GLWLPNLQQLFIEANQ 276

Query: 348 FEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSP 521
             G IP    + S    L L+ N+ TG VP SL + + +  L ++ NHL G IP  IGS 
Sbjct: 277 LHGNIPLYLSNCSQLTQLILTSNQFTGPVPTSLGRLEHLQTLILAGNHLTGPIPKEIGS- 335

Query: 522 FDHLDAASFSNNDCLCGNP 578
             +L+  + ++N+ +   P
Sbjct: 336 LRNLNLLNLADNNLIGSIP 354

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 48/157 (30%), Positives = 76/157 (48%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L +  + G +    G L  L   +LS N   G +   + +++RL  L +  N++ G I
Sbjct: 78  LSLGDMGLQGTISPHVGNLSFLVGLVLSNNSFHGHLVPEIGRLHRLRALIVERNKLEGEI 137

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  +   + L  + L+ N  TG IP+ L + + +G L L  N F GTIP   G+ S    
Sbjct: 138 PASIQHCQKLKIISLNSNEFTGVIPAWLSNFSSLGTLFLGENNFTGTIPASLGNISKLEW 197

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           L L  N L G +P+ +        + ++ NHL G+IP
Sbjct: 198 LGLGENNLHGIIPDEIGNLNLQA-IALNLNHLTGSIP 233

[48][TOP]
>UniRef100_Q9ZUI0 Putative receptor-like protein kinase n=1 Tax=Arabidopsis thaliana
            RepID=Q9ZUI0_ARATH
          Length = 980

 Score =  132 bits (331), Expect = 3e-29
 Identities = 81/217 (37%), Positives = 109/217 (50%), Gaps = 26/217 (11%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            PM +  I  L  LD+S N + G +P  FG L +L R LL  N L GT+P S+ K   L  
Sbjct: 362  PMELGDIPRLGLLDVSRNNLSGSIPDSFGNLSQLRRLLLYGNHLSGTVPQSLGKCINLEI 421

Query: 183  LDLSMNRITGSIPVR--------------------------LGKMRVLSTLKLDGNSMTG 284
            LDLS N +TG+IPV                           L KM ++ ++ L  N ++G
Sbjct: 422  LDLSHNNLTGTIPVEVVSNLRNLKLYLNLSSNHLSGPIPLELSKMDMVLSVDLSSNELSG 481

Query: 285  QIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFM 464
            +IP  L S   +  LNLSRNGF  T+P   G   Y   LD+SFN+LTG +P S  ++  +
Sbjct: 482  KIPPQLGSCIALEHLNLSRNGFSSTLPSSLGQLPYLKELDVSFNRLTGAIPPSFQQSSTL 541

Query: 465  GHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCGN 575
             HL+ S N L GN+     F  L   SF  +  LCG+
Sbjct: 542  KHLNFSFNLLSGNVSDKGSFSKLTIESFLGDSLLCGS 578

 Score =  105 bits (261), Expect = 3e-21
 Identities = 64/169 (37%), Positives = 95/169 (56%), Gaps = 1/169 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           S+   S L  L+L+ N + GE+ S    L   L +  L +N++ G+IP  +  +  L  L
Sbjct: 267 SLANSSDLQELELAGNSLGGEITSSVRHLSVNLVQIHLDQNRIHGSIPPEISNLLNLTLL 326

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           +LS N ++G IP  L K+  L  + L  N +TG+IP  L     +G+L++SRN   G+IP
Sbjct: 327 NLSSNLLSGPIPRELCKLSKLERVYLSNNHLTGEIPMELGDIPRLGLLDVSRNNLSGSIP 386

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           D FG+ S    L L  N L+G VP SL K   +  LD+S+N+L G IP+
Sbjct: 387 DSFGNLSQLRRLLLYGNHLSGTVPQSLGKCINLEILDLSHNNLTGTIPV 435

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 61/167 (36%), Positives = 89/167 (53%), Gaps = 6/167 (3%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLADL 185
           SI  ++GL  LDLS N  +G++P + G L +  + L LS N L G IP  +  +NRL  L
Sbjct: 85  SIANLTGLTVLDLSRNFFVGKIPPEIGSLHETLKQLSLSENLLHGNIPQELGLLNRLVYL 144

Query: 186 DLSMNRITGSIPVRL---GKMRVLSTLKLDGNSMTGQIPSTLLSN-TGMGILNLSRNGFE 353
           DL  NR+ GSIPV+L   G    L  + L  NS+TG+IP     +   +  L L  N   
Sbjct: 145 DLGSNRLNGSIPVQLFCNGSSSSLQYIDLSNNSLTGEIPLNYHCHLKELRFLLLWSNKLT 204

Query: 354 GTIPDVFGSKSYFMVLDLSFNKLTGRVPNS-LAKAKFMGHLDISNNH 491
           GT+P    + +    +DL  N L+G +P+  ++K   +  L +S NH
Sbjct: 205 GTVPSSLSNSTNLKWMDLESNMLSGELPSQVISKMPQLQFLYLSYNH 251

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 43/145 (29%), Positives = 71/145 (48%), Gaps = 8/145 (5%)
 Frame = +3

Query: 102 LSRALLSRNQLIGTIPDSVLKMNR----LADLDLSMNRITGSIPVRLGKMRVLSTLKLDG 269
           +S +  S + L+     S +K N+    + +LD+S   + G I   +  +  L+ L L  
Sbjct: 40  ISSSSSSSSMLVDVCNWSGVKCNKESTQVIELDISGRDLGGEISPSIANLTGLTVLDLSR 99

Query: 270 NSMTGQIPSTLLS-NTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSL 446
           N   G+IP  + S +  +  L+LS N   G IP   G  +  + LDL  N+L G +P  L
Sbjct: 100 NFFVGKIPPEIGSLHETLKQLSLSENLLHGNIPQELGLLNRLVYLDLGSNRLNGSIPVQL 159

Query: 447 ---AKAKFMGHLDISNNHLCGNIPI 512
                +  + ++D+SNN L G IP+
Sbjct: 160 FCNGSSSSLQYIDLSNNSLTGEIPL 184

[49][TOP]
>UniRef100_B9GRE1 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GRE1_POPTR
          Length = 810

 Score =  132 bits (331), Expect = 3e-29
 Identities = 75/191 (39%), Positives = 106/191 (55%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + ++  L  L L +N++ G +P++ G L KL    LS NQL G +P S+  +  L  
Sbjct: 234 PAELGKLPQLQVLSLGSNELTGRIPAELGNLSKLFMLNLSNNQLTGEVPQSLTSLKGLNS 293

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLS-NTGMGILNLSRNGFEGT 359
           LDLS N++TG+I   LG    LS+L L  N++ G+IP  L + N+   +L+LS N   G 
Sbjct: 294 LDLSDNKLTGNISKELGSYEKLSSLDLSHNNLAGEIPFELGNLNSLQYLLDLSSNSLSGA 353

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
           IP  F   S    L++S N L+GR+P+SL+    +   D S N L G IP GS F +  A
Sbjct: 354 IPQNFAKLSRLETLNVSHNHLSGRIPDSLSSMLSLSSFDFSYNELTGPIPTGSVFKNASA 413

Query: 540 ASFSNNDCLCG 572
            SF  N  LCG
Sbjct: 414 RSFVGNSGLCG 424

 Score =  105 bits (263), Expect = 2e-21
 Identities = 63/169 (37%), Positives = 87/169 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +   S L  + L  N+  G + + FG L  L    LS NQ IG I     +   L +
Sbjct: 162 PTCLRNCSKLTRVRLEENRFTGNITNAFGVLPNLVFVALSDNQFIGEISPDWGECKNLTN 221

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L +  NRI+G IP  LGK+  L  L L  N +TG+IP+ L + + + +LNLS N   G +
Sbjct: 222 LQMDGNRISGEIPAELGKLPQLQVLSLGSNELTGRIPAELGNLSKLFMLNLSNNQLTGEV 281

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P    S      LDLS NKLTG +   L   + +  LD+S+N+L G IP
Sbjct: 282 PQSLTSLKGLNSLDLSDNKLTGNISKELGSYEKLSSLDLSHNNLAGEIP 330

 Score =  100 bits (250), Expect = 6e-20
 Identities = 63/188 (33%), Positives = 99/188 (52%), Gaps = 2/188 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + R   L    ++ N   G LP+      KL+R  L  N+  G I ++   +  L  
Sbjct: 138 PPELCRGLSLQQFTVNENSFTGSLPTCLRNCSKLTRVRLEENRFTGNITNAFGVLPNLVF 197

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           + LS N+  G I    G+ + L+ L++DGN ++G+IP+ L     + +L+L  N   G I
Sbjct: 198 VALSDNQFIGEISPDWGECKNLTNLQMDGNRISGEIPAELGKLPQLQVLSLGSNELTGRI 257

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI--PIGSPFDHLD 536
           P   G+ S   +L+LS N+LTG VP SL   K +  LD+S+N L GNI   +GS ++ L 
Sbjct: 258 PAELGNLSKLFMLNLSNNQLTGEVPQSLTSLKGLNSLDLSDNKLTGNISKELGS-YEKLS 316

Query: 537 AASFSNND 560
           +   S+N+
Sbjct: 317 SLDLSHNN 324

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 51/161 (31%), Positives = 80/161 (49%), Gaps = 1/161 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L +L L NN   G +P + G L++L    LS NQL G +P  +  +  L  L+L  N IT
Sbjct: 2   LQYLFLYNNTFSGSIPPEIGNLKELLSLDLSGNQLSGPLPPPLWNLTNLQILNLFSNNIT 61

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS-KS 386
           G IP  +G + +L  L L+ N + G++P T+ + T +  +NL  N   G+IP  FG    
Sbjct: 62  GKIPSEVGNLTMLQILDLNTNQLHGELPQTISNITSLTSINLFGNNLSGSIPSDFGKYMP 121

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                  S N  +G +P  L +   +    ++ N   G++P
Sbjct: 122 SLAYASFSNNSFSGELPPELCRGLSLQQFTVNENSFTGSLP 162

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 49/169 (28%), Positives = 75/169 (44%), Gaps = 1/169 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L+ LDLS NQ+ G LP     L  L    L  N + G IP  V  +  L  
Sbjct: 17  PPEIGNLKELLSLDLSGNQLSGPLPPPLWNLTNLQILNLFSNNITGKIPSEVGNLTMLQI 76

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGT 359
           LDL+ N++ G +P  +  +  L+++ L GN+++G IPS        +   + S N F G 
Sbjct: 77  LDLNTNQLHGELPQTISNITSLTSINLFGNNLSGSIPSDFGKYMPSLAYASFSNNSFSGE 136

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           +P             ++ N  TG +P  L     +  + +  N   GNI
Sbjct: 137 LPPELCRGLSLQQFTVNENSFTGSLPTCLRNCSKLTRVRLEENRFTGNI 185

[50][TOP]
>UniRef100_B9GRE0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GRE0_POPTR
          Length = 1142

 Score =  132 bits (331), Expect = 3e-29
 Identities = 75/191 (39%), Positives = 106/191 (55%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  + ++  L  L L +N++ G +P++ G L KL    LS NQL G +P S+  +  L  
Sbjct: 628  PAELGKLPQLQVLSLGSNELTGRIPAELGNLSKLFMLNLSNNQLTGEVPQSLTSLKGLNS 687

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLS-NTGMGILNLSRNGFEGT 359
            LDLS N++TG+I   LG    LS+L L  N++ G+IP  L + N+   +L+LS N   G 
Sbjct: 688  LDLSDNKLTGNISKELGSYEKLSSLDLSHNNLAGEIPFELGNLNSLQYLLDLSSNSLSGA 747

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
            IP  F   S    L++S N L+GR+P+SL+    +   D S N L G IP GS F +  A
Sbjct: 748  IPQNFAKLSRLETLNVSHNHLSGRIPDSLSSMLSLSSFDFSYNELTGPIPTGSVFKNASA 807

Query: 540  ASFSNNDCLCG 572
             SF  N  LCG
Sbjct: 808  RSFVGNSGLCG 818

 Score =  105 bits (263), Expect = 2e-21
 Identities = 63/169 (37%), Positives = 87/169 (51%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +   S L  + L  N+  G + + FG L  L    LS NQ IG I     +   L +
Sbjct: 556  PTCLRNCSKLTRVRLEENRFAGNITNAFGVLPNLVFVALSDNQFIGEISPDWGECKNLTN 615

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L +  NRI+G IP  LGK+  L  L L  N +TG+IP+ L + + + +LNLS N   G +
Sbjct: 616  LQMDGNRISGEIPAELGKLPQLQVLSLGSNELTGRIPAELGNLSKLFMLNLSNNQLTGEV 675

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            P    S      LDLS NKLTG +   L   + +  LD+S+N+L G IP
Sbjct: 676  PQSLTSLKGLNSLDLSDNKLTGNISKELGSYEKLSSLDLSHNNLAGEIP 724

 Score =  103 bits (256), Expect = 1e-20
 Identities = 62/188 (32%), Positives = 99/188 (52%), Gaps = 3/188 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGEL-PSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P+S+  +S +  + LS N + GE+ P+      +L    +  N   G IP  + K+  L 
Sbjct: 355 PLSLSNLSKIADMGLSENSLSGEISPTLISNWTELISLQVQNNLFSGNIPPEIGKLTMLQ 414

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N  +GSIP  +G ++ L +L L GN ++G +P  L + T + ILNL  N   G 
Sbjct: 415 YLFLYNNTFSGSIPPEIGNLKELLSLDLSGNQLSGPLPPPLWNLTNLQILNLFSNNITGK 474

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHL 533
           IP   G+ +   +LDL+ N+L G +P +++    +  +++  N+L G+IP   G     L
Sbjct: 475 IPSEVGNLTMLQILDLNTNQLHGELPLTISDITSLTSINLFGNNLSGSIPSDFGKYMPSL 534

Query: 534 DAASFSNN 557
             ASFSNN
Sbjct: 535 AYASFSNN 542

 Score =  100 bits (249), Expect = 8e-20
 Identities = 69/220 (31%), Positives = 108/220 (49%), Gaps = 34/220 (15%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLR---------------------------- 98
            P++I  I+ L  ++L  N + G +PSDFGK                              
Sbjct: 500  PLTISDITSLTSINLFGNNLSGSIPSDFGKYMPSLAYASFSNNSFSGELPPELWSLPTCL 559

Query: 99   ----KLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLD 266
                KL+R  L  N+  G I ++   +  L  + LS N+  G I    G+ + L+ L++D
Sbjct: 560  RNCSKLTRVRLEENRFAGNITNAFGVLPNLVFVALSDNQFIGEISPDWGECKNLTNLQMD 619

Query: 267  GNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSL 446
            GN ++G+IP+ L     + +L+L  N   G IP   G+ S   +L+LS N+LTG VP SL
Sbjct: 620  GNRISGEIPAELGKLPQLQVLSLGSNELTGRIPAELGNLSKLFMLNLSNNQLTGEVPQSL 679

Query: 447  AKAKFMGHLDISNNHLCGNI--PIGSPFDHLDAASFSNND 560
               K +  LD+S+N L GNI   +GS ++ L +   S+N+
Sbjct: 680  TSLKGLNSLDLSDNKLTGNISKELGS-YEKLSSLDLSHNN 718

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 59/170 (34%), Positives = 88/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  ISGL  ++L +N   G +PS  GKL+ L +  L  N L  TIP  +     L  
Sbjct: 283 PESIGSISGLQIVELFSNSFQGNIPSSIGKLKHLEKLDLRINALNSTIPPELGLCTNLTY 342

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN-TGMGILNLSRNGFEGT 359
           L L+ N++ G +P+ L  +  ++ + L  NS++G+I  TL+SN T +  L +  N F G 
Sbjct: 343 LALADNQLRGELPLSLSNLSKIADMGLSENSLSGEISPTLISNWTELISLQVQNNLFSGN 402

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G  +    L L  N  +G +P  +   K +  LD+S N L G +P
Sbjct: 403 IPPEIGKLTMLQYLFLYNNTFSGSIPPEIGNLKELLSLDLSGNQLSGPLP 452

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 50/168 (29%), Positives = 85/168 (50%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           +I ++S L ++ L NN + G++P   G +  L    L  N   G IP S+ K+  L  LD
Sbjct: 261 NISKLSNLKNISLQNNLLSGQIPESIGSISGLQIVELFSNSFQGNIPSSIGKLKHLEKLD 320

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI-P 365
           L +N +  +IP  LG    L+ L L  N + G++P +L + + +  + LS N   G I P
Sbjct: 321 LRINALNSTIPPELGLCTNLTYLALADNQLRGELPLSLSNLSKIADMGLSENSLSGEISP 380

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +  + +  + L +  N  +G +P  + K   + +L + NN   G+IP
Sbjct: 381 TLISNWTELISLQVQNNLFSGNIPPEIGKLTMLQYLFLYNNTFSGSIP 428

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 49/162 (30%), Positives = 79/162 (48%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVL-KMNRLADLDLSMNRI 206
           L +L    N++  E P      R L+   LS N+  G IP+ V   + +L  L+L  N  
Sbjct: 195 LEYLSFFLNELTAEFPHFITNCRNLTFLDLSLNKFTGQIPELVYTNLGKLEALNLYNNSF 254

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
            G +   + K+  L  + L  N ++GQIP ++ S +G+ I+ L  N F+G IP   G   
Sbjct: 255 QGPLSSNISKLSNLKNISLQNNLLSGQIPESIGSISGLQIVELFSNSFQGNIPSSIGKLK 314

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           +   LDL  N L   +P  L     + +L +++N L G +P+
Sbjct: 315 HLEKLDLRINALNSTIPPELGLCTNLTYLALADNQLRGELPL 356

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 52/169 (30%), Positives = 81/169 (47%), Gaps = 1/169 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPS-DFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I     L  LDLS N+  G++P   +  L KL    L  N   G +  ++ K++ L 
Sbjct: 210 PHFITNCRNLTFLDLSLNKFTGQIPELVYTNLGKLEALNLYNNSFQGPLSSNISKLSNLK 269

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           ++ L  N ++G IP  +G +  L  ++L  NS  G IPS++     +  L+L  N    T
Sbjct: 270 NISLQNNLLSGQIPESIGSISGLQIVELFSNSFQGNIPSSIGKLKHLEKLDLRINALNST 329

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           IP   G  +    L L+ N+L G +P SL+    +  + +S N L G I
Sbjct: 330 IPPELGLCTNLTYLALADNQLRGELPLSLSNLSKIADMGLSENSLSGEI 378

 Score = 77.8 bits (190), Expect = 6e-13
 Identities = 52/158 (32%), Positives = 77/158 (48%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+L NN   G L S+  KL  L    L  N L G IP+S+  ++ L  ++L  N   G+I
Sbjct: 247 LNLYNNSFQGPLSSNISKLSNLKNISLQNNLLSGQIPESIGSISGLQIVELFSNSFQGNI 306

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  +GK++ L  L L  N++   IP  L   T +  L L+ N   G +P    + S    
Sbjct: 307 PSSIGKLKHLEKLDLRINALNSTIPPELGLCTNLTYLALADNQLRGELPLSLSNLSKIAD 366

Query: 399 LDLSFNKLTGRV-PNSLAKAKFMGHLDISNNHLCGNIP 509
           + LS N L+G + P  ++    +  L + NN   GNIP
Sbjct: 367 MGLSENSLSGEISPTLISNWTELISLQVQNNLFSGNIP 404

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 54/208 (25%), Positives = 82/208 (39%), Gaps = 48/208 (23%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L   D+ +N + G +PS  G L KL+   LS N   G+IP  + ++  L  L L  N + 
Sbjct: 100 LTRFDIQSNNVNGTIPSAIGSLSKLTHLDLSANLFEGSIPVEISQLTELQYLSLYNNNLN 159

Query: 210 GSIPVRLGKM-----------------------------------------------RVL 248
           G IP +L  +                                               R L
Sbjct: 160 GIIPFQLANLPKVRHLDLGANYLENPDWSNFSMPSLEYLSFFLNELTAEFPHFITNCRNL 219

Query: 249 STLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLT 425
           + L L  N  TGQIP  + +N G +  LNL  N F+G +       S    + L  N L+
Sbjct: 220 TFLDLSLNKFTGQIPELVYTNLGKLEALNLYNNSFQGPLSSNISKLSNLKNISLQNNLLS 279

Query: 426 GRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G++P S+     +  +++ +N   GNIP
Sbjct: 280 GQIPESIGSISGLQIVELFSNSFQGNIP 307

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 53/176 (30%), Positives = 83/176 (47%), Gaps = 3/176 (1%)
 Frame = +3

Query: 39  LDLSNNQIIGELPS-DFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGS 215
           ++L +  I G L   +F     L+R  +  N + GTIP ++  +++L  LDLS N   GS
Sbjct: 78  INLRSLNITGTLAHFNFTPFTDLTRFDIQSNNVNGTIPSAIGSLSKLTHLDLSANLFEGS 137

Query: 216 IPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFM 395
           IPV + ++  L  L L  N++ G IP  L +   +  L+L  N  E      F   S   
Sbjct: 138 IPVEISQLTELQYLSLYNNNLNGIIPFQLANLPKVRHLDLGANYLENPDWSNFSMPS-LE 196

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAASFSNN 557
            L    N+LT   P+ +   + +  LD+S N   G IP  + +    L+A +  NN
Sbjct: 197 YLSFFLNELTAEFPHFITNCRNLTFLDLSLNKFTGQIPELVYTNLGKLEALNLYNN 252

[51][TOP]
>UniRef100_UPI0000E129A4 Os07g0121200 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000E129A4
          Length = 1008

 Score =  131 bits (329), Expect = 4e-29
 Identities = 76/190 (40%), Positives = 107/190 (56%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I   S +  L LSNNQ  G +PS  GKLR+LS+  LS N L G IP  V  +  +  
Sbjct: 432 PDAIGNTSQMSELFLSNNQFHGLIPSSLGKLRQLSKLDLSYNNLEGNIPKEVFTVPTIVQ 491

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
             LS N + G IP  L  ++ LS L L  N++TG+IP TL +   +  +N+ +N   G+I
Sbjct: 492 CGLSHNNLQGLIP-SLSSLQQLSYLDLSSNNLTGEIPPTLGTCQQLETINMGQNFLSGSI 550

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P   G+ S   + +LS N LTG +P +L+K +F+  LD+S+NHL G +P    F +  A 
Sbjct: 551 PTSLGNLSILTLFNLSHNNLTGSIPIALSKLQFLTQLDLSDNHLEGQVPTDGVFRNATAI 610

Query: 543 SFSNNDCLCG 572
           S   N  LCG
Sbjct: 611 SLEGNRQLCG 620

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 62/178 (34%), Positives = 84/178 (47%), Gaps = 1/178 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRK-LSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  L L  N + G LP+  G L   +   +LS N L G +P S+  ++RL    L  N  
Sbjct: 344 LKMLSLHQNLLQGVLPNSVGNLSSSMDNLVLSNNMLSGLVPSSIGNLHRLTKFGLDFNSF 403

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           TG I   +G M  L  L LD N+ TG IP  + + + M  L LS N F G IP   G   
Sbjct: 404 TGPIEGWIGSMVNLQALYLDSNNFTGNIPDAIGNTSQMSELFLSNNQFHGLIPSSLGKLR 463

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNND 560
               LDLS+N L G +P  +     +    +S+N+L G IP  S    L     S+N+
Sbjct: 464 QLSKLDLSYNNLEGNIPKEVFTVPTIVQCGLSHNNLQGLIPSLSSLQQLSYLDLSSNN 521

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 62/170 (36%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLM-HLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P S+  +S  M +L LSNN + G +PS  G L +L++  L  N   G I   +  M  L 
Sbjct: 359 PNSVGNLSSSMDNLVLSNNMLSGLVPSSIGNLHRLTKFGLDFNSFTGPIEGWIGSMVNLQ 418

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N  TG+IP  +G    +S L L  N   G IPS+L     +  L+LS N  EG 
Sbjct: 419 ALYLDSNNFTGNIPDAIGNTSQMSELFLSNNQFHGLIPSSLGKLRQLSKLDLSYNNLEGN 478

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP    +    +   LS N L G +P SL+  + + +LD+S+N+L G IP
Sbjct: 479 IPKEVFTVPTIVQCGLSHNNLQGLIP-SLSSLQQLSYLDLSSNNLTGEIP 527

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 65/207 (31%), Positives = 97/207 (46%), Gaps = 26/207 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +++  + L  LD+S N ++G++  +   L  L    L  N L G IP  +  +  L  
Sbjct: 135 PEALINCTRLRTLDVSRNHLVGDITPNIALLSNLRNMRLHSNNLTGIIPPEIGNITSLNT 194

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLL------------------- 305
           + L  N + GSIP  LGK+  +S L L GN ++G+IP  L                    
Sbjct: 195 VILQGNMLEGSIPEELGKLSNMSYLLLGGNRLSGRIPEVLFNLSHIQEIALPLNMLHGPL 254

Query: 306 -SNTGMGILNLSR-----NGFEGTIPDVFGSKSYFMVLDLSFNK-LTGRVPNSLAKAKFM 464
            S+ G  I NL +     N   G IPD  G+ +    LDLS+N+  TGR+P SL K + +
Sbjct: 255 PSDLGNFIPNLQQLYLGGNMLGGHIPDSLGNATELQWLDLSYNQGFTGRIPPSLGKLRKI 314

Query: 465 GHLDISNNHLCGNIPIGSPFDHLDAAS 545
             L +  N+L      G  ++ LDA S
Sbjct: 315 EKLGLDMNNLEARDSWG--WEFLDALS 339

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 48/154 (31%), Positives = 74/154 (48%), Gaps = 1/154 (0%)
 Frame = +3

Query: 51  NNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRL 230
           N    G +P       +L    +SRN L+G I  ++  ++ L ++ L  N +TG IP  +
Sbjct: 127 NCHCTGIIPEALINCTRLRTLDVSRNHLVGDITPNIALLSNLRNMRLHSNNLTGIIPPEI 186

Query: 231 GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLS 410
           G +  L+T+ L GN + G IP  L   + M  L L  N   G IP+V  + S+   + L 
Sbjct: 187 GNITSLNTVILQGNMLEGSIPEELGKLSNMSYLLLGGNRLSGRIPEVLFNLSHIQEIALP 246

Query: 411 FNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIP 509
            N L G +P+ L      +  L +  N L G+IP
Sbjct: 247 LNMLHGPLPSDLGNFIPNLQQLYLGGNMLGGHIP 280

[52][TOP]
>UniRef100_Q8LHW9 Putative uncharacterized protein OSJNBa0057M23.105 n=1 Tax=Oryza
            sativa Japonica Group RepID=Q8LHW9_ORYSJ
          Length = 1016

 Score =  131 bits (329), Expect = 4e-29
 Identities = 76/190 (40%), Positives = 107/190 (56%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P +I   S +  L LSNNQ  G +PS  GKLR+LS+  LS N L G IP  V  +  +  
Sbjct: 441  PDAIGNTSQMSELFLSNNQFHGLIPSSLGKLRQLSKLDLSYNNLEGNIPKEVFTVPTIVQ 500

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
              LS N + G IP  L  ++ LS L L  N++TG+IP TL +   +  +N+ +N   G+I
Sbjct: 501  CGLSHNNLQGLIP-SLSSLQQLSYLDLSSNNLTGEIPPTLGTCQQLETINMGQNFLSGSI 559

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P   G+ S   + +LS N LTG +P +L+K +F+  LD+S+NHL G +P    F +  A 
Sbjct: 560  PTSLGNLSILTLFNLSHNNLTGSIPIALSKLQFLTQLDLSDNHLEGQVPTDGVFRNATAI 619

Query: 543  SFSNNDCLCG 572
            S   N  LCG
Sbjct: 620  SLEGNRQLCG 629

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 62/178 (34%), Positives = 84/178 (47%), Gaps = 1/178 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRK-LSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  L L  N + G LP+  G L   +   +LS N L G +P S+  ++RL    L  N  
Sbjct: 353 LKMLSLHQNLLQGVLPNSVGNLSSSMDNLVLSNNMLSGLVPSSIGNLHRLTKFGLDFNSF 412

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           TG I   +G M  L  L LD N+ TG IP  + + + M  L LS N F G IP   G   
Sbjct: 413 TGPIEGWIGSMVNLQALYLDSNNFTGNIPDAIGNTSQMSELFLSNNQFHGLIPSSLGKLR 472

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNND 560
               LDLS+N L G +P  +     +    +S+N+L G IP  S    L     S+N+
Sbjct: 473 QLSKLDLSYNNLEGNIPKEVFTVPTIVQCGLSHNNLQGLIPSLSSLQQLSYLDLSSNN 530

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 56/167 (33%), Positives = 86/167 (51%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S+  +S L  L L +N + G +P   G LRKL    LS N L G IP++++   RL  LD
Sbjct: 98  SLGNMSYLTSLSLPDNLLSGRVPPQLGNLRKLVFLDLSGNSLQGIIPEALINCTRLRTLD 157

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           +S N + G I   +  +  L  ++L  N++TG IP  + + T +  + L  N  EG+IP+
Sbjct: 158 VSRNHLVGDITPNIALLSNLRNMRLHSNNLTGIIPPEIGNITSLNTVILQGNMLEGSIPE 217

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             G  S    L L  N+L+GR+P  L     +  + +  N L G +P
Sbjct: 218 ELGKLSNMSYLLLGGNRLSGRIPEVLFNLSHIQEIALPLNMLHGPLP 264

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 62/170 (36%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLM-HLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P S+  +S  M +L LSNN + G +PS  G L +L++  L  N   G I   +  M  L 
Sbjct: 368 PNSVGNLSSSMDNLVLSNNMLSGLVPSSIGNLHRLTKFGLDFNSFTGPIEGWIGSMVNLQ 427

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N  TG+IP  +G    +S L L  N   G IPS+L     +  L+LS N  EG 
Sbjct: 428 ALYLDSNNFTGNIPDAIGNTSQMSELFLSNNQFHGLIPSSLGKLRQLSKLDLSYNNLEGN 487

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP    +    +   LS N L G +P SL+  + + +LD+S+N+L G IP
Sbjct: 488 IPKEVFTVPTIVQCGLSHNNLQGLIP-SLSSLQQLSYLDLSSNNLTGEIP 536

 Score = 86.3 bits (212), Expect = 2e-15
 Identities = 54/170 (31%), Positives = 84/170 (49%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +  L+ LDLS N + G +P       +L    +SRN L+G I  ++  ++ L +
Sbjct: 120 PPQLGNLRKLVFLDLSGNSLQGIIPEALINCTRLRTLDVSRNHLVGDITPNIALLSNLRN 179

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           + L  N +TG IP  +G +  L+T+ L GN + G IP  L   + M  L L  N   G I
Sbjct: 180 MRLHSNNLTGIIPPEIGNITSLNTVILQGNMLEGSIPEELGKLSNMSYLLLGGNRLSGRI 239

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIP 509
           P+V  + S+   + L  N L G +P+ L      +  L +  N L G+IP
Sbjct: 240 PEVLFNLSHIQEIALPLNMLHGPLPSDLGNFIPNLQQLYLGGNMLGGHIP 289

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 66/200 (33%), Positives = 99/200 (49%), Gaps = 15/200 (7%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  +  +S +  + L  N + G LPSD G  +  L +  L  N L G IPDS+     L 
Sbjct: 240 PEVLFNLSHIQEIALPLNMLHGPLPSDLGNFIPNLQQLYLGGNMLGGHIPDSLGNATELQ 299

Query: 180 DLDLSMNR-ITGSIPVRLGKMRVLSTLKLDGNSMTG------QIPSTLLSNTGMGILNLS 338
            LDLS N+  TG IP  LGK+R +  L LD N++        +    L + T + +L+L 
Sbjct: 300 WLDLSYNQGFTGRIPPSLGKLRKIEKLGLDMNNLEARDSWGWEFLDALSNCTRLKMLSLH 359

Query: 339 RNGFEGTIPDVFGSKSYFM-VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP-- 509
           +N  +G +P+  G+ S  M  L LS N L+G VP+S+     +    +  N   G I   
Sbjct: 360 QNLLQGVLPNSVGNLSSSMDNLVLSNNMLSGLVPSSIGNLHRLTKFGLDFNSFTGPIEGW 419

Query: 510 IGSPFD----HLDAASFSNN 557
           IGS  +    +LD+ +F+ N
Sbjct: 420 IGSMVNLQALYLDSNNFTGN 439

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 43/126 (34%), Positives = 63/126 (50%)
 Frame = +3

Query: 132 LIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN 311
           L G I  S+  M+ L  L L  N ++G +P +LG +R L  L L GNS+ G IP  L++ 
Sbjct: 91  LTGQISHSLGNMSYLTSLSLPDNLLSGRVPPQLGNLRKLVFLDLSGNSLQGIIPEALINC 150

Query: 312 TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
           T +  L++SRN   G I       S    + L  N LTG +P  +     +  + +  N 
Sbjct: 151 TRLRTLDVSRNHLVGDITPNIALLSNLRNMRLHSNNLTGIIPPEIGNITSLNTVILQGNM 210

Query: 492 LCGNIP 509
           L G+IP
Sbjct: 211 LEGSIP 216

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 36/116 (31%), Positives = 63/116 (54%)
 Frame = +3

Query: 162 KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
           + +R+  LDL    +TG I   LG M  L++L L  N ++G++P  L +   +  L+LS 
Sbjct: 77  RAHRVVALDLVGQTLTGQISHSLGNMSYLTSLSLPDNLLSGRVPPQLGNLRKLVFLDLSG 136

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           N  +G IP+   + +    LD+S N L G +  ++A    + ++ + +N+L G IP
Sbjct: 137 NSLQGIIPEALINCTRLRTLDVSRNHLVGDITPNIALLSNLRNMRLHSNNLTGIIP 192

[53][TOP]
>UniRef100_Q0D8X3 Os07g0121200 protein n=2 Tax=Oryza sativa Japonica Group
            RepID=Q0D8X3_ORYSJ
          Length = 1134

 Score =  131 bits (329), Expect = 4e-29
 Identities = 76/190 (40%), Positives = 107/190 (56%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P +I   S +  L LSNNQ  G +PS  GKLR+LS+  LS N L G IP  V  +  +  
Sbjct: 558  PDAIGNTSQMSELFLSNNQFHGLIPSSLGKLRQLSKLDLSYNNLEGNIPKEVFTVPTIVQ 617

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
              LS N + G IP  L  ++ LS L L  N++TG+IP TL +   +  +N+ +N   G+I
Sbjct: 618  CGLSHNNLQGLIP-SLSSLQQLSYLDLSSNNLTGEIPPTLGTCQQLETINMGQNFLSGSI 676

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P   G+ S   + +LS N LTG +P +L+K +F+  LD+S+NHL G +P    F +  A 
Sbjct: 677  PTSLGNLSILTLFNLSHNNLTGSIPIALSKLQFLTQLDLSDNHLEGQVPTDGVFRNATAI 736

Query: 543  SFSNNDCLCG 572
            S   N  LCG
Sbjct: 737  SLEGNRQLCG 746

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 62/178 (34%), Positives = 84/178 (47%), Gaps = 1/178 (0%)
 Frame = +3

Query: 30   LMHLDLSNNQIIGELPSDFGKLRK-LSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
            L  L L  N + G LP+  G L   +   +LS N L G +P S+  ++RL    L  N  
Sbjct: 470  LKMLSLHQNLLQGVLPNSVGNLSSSMDNLVLSNNMLSGLVPSSIGNLHRLTKFGLDFNSF 529

Query: 207  TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
            TG I   +G M  L  L LD N+ TG IP  + + + M  L LS N F G IP   G   
Sbjct: 530  TGPIEGWIGSMVNLQALYLDSNNFTGNIPDAIGNTSQMSELFLSNNQFHGLIPSSLGKLR 589

Query: 387  YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNND 560
                LDLS+N L G +P  +     +    +S+N+L G IP  S    L     S+N+
Sbjct: 590  QLSKLDLSYNNLEGNIPKEVFTVPTIVQCGLSHNNLQGLIPSLSSLQQLSYLDLSSNN 647

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 56/167 (33%), Positives = 86/167 (51%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S+  +S L  L L +N + G +P   G LRKL    LS N L G IP++++   RL  LD
Sbjct: 215 SLGNMSYLTSLSLPDNLLSGRVPPQLGNLRKLVFLDLSGNSLQGIIPEALINCTRLRTLD 274

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           +S N + G I   +  +  L  ++L  N++TG IP  + + T +  + L  N  EG+IP+
Sbjct: 275 VSRNHLVGDITPNIALLSNLRNMRLHSNNLTGIIPPEIGNITSLNTVILQGNMLEGSIPE 334

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             G  S    L L  N+L+GR+P  L     +  + +  N L G +P
Sbjct: 335 ELGKLSNMSYLLLGGNRLSGRIPEVLFNLSHIQEIALPLNMLHGPLP 381

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 62/170 (36%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLM-HLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P S+  +S  M +L LSNN + G +PS  G L +L++  L  N   G I   +  M  L 
Sbjct: 485 PNSVGNLSSSMDNLVLSNNMLSGLVPSSIGNLHRLTKFGLDFNSFTGPIEGWIGSMVNLQ 544

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N  TG+IP  +G    +S L L  N   G IPS+L     +  L+LS N  EG 
Sbjct: 545 ALYLDSNNFTGNIPDAIGNTSQMSELFLSNNQFHGLIPSSLGKLRQLSKLDLSYNNLEGN 604

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP    +    +   LS N L G +P SL+  + + +LD+S+N+L G IP
Sbjct: 605 IPKEVFTVPTIVQCGLSHNNLQGLIP-SLSSLQQLSYLDLSSNNLTGEIP 653

 Score = 86.3 bits (212), Expect = 2e-15
 Identities = 54/170 (31%), Positives = 84/170 (49%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +  L+ LDLS N + G +P       +L    +SRN L+G I  ++  ++ L +
Sbjct: 237 PPQLGNLRKLVFLDLSGNSLQGIIPEALINCTRLRTLDVSRNHLVGDITPNIALLSNLRN 296

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           + L  N +TG IP  +G +  L+T+ L GN + G IP  L   + M  L L  N   G I
Sbjct: 297 MRLHSNNLTGIIPPEIGNITSLNTVILQGNMLEGSIPEELGKLSNMSYLLLGGNRLSGRI 356

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIP 509
           P+V  + S+   + L  N L G +P+ L      +  L +  N L G+IP
Sbjct: 357 PEVLFNLSHIQEIALPLNMLHGPLPSDLGNFIPNLQQLYLGGNMLGGHIP 406

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 66/200 (33%), Positives = 99/200 (49%), Gaps = 15/200 (7%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  +  +S +  + L  N + G LPSD G  +  L +  L  N L G IPDS+     L 
Sbjct: 357 PEVLFNLSHIQEIALPLNMLHGPLPSDLGNFIPNLQQLYLGGNMLGGHIPDSLGNATELQ 416

Query: 180 DLDLSMNR-ITGSIPVRLGKMRVLSTLKLDGNSMTG------QIPSTLLSNTGMGILNLS 338
            LDLS N+  TG IP  LGK+R +  L LD N++        +    L + T + +L+L 
Sbjct: 417 WLDLSYNQGFTGRIPPSLGKLRKIEKLGLDMNNLEARDSWGWEFLDALSNCTRLKMLSLH 476

Query: 339 RNGFEGTIPDVFGSKSYFM-VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP-- 509
           +N  +G +P+  G+ S  M  L LS N L+G VP+S+     +    +  N   G I   
Sbjct: 477 QNLLQGVLPNSVGNLSSSMDNLVLSNNMLSGLVPSSIGNLHRLTKFGLDFNSFTGPIEGW 536

Query: 510 IGSPFD----HLDAASFSNN 557
           IGS  +    +LD+ +F+ N
Sbjct: 537 IGSMVNLQALYLDSNNFTGN 556

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 43/126 (34%), Positives = 63/126 (50%)
 Frame = +3

Query: 132 LIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN 311
           L G I  S+  M+ L  L L  N ++G +P +LG +R L  L L GNS+ G IP  L++ 
Sbjct: 208 LTGQISHSLGNMSYLTSLSLPDNLLSGRVPPQLGNLRKLVFLDLSGNSLQGIIPEALINC 267

Query: 312 TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
           T +  L++SRN   G I       S    + L  N LTG +P  +     +  + +  N 
Sbjct: 268 TRLRTLDVSRNHLVGDITPNIALLSNLRNMRLHSNNLTGIIPPEIGNITSLNTVILQGNM 327

Query: 492 LCGNIP 509
           L G+IP
Sbjct: 328 LEGSIP 333

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 36/116 (31%), Positives = 63/116 (54%)
 Frame = +3

Query: 162 KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
           + +R+  LDL    +TG I   LG M  L++L L  N ++G++P  L +   +  L+LS 
Sbjct: 194 RAHRVVALDLVGQTLTGQISHSLGNMSYLTSLSLPDNLLSGRVPPQLGNLRKLVFLDLSG 253

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           N  +G IP+   + +    LD+S N L G +  ++A    + ++ + +N+L G IP
Sbjct: 254 NSLQGIIPEALINCTRLRTLDVSRNHLVGDITPNIALLSNLRNMRLHSNNLTGIIP 309

[54][TOP]
>UniRef100_C5YTA1 Putative uncharacterized protein Sb08g005400 n=1 Tax=Sorghum bicolor
            RepID=C5YTA1_SORBI
          Length = 1103

 Score =  131 bits (329), Expect = 4e-29
 Identities = 70/192 (36%), Positives = 104/192 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P ++  +  ++ L L NN+  G +P D G L  L    LS N++  TIP S+  ++ L  
Sbjct: 537  PSNLAMLKNMVKLYLHNNEFSGSIPRDIGNLTVLEDLRLSNNRITWTIPPSLFHIDSLIF 596

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N + G +PV +G M+ ++ + L  N + G +P ++     M  LNLS N F G+I
Sbjct: 597  LDLSENLLEGELPVDIGYMKQINGMDLSANLLVGSLPDSIAQLQMMAYLNLSHNSFHGSI 656

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  F + +    LDLS+N L+G +PN LA    +  L++S N L G IP G  F ++   
Sbjct: 657  PMSFINLTSLQFLDLSYNHLSGTIPNYLANFSILASLNLSYNELQGQIPEGGVFSNITLQ 716

Query: 543  SFSNNDCLCGNP 578
            S   N  LCG P
Sbjct: 717  SLIGNAGLCGAP 728

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 57/170 (33%), Positives = 91/170 (53%), Gaps = 2/170 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +V    L  +D++ N + G LP+  G L +L+   L  N  +G IP  +  +  L+ 
Sbjct: 293 PSGLVACRFLESVDMTENLLEGILPTWLGSLVRLTFLSLGGNSFVGPIPAELGNLTMLSS 352

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS+  +TGSIPV LG M  LS L L  N ++G IP++L + +  G + L  N   GTI
Sbjct: 353 LDLSVCNLTGSIPVGLGHMSQLSLLLLSANQLSGSIPASLGNLSEFGYMALDGNQLVGTI 412

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNI 506
           P      +   ++ +S N+L G     ++L+  + + +LDIS N   G++
Sbjct: 413 PSALCDMNSLFLISVSENRLQGDFSFLSALSNCRQLSYLDISMNRFVGSL 462

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 53/158 (33%), Positives = 78/158 (49%), Gaps = 1/158 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  L+L+N  + G LP D G+L +L     + N L G+IP ++  +  L  L L  N
Sbjct: 104 LSFLTVLNLTNTSLTGALPDDLGRLHRLKAMDFTFNGLSGSIPPAIGNLTSLEVLALKFN 163

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFG 377
            ++G IP  L  +  L+ + L  N +TG IP  L +NT  +  LN   N   G+IP   G
Sbjct: 164 HLSGPIPAELHNLHSLNHINLQRNFLTGSIPDNLFNNTPLLTYLNFGNNSLSGSIPSCIG 223

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
           S      L L  N L G VP ++     +  L ++ NH
Sbjct: 224 SLPSLEYLKLQVNHLAGAVPPAIFNMSTLQILALTYNH 261

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 47/158 (29%), Positives = 82/158 (51%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           + L +  + G +    G L  L+   L+   L G +PD + +++RL  +D + N ++GSI
Sbjct: 86  VQLQHLPLYGVVAPQLGNLSFLTVLNLTNTSLTGALPDDLGRLHRLKAMDFTFNGLSGSI 145

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD-VFGSKSYFM 395
           P  +G +  L  L L  N ++G IP+ L +   +  +NL RN   G+IPD +F +     
Sbjct: 146 PPAIGNLTSLEVLALKFNHLSGPIPAELHNLHSLNHINLQRNFLTGSIPDNLFNNTPLLT 205

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L+   N L+G +P+ +     + +L +  NHL G +P
Sbjct: 206 YLNFGNNSLSGSIPSCIGSLPSLEYLKLQVNHLAGAVP 243

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 52/164 (31%), Positives = 80/164 (48%), Gaps = 2/164 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR-I 206
           L +L+  NN + G +PS  G L  L    L  N L G +P ++  M+ L  L L+ N  +
Sbjct: 204 LTYLNFGNNSLSGSIPSCIGSLPSLEYLKLQVNHLAGAVPPAIFNMSTLQILALTYNHGL 263

Query: 207 TGSIPVRLG-KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           TG I       + +L    +  NS +GQIPS L++   +  ++++ N  EG +P   GS 
Sbjct: 264 TGPILGNASFSLPMLQVFSIGLNSFSGQIPSGLVACRFLESVDMTENLLEGILPTWLGSL 323

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
                L L  N   G +P  L     +  LD+S  +L G+IP+G
Sbjct: 324 VRLTFLSLGGNSFVGPIPAELGNLTMLSSLDLSVCNLTGSIPVG 367

 Score = 79.0 bits (193), Expect = 3e-13
 Identities = 51/165 (30%), Positives = 79/165 (47%)
 Frame = +3

Query: 54  NQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLG 233
           N   G++PS     R L    ++ N L G +P  +  + RL  L L  N   G IP  LG
Sbjct: 286 NSFSGQIPSGLVACRFLESVDMTENLLEGILPTWLGSLVRLTFLSLGGNSFVGPIPAELG 345

Query: 234 KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSF 413
            + +LS+L L   ++TG IP  L   + + +L LS N   G+IP   G+ S F  + L  
Sbjct: 346 NLTMLSSLDLSVCNLTGSIPVGLGHMSQLSLLLLSANQLSGSIPASLGNLSEFGYMALDG 405

Query: 414 NKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASF 548
           N+L G +P++L     +  + +S N L G+    S   +    S+
Sbjct: 406 NQLVGTIPSALCDMNSLFLISVSENRLQGDFSFLSALSNCRQLSY 450

 Score = 77.8 bits (190), Expect = 6e-13
 Identities = 51/163 (31%), Positives = 81/163 (49%), Gaps = 2/163 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDF--GKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           L +LD+S N+ +G L  +       +L     + N+++G +P ++  +  L  L+LS  +
Sbjct: 448 LSYLDISMNRFVGSLTENHIGNWSNELQTFRANGNKIVGELPAAISNLTGLISLELSDTQ 507

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           +  +IP  +  +  L  L L  NSM   IPS L     M  L L  N F G+IP   G+ 
Sbjct: 508 LRSAIPESMAMLEDLQWLGLQRNSMFASIPSNLAMLKNMVKLYLHNNEFSGSIPRDIGNL 567

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           +    L LS N++T  +P SL     +  LD+S N L G +P+
Sbjct: 568 TVLEDLRLSNNRITWTIPPSLFHIDSLIFLDLSENLLEGELPV 610

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 52/196 (26%), Positives = 85/196 (43%), Gaps = 27/196 (13%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + R+  L  +D + N + G +P   G L  L    L  N L G IP  +  ++ L  
Sbjct: 122 PDDLGRLHRLKAMDFTFNGLSGSIPPAIGNLTSLEVLALKFNHLSGPIPAELHNLHSLNH 181

Query: 183 LDLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           ++L  N +TGSIP  L     +L+ L    NS++G IPS + S   +  L L  N   G 
Sbjct: 182 INLQRNFLTGSIPDNLFNNTPLLTYLNFGNNSLSGSIPSCIGSLPSLEYLKLQVNHLAGA 241

Query: 360 IPDVFGSKSYFMVLDLSF--------------------------NKLTGRVPNSLAKAKF 461
           +P    + S   +L L++                          N  +G++P+ L   +F
Sbjct: 242 VPPAIFNMSTLQILALTYNHGLTGPILGNASFSLPMLQVFSIGLNSFSGQIPSGLVACRF 301

Query: 462 MGHLDISNNHLCGNIP 509
           +  +D++ N L G +P
Sbjct: 302 LESVDMTENLLEGILP 317

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 35/114 (30%), Positives = 58/114 (50%)
 Frame = +3

Query: 168 NRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNG 347
           NR+  + L    + G +  +LG +  L+ L L   S+TG +P  L     +  ++ + NG
Sbjct: 81  NRVTAVQLQHLPLYGVVAPQLGNLSFLTVLNLTNTSLTGALPDDLGRLHRLKAMDFTFNG 140

Query: 348 FEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             G+IP   G+ +   VL L FN L+G +P  L     + H+++  N L G+IP
Sbjct: 141 LSGSIPPAIGNLTSLEVLALKFNHLSGPIPAELHNLHSLNHINLQRNFLTGSIP 194

[55][TOP]
>UniRef100_B8LQX6 Putative uncharacterized protein n=1 Tax=Picea sitchensis
            RepID=B8LQX6_PICSI
          Length = 818

 Score =  131 bits (329), Expect = 4e-29
 Identities = 80/227 (35%), Positives = 117/227 (51%), Gaps = 35/227 (15%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I   S L  LDLS N   G++P     L++L    ++ N+L G IP S+  + +L  
Sbjct: 515  PEVIDNFSQLQLLDLSKNGFTGQIPGYLASLQELRVLSVAYNKLHGDIPASITNLTQLQV 574

Query: 183  LDLSMNRITGSIP---VRLGKMRVLSTLKLDGNSM------------------------- 278
            LDLS NRI+G IP    RL   ++L++ KL  N++                         
Sbjct: 575  LDLSNNRISGRIPRDLERLQGFKILASSKLSSNTLYEDLDIVIKGFEYTLTYVLATNTIF 634

Query: 279  -------TGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVP 437
                   TG+IP+++ + + + +LNLSRN  EG IP   G  S    LDL+ N  +G++P
Sbjct: 635  DLSSNNLTGEIPASIGNLSTLRLLNLSRNQLEGKIPASLGQISTLEQLDLANNYFSGKIP 694

Query: 438  NSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCGNP 578
              L+    +  L++S+N LCG IP+G+ FD  +A SF NN CLCG P
Sbjct: 695  QELSNLTMLASLNVSSNRLCGRIPLGTQFDTFNATSFQNNKCLCGFP 741

 Score =  113 bits (283), Expect = 9e-24
 Identities = 62/169 (36%), Positives = 95/169 (56%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           PMSI R+  L  L L  N + G +P   G L +L+   L +N   G IP+++  + +L  
Sbjct: 420 PMSIFRLP-LSTLSLGKNYLTGSIPEAIGNLSQLTSLSLHQNNFTGGIPEAIGNLIQLTS 478

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L+ N  TG IP  +G +  L++L L+ N+ TG IP  + + + + +L+LS+NGF G I
Sbjct: 479 LILNQNNFTGGIPEAIGNLSQLTSLTLNQNNFTGGIPEVIDNFSQLQLLDLSKNGFTGQI 538

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P    S     VL +++NKL G +P S+     +  LD+SNN + G IP
Sbjct: 539 PGYLASLQELRVLSVAYNKLHGDIPASITNLTQLQVLDLSNNRISGRIP 587

 Score =  106 bits (264), Expect = 1e-21
 Identities = 61/169 (36%), Positives = 88/169 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++   + L  + LS N + G +P++FG+L KL +  L  N L G+IP S+     L  
Sbjct: 199 PKALCNCTRLQWIRLSYNSLTGSIPTEFGRLVKLEQLRLRNNNLSGSIPTSLSNCTSLQG 258

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L +  N +TG IP  L  +R LS L  +GNS++G IPS+L + T +  +  S N   G I
Sbjct: 259 LSIGYNSLTGPIPSVLSLIRNLSLLYFEGNSLSGHIPSSLCNCTELRYIAFSHNNLVGRI 318

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G       L L  NKL   +P SL     + +L + +N L GNIP
Sbjct: 319 PAELGLLQNLQKLYLHTNKLESTIPPSLGNCSSLENLFLGDNRLSGNIP 367

 Score =  100 bits (250), Expect = 6e-20
 Identities = 58/167 (34%), Positives = 91/167 (54%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S+  +S L  L+LS N + G +P +FG+L+ L    L  N L G IP ++    RL  + 
Sbjct: 153 SLCSLSLLRVLNLSGNNLTGTIPPEFGQLKSLGILDLRFNFLRGFIPKALCNCTRLQWIR 212

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           LS N +TGSIP   G++  L  L+L  N+++G IP++L + T +  L++  N   G IP 
Sbjct: 213 LSYNSLTGSIPTEFGRLVKLEQLRLRNNNLSGSIPTSLSNCTSLQGLSIGYNSLTGPIPS 272

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           V        +L    N L+G +P+SL     + ++  S+N+L G IP
Sbjct: 273 VLSLIRNLSLLYFEGNSLSGHIPSSLCNCTELRYIAFSHNNLVGRIP 319

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 56/173 (32%), Positives = 89/173 (51%), Gaps = 3/173 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  +S L  L L  N   G +P   G L +L+  +L++N   G IP+++  +++L  
Sbjct: 443 PEAIGNLSQLTSLSLHQNNFTGGIPEAIGNLIQLTSLILNQNNFTGGIPEAIGNLSQLTS 502

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L+ N  TG IP  +     L  L L  N  TGQIP  L S   + +L+++ N   G I
Sbjct: 503 LTLNQNNFTGGIPEVIDNFSQLQLLDLSKNGFTGQIPGYLASLQELRVLSVAYNKLHGDI 562

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA---KFMGHLDISNNHLCGNIPI 512
           P    + +   VLDLS N+++GR+P  L +    K +    +S+N L  ++ I
Sbjct: 563 PASITNLTQLQVLDLSNNRISGRIPRDLERLQGFKILASSKLSSNTLYEDLDI 615

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 52/175 (29%), Positives = 92/175 (52%), Gaps = 6/175 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+   + L ++  S+N ++G +P++ G L+ L +  L  N+L  TIP S+   + L +
Sbjct: 295 PSSLCNCTELRYIAFSHNNLVGRIPAELGLLQNLQKLYLHTNKLESTIPPSLGNCSSLEN 354

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDG-----NSMTGQIPSTLLSNTGMGILNLSRNG 347
           L L  NR++G+IP + G +R L  L + G      S++G IPS + + + +  L+   N 
Sbjct: 355 LFLGDNRLSGNIPSQFGSLRELFQLSIYGPEYVKGSISGSIPSEIGNCSSLVWLDFGNNR 414

Query: 348 FEGTIP-DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +G++P  +F  +     L L  N LTG +P ++     +  L +  N+  G IP
Sbjct: 415 VQGSVPMSIF--RLPLSTLSLGKNYLTGSIPEAIGNLSQLTSLSLHQNNFTGGIP 467

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 57/198 (28%), Positives = 92/198 (46%), Gaps = 7/198 (3%)
 Frame = +3

Query: 6   MSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           +S++R   L++ +   N + G +PS      +L     S N L+G IP  +  +  L  L
Sbjct: 274 LSLIRNLSLLYFE--GNSLSGHIPSSLCNCTELRYIAFSHNNLVGRIPAELGLLQNLQKL 331

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNL-----SRNGF 350
            L  N++  +IP  LG    L  L L  N ++G IPS   S   +  L++      +   
Sbjct: 332 YLHTNKLESTIPPSLGNCSSLENLFLGDNRLSGNIPSQFGSLRELFQLSIYGPEYVKGSI 391

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPF 524
            G+IP   G+ S  + LD   N++ G VP S+ +   +  L +  N+L G+IP  IG+  
Sbjct: 392 SGSIPSEIGNCSSLVWLDFGNNRVQGSVPMSIFRLP-LSTLSLGKNYLTGSIPEAIGN-L 449

Query: 525 DHLDAASFSNNDCLCGNP 578
             L + S   N+   G P
Sbjct: 450 SQLTSLSLHQNNFTGGIP 467

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 46/126 (36%), Positives = 64/126 (50%)
 Frame = +3

Query: 132 LIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN 311
           L G I  S+  ++ L  L+LS N +TG+IP   G+++ L  L L  N + G IP  L + 
Sbjct: 146 LQGRISPSLCSLSLLRVLNLSGNNLTGTIPPEFGQLKSLGILDLRFNFLRGFIPKALCNC 205

Query: 312 TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
           T +  + LS N   G+IP  FG       L L  N L+G +P SL+    +  L I  N 
Sbjct: 206 TRLQWIRLSYNSLTGSIPTEFGRLVKLEQLRLRNNNLSGSIPTSLSNCTSLQGLSIGYNS 265

Query: 492 LCGNIP 509
           L G IP
Sbjct: 266 LTGPIP 271

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 46/138 (33%), Positives = 71/138 (51%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           R+   ALLS  + + + PD  L +N  ++   ++    G I  R    RV++ + L G  
Sbjct: 89  RRDVEALLSFRKALTSDPDGSL-LNWTSENSDNVCSWNG-IFCRKRTKRVVAII-LPGLG 145

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA 455
           + G+I  +L S + + +LNLS N   GTIP  FG      +LDL FN L G +P +L   
Sbjct: 146 LQGRISPSLCSLSLLRVLNLSGNNLTGTIPPEFGQLKSLGILDLRFNFLRGFIPKALCNC 205

Query: 456 KFMGHLDISNNHLCGNIP 509
             +  + +S N L G+IP
Sbjct: 206 TRLQWIRLSYNSLTGSIP 223

[56][TOP]
>UniRef100_A5B0Q4 Putative uncharacterized protein n=1 Tax=Vitis vinifera
            RepID=A5B0Q4_VITVI
          Length = 1229

 Score =  131 bits (329), Expect = 4e-29
 Identities = 73/192 (38%), Positives = 107/192 (55%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  +  L +L LS+N++ G +PS FG L  L    L  N L   IP S+  +  L  
Sbjct: 679  PNDLCHLKNLGYLHLSSNKLSGSIPSCFGDLPALQELFLDSNVLAFNIPTSLWSLRDLLV 738

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N +TG++P  +G M+ ++TL L  N ++G IP  +     +  L+LS+N  +G I
Sbjct: 739  LNLSSNFLTGNLPPEVGNMKSITTLDLSKNLVSGYIPRRMGEQQNLAKLSLSQNRLQGPI 798

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  FG       LDLS N L+G +P SL    ++ +L++S+N L G IP G PF +  A 
Sbjct: 799  PVEFGDLVSLESLDLSQNNLSGTIPKSLEALIYLKYLNVSSNKLQGEIPNGGPFVNFTAE 858

Query: 543  SFSNNDCLCGNP 578
            SF  N+ LCG P
Sbjct: 859  SFMFNEALCGAP 870

 Score =  103 bits (256), Expect = 1e-20
 Identities = 58/181 (32%), Positives = 101/181 (55%), Gaps = 2/181 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L+ LDLSNN     LP D GK ++L +  L  N+L+G IP+++  +++L +L L  N
Sbjct: 74  LSFLISLDLSNNYFHDSLPKDIGKCKELQQLNLFNNKLVGGIPEAICNLSKLEELYLGNN 133

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFG 377
           ++ G IP ++  ++ L  L    N++TG IP+T+ + + +  ++LS N   G++P D+  
Sbjct: 134 QLIGEIPKKMNHLQNLKVLSFPMNNLTGFIPATIFNISSLLNISLSNNNLSGSLPMDMCY 193

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSN 554
           +      L+LS N L+G++P  L +   +  + ++ N   G+IP G      L   S  N
Sbjct: 194 ANPKLKELNLSSNHLSGKIPTGLGQCLKLQVISLAYNDFTGSIPSGIGNLVELQRLSLQN 253

Query: 555 N 557
           N
Sbjct: 254 N 254

 Score =  100 bits (250), Expect = 6e-20
 Identities = 70/211 (33%), Positives = 96/211 (45%), Gaps = 26/211 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  IS L+++ LSNN + G LP D      KL    LS N L G IP  + +  +L 
Sbjct: 164 PATIFNISSLLNISLSNNNLSGSLPMDMCYANPKLKELNLSSNHLSGKIPTGLGQCLKLQ 223

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            + L+ N  TGSIP  +G +  L  L L  NS+TG+IP  L + + + +LNL+ N  EG 
Sbjct: 224 VISLAYNDFTGSIPSGIGNLVELQRLSLQNNSLTGEIPQLLFNISSLRLLNLAVNNLEGE 283

Query: 360 IPD------------------------VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
           IP                           GS S    L L +NKLTG +P  +     + 
Sbjct: 284 IPSNLSHCRELRVLSLSINRFTGGIPQAIGSLSDLEELYLGYNKLTGGIPREIGNLSNLN 343

Query: 468 HLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
            L + +N + G IP        L    FSNN
Sbjct: 344 ILQLGSNGISGPIPAEIFNISSLQGIGFSNN 374

 Score =  100 bits (248), Expect = 1e-19
 Identities = 56/170 (32%), Positives = 83/170 (48%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I +   L  L+L NN+++G +P     L KL    L  NQLIG IP  +  +  L  
Sbjct: 92  PKDIGKCKELQQLNLFNNKLVGGIPEAICNLSKLEELYLGNNQLIGEIPKKMNHLQNLKV 151

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGT 359
           L   MN +TG IP  +  +  L  + L  N+++G +P  +  +N  +  LNLS N   G 
Sbjct: 152 LSFPMNNLTGFIPATIFNISSLLNISLSNNNLSGSLPMDMCYANPKLKELNLSSNHLSGK 211

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G      V+ L++N  TG +P+ +     +  L + NN L G IP
Sbjct: 212 IPTGLGQCLKLQVISLAYNDFTGSIPSGIGNLVELQRLSLQNNSLTGEIP 261

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 61/168 (36%), Positives = 85/168 (50%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9    SIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADL 185
            S+     L +L + NN   G LP+  G L   L   + S  Q  GTIP  +  +  L  L
Sbjct: 584  SLTNCKFLKNLWIGNNPFKGTLPNSLGNLPIALESFIASACQFRGTIPTGIGNLTNLIWL 643

Query: 186  DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
            DL  N +TGSIP  LG+++ L  L + GN + G IP+ L     +G L+LS N   G+IP
Sbjct: 644  DLGANDLTGSIPTILGRLKKLQRLHIAGNRLRGSIPNDLCHLKNLGYLHLSSNKLSGSIP 703

Query: 366  DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              FG       L L  N L   +P SL   + +  L++S+N L GN+P
Sbjct: 704  SCFGDLPALQELFLDSNVLAFNIPTSLWSLRDLLVLNLSSNFLTGNLP 751

 Score = 91.7 bits (226), Expect = 4e-17
 Identities = 58/170 (34%), Positives = 82/170 (48%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L  L L NN + GE+P     +  L    L+ N L G IP ++     L  
Sbjct: 237 PSGIGNLVELQRLSLQNNSLTGEIPQLLFNISSLRLLNLAVNNLEGEIPSNLSHCRELRV 296

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS+NR TG IP  +G +  L  L L  N +TG IP  + + + + IL L  NG  G I
Sbjct: 297 LSLSINRFTGGIPQAIGSLSDLEELYLGYNKLTGGIPREIGNLSNLNILQLGSNGISGPI 356

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIP 509
           P    + S    +  S N L+G +P  + K    +  LD++ NHL G +P
Sbjct: 357 PAEIFNISSLQGIGFSNNSLSGSLPMDICKHLPNLQWLDLALNHLSGQLP 406

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 53/171 (30%), Positives = 90/171 (52%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVR-ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           PM I + +  L  LDL+ N + G+LP+     R+L    LS N+  G+IP  +  +++L 
Sbjct: 381 PMDICKHLPNLQWLDLALNHLSGQLPTTLSLCRELLVLSLSFNKFRGSIPREIGNLSKLE 440

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            +DLS N + GSIP   G +  L  L L  N++TG +P  + + + +  L ++ N   G+
Sbjct: 441 WIDLSSNSLVGSIPTSFGNLMALKFLNLGINNLTGTVPEAIFNISKLQSLAMAINHLSGS 500

Query: 360 IPDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+       L +  N+ +G +P S++    +  LD+S N   GN+P
Sbjct: 501 LPSSIGTWLPDLEGLFIGGNEFSGIIPVSISNMSKLTQLDVSRNSFIGNVP 551

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 63/250 (25%), Positives = 101/250 (40%), Gaps = 81/250 (32%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I  +S L  +DLS+N ++G +P+ FG L  L    L  N L GT+P+++  +++L  
Sbjct: 430  PREIGNLSKLEWIDLSSNSLVGSIPTSFGNLMALKFLNLGINNLTGTVPEAIFNISKLQS 489

Query: 183  LDLSMNRITGS-------------------------IPVRLGKMRVLSTLKLDGNSMTGQ 287
            L +++N ++GS                         IPV +  M  L+ L +  NS  G 
Sbjct: 490  LAMAINHLSGSLPSSIGTWLPDLEGLFIGGNEFSGIIPVSISNMSKLTQLDVSRNSFIGN 549

Query: 288  IPSTLLSNTGMGILNLS-------------------------------RNGFEGTIPDV- 371
            +P  L + T + +LNL+                                N F+GT+P+  
Sbjct: 550  VPKDLGNLTKLEVLNLAGNQFTNEHLASEVSFLTSLTNCKFLKNLWIGNNPFKGTLPNSL 609

Query: 372  ------------------------FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDI 479
                                     G+ +  + LDL  N LTG +P  L + K +  L I
Sbjct: 610  GNLPIALESFIASACQFRGTIPTGIGNLTNLIWLDLGANDLTGSIPTILGRLKKLQRLHI 669

Query: 480  SNNHLCGNIP 509
            + N L G+IP
Sbjct: 670  AGNRLRGSIP 679

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 44/139 (31%), Positives = 68/139 (48%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           +++S   LS   L GTI   V  ++ L  LDLS N    S+P  +GK + L  L L  N 
Sbjct: 51  QRVSAINLSNMGLEGTIAPQVGNLSFLISLDLSNNYFHDSLPKDIGKCKELQQLNLFNNK 110

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA 455
           + G IP  + + + +  L L  N   G IP          VL    N LTG +P ++   
Sbjct: 111 LVGGIPEAICNLSKLEELYLGNNQLIGEIPKKMNHLQNLKVLSFPMNNLTGFIPATIFNI 170

Query: 456 KFMGHLDISNNHLCGNIPI 512
             + ++ +SNN+L G++P+
Sbjct: 171 SSLLNISLSNNNLSGSLPM 189

[57][TOP]
>UniRef100_A5BMU7 Putative uncharacterized protein n=1 Tax=Vitis vinifera
            RepID=A5BMU7_VITVI
          Length = 1241

 Score =  130 bits (328), Expect = 6e-29
 Identities = 72/192 (37%), Positives = 106/192 (55%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  +  L +L L +N++ G +PS FG L  L    L  N L   IP S+  +  L  
Sbjct: 691  PNDLCHLKNLGYLHLXSNKLSGSIPSCFGDLPALQELFLDSNVLAFNIPTSLWSLRDLLV 750

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N +TG++P  +G M+ ++TL L  N ++G IP  +     +  L+LS+N  +G I
Sbjct: 751  LNLSSNFLTGNLPPEVGNMKSITTLDLSKNLVSGYIPRRMGEQQNLAKLSLSQNRLQGPI 810

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  FG       LDLS N L+G +P SL    ++ +L++S+N L G IP G PF +  A 
Sbjct: 811  PXEFGDLVSLESLDLSQNNLSGTIPKSLEALIYLKYLNVSSNKLQGEIPNGGPFXNFTAE 870

Query: 543  SFSNNDCLCGNP 578
            SF  N+ LCG P
Sbjct: 871  SFMFNEALCGAP 882

 Score =  107 bits (266), Expect = 9e-22
 Identities = 71/210 (33%), Positives = 99/210 (47%), Gaps = 25/210 (11%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L  L L NN + GE+PS+F   R+L    LS NQ  G IP ++  +  L +
Sbjct: 177 PNGIGNLVELQRLSLRNNSLTGEIPSNFSHCRELRGLSLSFNQFTGGIPQAIGSLCNLEE 236

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGN------------------------SMTGQI 290
           L L+ N++TG IP  +G +  L+ L+L  N                        S+TG+I
Sbjct: 237 LYLAFNKLTGGIPREIGNLSKLNILQLSSNGISGPIPTEIFNISSLQEIDFSNNSLTGEI 296

Query: 291 PSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGH 470
           PS L     + +L+LS N F G IP   GS S    L LS+NKLTG +P  +     +  
Sbjct: 297 PSNLSHCRELRVLSLSFNQFTGGIPQAIGSLSNLEGLYLSYNKLTGGIPREIGNLSNLNI 356

Query: 471 LDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
           L + +N + G IP        L    FSNN
Sbjct: 357 LQLGSNGISGPIPAEIFNISSLQIIDFSNN 386

 Score =  105 bits (262), Expect = 3e-21
 Identities = 66/196 (33%), Positives = 93/196 (47%), Gaps = 4/196 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I +   L  L+L NN+++G +P     L KL    L  N+LIG IP  +  +  L  
Sbjct: 32  PKDIGKCKELQQLNLFNNKLVGGIPEAICNLSKLEELYLGNNELIGEIPKKMNHLQNLKV 91

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGT 359
           L   MN +TGSIP  +  +  L  + L  N+++G +P  +  +N  +  LNLS N   G 
Sbjct: 92  LSFPMNNLTGSIPATIFNISSLLNISLSNNNLSGSLPKDMCYANPKLKELNLSSNHLSGK 151

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDH--- 530
           IP   G      V+ L++N  TG +PN +     +  L + NN L G IP  S F H   
Sbjct: 152 IPTGLGQCIQLQVISLAYNDFTGSIPNGIGNLVELQRLSLRNNSLTGEIP--SNFSHCRE 209

Query: 531 LDAASFSNNDCLCGNP 578
           L   S S N    G P
Sbjct: 210 LRGLSLSFNQFTGGIP 225

 Score =  101 bits (252), Expect = 4e-20
 Identities = 57/170 (33%), Positives = 94/170 (55%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  IS L  +D SNN + GE+PS+    R+L    LS NQ  G IP ++  ++ L  
Sbjct: 273 PTEIFNISSLQEIDFSNNSLTGEIPSNLSHCRELRVLSLSFNQFTGGIPQAIGSLSNLEG 332

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N++TG IP  +G +  L+ L+L  N ++G IP+ + + + + I++ S N   G++
Sbjct: 333 LYLSYNKLTGGIPREIGNLSNLNILQLGSNGISGPIPAEIFNISSLQIIDFSNNSLSGSL 392

Query: 363 P-DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P D+         L L  N L+G++P +L+    + +L ++ N   G+IP
Sbjct: 393 PMDICKHLPNLQGLYLLQNHLSGQLPTTLSLCGELLYLSLAVNKFRGSIP 442

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 66/194 (34%), Positives = 93/194 (47%), Gaps = 2/194 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + +   L  + L+ N   G +P+  G L +L R  L  N L G IP +      L  
Sbjct: 153 PTGLGQCIQLQVISLAYNDFTGSIPNGIGNLVELQRLSLRNNSLTGEIPSNFSHCRELRG 212

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N+ TG IP  +G +  L  L L  N +TG IP  + + + + IL LS NG  G I
Sbjct: 213 LSLSFNQFTGGIPQAIGSLCNLEELYLAFNKLTGGIPREIGNLSKLNILQLSSNGISGPI 272

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLD 536
           P    + S    +D S N LTG +P++L+  + +  L +S N   G IP  IGS   +L+
Sbjct: 273 PTEIFNISSLQEIDFSNNSLTGEIPSNLSHCRELRVLSLSFNQFTGGIPQAIGS-LSNLE 331

Query: 537 AASFSNNDCLCGNP 578
               S N    G P
Sbjct: 332 GLYLSYNKLTGGIP 345

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 68/194 (35%), Positives = 89/194 (45%), Gaps = 25/194 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  IS L+++ LSNN + G LP D      KL    LS N L G IP  + +  +L 
Sbjct: 104 PATIFNISSLLNISLSNNNLSGSLPKDMCYANPKLKELNLSSNHLSGKIPTGLGQCIQLQ 163

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            + L+ N  TGSIP  +G +  L  L L  NS+TG+IPS       +  L+LS N F G 
Sbjct: 164 VISLAYNDFTGSIPNGIGNLVELQRLSLRNNSLTGEIPSNFSHCRELRGLSLSFNQFTGG 223

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG------------------------ 467
           IP   GS      L L+FNKLTG +P  +     +                         
Sbjct: 224 IPQAIGSLCNLEELYLAFNKLTGGIPREIGNLSKLNILQLSSNGISGPIPTEIFNISSLQ 283

Query: 468 HLDISNNHLCGNIP 509
            +D SNN L G IP
Sbjct: 284 EIDFSNNSLTGEIP 297

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 59/168 (35%), Positives = 83/168 (49%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9    SIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADL 185
            S+     L HL + +N   G LP+  G L   L     S  Q  GTIP  +  +  L +L
Sbjct: 596  SLTNCKFLRHLWIDDNPFKGTLPNSLGNLPIALESFTASACQFRGTIPTGIGNLTNLIEL 655

Query: 186  DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
            DL  N +T SIP  LG+++ L  L + GN + G IP+ L     +G L+L  N   G+IP
Sbjct: 656  DLGANDLTRSIPTTLGRLQKLQRLHIAGNRIRGSIPNDLCHLKNLGYLHLXSNKLSGSIP 715

Query: 366  DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              FG       L L  N L   +P SL   + +  L++S+N L GN+P
Sbjct: 716  SCFGDLPALQELFLDSNVLAFNIPTSLWSLRDLLVLNLSSNFLTGNLP 763

 Score = 93.6 bits (231), Expect = 1e-17
 Identities = 58/170 (34%), Positives = 83/170 (48%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +S L  L LS+N I G +P++   +  L     S N L G IP ++     L  
Sbjct: 249 PREIGNLSKLNILQLSSNGISGPIPTEIFNISSLQEIDFSNNSLTGEIPSNLSHCRELRV 308

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N+ TG IP  +G +  L  L L  N +TG IP  + + + + IL L  NG  G I
Sbjct: 309 LSLSFNQFTGGIPQAIGSLSNLEGLYLSYNKLTGGIPREIGNLSNLNILQLGSNGISGPI 368

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIP 509
           P    + S   ++D S N L+G +P  + K    +  L +  NHL G +P
Sbjct: 369 PAEIFNISSLQIIDFSNNSLSGSLPMDICKHLPNLQGLYLLQNHLSGQLP 418

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 50/171 (29%), Positives = 85/171 (49%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVR-ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           PM I + +  L  L L  N + G+LP+      +L    L+ N+  G+IP  +  +++L 
Sbjct: 393 PMDICKHLPNLQGLYLLQNHLSGQLPTTLSLCGELLYLSLAVNKFRGSIPREIGNLSKLE 452

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           D+ L  N + GSIP   G +  L  L L  N +TG +P  + + + + IL L +N   G+
Sbjct: 453 DISLRSNSLVGSIPTSFGNLMALKYLDLGMNFLTGTVPEAIFNISELQILVLVQNHLSGS 512

Query: 360 IPDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+       L +  NK +G +P S++    +  L + +N   GN+P
Sbjct: 513 LPPSIGTWLPDLEGLYIGSNKFSGTIPMSISNMSKLIQLQVWDNSFTGNVP 563

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 49/166 (29%), Positives = 80/166 (48%), Gaps = 1/166 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L+ LDLSNN     LP D GK ++L +  L  N+L+G IP+++  +++L +L     
Sbjct: 14  LSFLVSLDLSNNYFHDSLPKDIGKCKELQQLNLFNNKLVGGIPEAICNLSKLEEL----- 68

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
                               L  N + G+IP  +     + +L+   N   G+IP    +
Sbjct: 69  -------------------YLGNNELIGEIPKKMNHLQNLKVLSFPMNNLTGSIPATIFN 109

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAK-FMGHLDISNNHLCGNIPIG 515
            S  + + LS N L+G +P  +  A   +  L++S+NHL G IP G
Sbjct: 110 ISSLLNISLSNNNLSGSLPKDMCYANPKLKELNLSSNHLSGKIPTG 155

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 58/203 (28%), Positives = 89/203 (43%), Gaps = 34/203 (16%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
            P +I  IS L  L L  N + G LP   G  L  L    +  N+  GTIP S+  M++L 
Sbjct: 490  PEAIFNISELQILVLVQNHLSGSLPPSIGTWLPDLEGLYIGSNKFSGTIPMSISNMSKLI 549

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMT-------------------------- 281
             L +  N  TG++P  LG +  L  L L  N +T                          
Sbjct: 550  QLQVWDNSFTGNVPKDLGNLTKLEVLNLAANQLTNEHLASGVGFLTSLTNCKFLRHLWID 609

Query: 282  -----GQIPSTLLSNTGMGILNLSRNG--FEGTIPDVFGSKSYFMVLDLSFNKLTGRVPN 440
                 G +P++ L N  + + + + +   F GTIP   G+ +  + LDL  N LT  +P 
Sbjct: 610  DNPFKGTLPNS-LGNLPIALESFTASACQFRGTIPTGIGNLTNLIELDLGANDLTRSIPT 668

Query: 441  SLAKAKFMGHLDISNNHLCGNIP 509
            +L + + +  L I+ N + G+IP
Sbjct: 669  TLGRLQKLQRLHIAGNRIRGSIP 691

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 41/126 (32%), Positives = 61/126 (48%)
 Frame = +3

Query: 132 LIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN 311
           L GTI   V  ++ L  LDLS N    S+P  +GK + L  L L  N + G IP  + + 
Sbjct: 3   LEGTIAPQVGNLSFLVSLDLSNNYFHDSLPKDIGKCKELQQLNLFNNKLVGGIPEAICNL 62

Query: 312 TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
           + +  L L  N   G IP          VL    N LTG +P ++     + ++ +SNN+
Sbjct: 63  SKLEELYLGNNELIGEIPKKMNHLQNLKVLSFPMNNLTGSIPATIFNISSLLNISLSNNN 122

Query: 492 LCGNIP 509
           L G++P
Sbjct: 123 LSGSLP 128

[58][TOP]
>UniRef100_UPI0001985E6B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001985E6B
          Length = 697

 Score =  130 bits (327), Expect = 7e-29
 Identities = 74/163 (45%), Positives = 102/163 (62%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L +LDLS+NQ+ G +P   GK+  LS   LS NQL G+IPD+V KM  L+ LDLS+N
Sbjct: 1   MSSLEYLDLSSNQLQGSIPDTVGKMVLLSHLDLSFNQLQGSIPDTVRKMVLLSHLDLSVN 60

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           ++ GSIP  +GKM +LS L L  N + G IP T+     +  L LS N  +G+IPD  G+
Sbjct: 61  QLQGSIPDTVGKMVLLSHLDLVVNQLQGSIPDTVGKMVLLSHLFLSYNQLQGSIPDTVGN 120

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                 LDLS N+L G +P+++     + HLD+S N L G+IP
Sbjct: 121 MVLLSHLDLSSNQLRGSIPDTVGNMVLLSHLDLSRNQLQGSIP 163

 Score =  119 bits (299), Expect = 1e-25
 Identities = 72/169 (42%), Positives = 101/169 (59%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++ ++  L HLDLS NQ+ G +P    K+  LS   LS NQL G+IPD+V KM  L+ 
Sbjct: 19  PDTVGKMVLLSHLDLSFNQLQGSIPDTVRKMVLLSHLDLSVNQLQGSIPDTVGKMVLLSH 78

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL +N++ GSIP  +GKM +LS L L  N + G IP T+ +   +  L+LS N   G+I
Sbjct: 79  LDLVVNQLQGSIPDTVGKMVLLSHLFLSYNQLQGSIPDTVGNMVLLSHLDLSSNQLRGSI 138

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           PD  G+      LDLS N+L G +P ++     + +L +S NHL G IP
Sbjct: 139 PDTVGNMVLLSHLDLSRNQLQGSIPYTVGNMVSLENLYLSQNHLQGEIP 187

 Score =  110 bits (275), Expect = 8e-23
 Identities = 73/188 (38%), Positives = 103/188 (54%), Gaps = 3/188 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++ ++  L HLDLS NQ+ G +P   GK+  LS   L  NQL G+IPD+V KM  L+ 
Sbjct: 43  PDTVRKMVLLSHLDLSVNQLQGSIPDTVGKMVLLSHLDLVVNQLQGSIPDTVGKMVLLSH 102

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N++ GSIP  +G M +LS L L  N + G IP T+ +   +  L+LSRN  +G+I
Sbjct: 103 LFLSYNQLQGSIPDTVGNMVLLSHLDLSSNQLRGSIPDTVGNMVLLSHLDLSRNQLQGSI 162

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP---IGSPFDHL 533
           P   G+      L LS N L G +P SL+    +  L +  N+L G +    +    D L
Sbjct: 163 PYTVGNMVSLENLYLSQNHLQGEIPKSLSNLCNLQALKLDRNNLSGQLAPDFVACANDTL 222

Query: 534 DAASFSNN 557
              S S+N
Sbjct: 223 KTLSLSDN 230

 Score = 84.0 bits (206), Expect = 8e-15
 Identities = 60/200 (30%), Positives = 91/200 (45%), Gaps = 24/200 (12%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  LD+SN++I   LP  F  +      L +S N++ GT+P+      R +++D+S N  
Sbjct: 312 LSELDISNSEISDVLPDWFWNVTSTVNTLSISNNRIKGTLPNLSSTFERFSNIDMSSNCF 371

Query: 207 TGSIP--------VRLGKMRV-------------LSTLKLDGNSMTGQIPSTLLSNTGMG 323
            GSIP        + L   ++             L  L L  NS++G +P+       + 
Sbjct: 372 EGSIPQLPYDVQWLDLSNNKLSRSISLLCTVGTELLLLDLSNNSLSGGLPNCWAQWKSLA 431

Query: 324 ILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGN 503
           +LNL  N F G IP+ FGS      L L  N LTG +P S      +  +D++ N L G 
Sbjct: 432 VLNLENNRFSGQIPNSFGSLRSIRTLHLRNNNLTGELPLSFKNCTSLRFIDLAKNRLSGK 491

Query: 504 IP--IGSPFDHLDAASFSNN 557
           IP  IG    +L   +  +N
Sbjct: 492 IPEWIGGSLPNLIVLNLGSN 511

 Score = 79.0 bits (193), Expect = 3e-13
 Identities = 49/161 (30%), Positives = 84/161 (52%), Gaps = 1/161 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L+ LDLSNN + G LP+ + + +                         LA L+L  NR +
Sbjct: 406 LLLLDLSNNSLSGGLPNCWAQWKS------------------------LAVLNLENNRFS 441

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD-VFGSKS 386
           G IP   G +R + TL L  N++TG++P +  + T +  ++L++N   G IP+ + GS  
Sbjct: 442 GQIPNSFGSLRSIRTLHLRNNNLTGELPLSFKNCTSLRFIDLAKNRLSGKIPEWIGGSLP 501

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             +VL+L  N+ +G +   L + K +  LD+S+N++ G +P
Sbjct: 502 NLIVLNLGSNRFSGGISPKLCQLKNIQILDLSSNNMLGVVP 542

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 33/83 (39%), Positives = 52/83 (62%)
 Frame = +3

Query: 117 LSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS 296
           LS N+L G IP+ V+ +  L  L+LS N +T  IP R+G+++ L  L L  N + G+IP+
Sbjct: 610 LSSNKLSGEIPEEVIDLVELVSLNLSRNNLTRLIPARIGQLKSLEVLDLSRNQLFGEIPA 669

Query: 297 TLLSNTGMGILNLSRNGFEGTIP 365
           +L+  + + +L+LS N   G IP
Sbjct: 670 SLVEISDLSVLDLSDNNLSGKIP 692

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 48/175 (27%), Positives = 85/175 (48%), Gaps = 6/175 (3%)
 Frame = +3

Query: 12   IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSR--ALLSRNQLIGTIPDSVLKMNRLADL 185
            + ++  +  LDLS+N ++G +P   G    +++  +L+  +    T  D+    N +   
Sbjct: 521  LCQLKNIQILDLSSNNMLGVVPRCVGSFIAMTKKGSLVIAHNYSFTDYDNCSYFNCMPTN 580

Query: 186  DLSMNRITGSIPVR----LGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
               ++R       R       + ++ ++ L  N ++G+IP  ++    +  LNLSRN   
Sbjct: 581  ASYVDRALVKWKAREFDFKSTLGLVKSIDLSSNKLSGEIPEEVIDLVELVSLNLSRNNLT 640

Query: 354  GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGS 518
              IP   G      VLDLS N+L G +P SL +   +  LD+S+N+L G IP G+
Sbjct: 641  RLIPARIGQLKSLEVLDLSRNQLFGEIPASLVEISDLSVLDLSDNNLSGKIPQGT 695

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 49/188 (26%), Positives = 90/188 (47%), Gaps = 22/188 (11%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           +  +S L +L+LS N +   +  ++    +L   L +  +L    P  +   NRL++LD+
Sbjct: 258 LFNLSQLSYLNLSPNSLTFNMSLEWVPPFQLFDLLSASCKLGPHFPSWLRTQNRLSELDI 317

Query: 192 SMNRITGSIPVRLGKMR-VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP- 365
           S + I+  +P     +   ++TL +  N + G +P+   +      +++S N FEG+IP 
Sbjct: 318 SNSEISDVLPDWFWNVTSTVNTLSISNNRIKGTLPNLSSTFERFSNIDMSSNCFEGSIPQ 377

Query: 366 --------DVFGSK------------SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISN 485
                   D+  +K            +  ++LDLS N L+G +PN  A+ K +  L++ N
Sbjct: 378 LPYDVQWLDLSNNKLSRSISLLCTVGTELLLLDLSNNSLSGGLPNCWAQWKSLAVLNLEN 437

Query: 486 NHLCGNIP 509
           N   G IP
Sbjct: 438 NRFSGQIP 445

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 57/224 (25%), Positives = 87/224 (38%), Gaps = 55/224 (24%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSV-LKMNRLA 179
            P S   +  +  L L NN + GELP  F     L    L++N+L G IP+ +   +  L 
Sbjct: 445  PNSFGSLRSIRTLHLRNNNLTGELPLSFKNCTSLRFIDLAKNRLSGKIPEWIGGSLPNLI 504

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIP---STLLSNTGMGIL------- 329
             L+L  NR +G I  +L +++ +  L L  N+M G +P    + ++ T  G L       
Sbjct: 505  VLNLGSNRFSGGISPKLCQLKNIQILDLSSNNMLGVVPRCVGSFIAMTKKGSLVIAHNYS 564

Query: 330  --------------------------------------------NLSRNGFEGTIPDVFG 377
                                                        +LS N   G IP+   
Sbjct: 565  FTDYDNCSYFNCMPTNASYVDRALVKWKAREFDFKSTLGLVKSIDLSSNKLSGEIPEEVI 624

Query: 378  SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                 + L+LS N LT  +P  + + K +  LD+S N L G IP
Sbjct: 625  DLVELVSLNLSRNNLTRLIPARIGQLKSLEVLDLSRNQLFGEIP 668

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 29/73 (39%), Positives = 47/73 (64%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  ++ +  L+ L+LS N +   +P+  G+L+ L    LSRNQL G IP S+++++ L+ 
Sbjct: 620 PEEVIDLVELVSLNLSRNNLTRLIPARIGQLKSLEVLDLSRNQLFGEIPASLVEISDLSV 679

Query: 183 LDLSMNRITGSIP 221
           LDLS N ++G IP
Sbjct: 680 LDLSDNNLSGKIP 692

[59][TOP]
>UniRef100_B9T577 Serine-threonine protein kinase, plant-type, putative n=1
           Tax=Ricinus communis RepID=B9T577_RICCO
          Length = 843

 Score =  130 bits (327), Expect = 7e-29
 Identities = 72/191 (37%), Positives = 110/191 (57%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +S L  L LSNN + G LP+ FG L  L    L  N     IP S+  +  + +
Sbjct: 287 PTDICHLSNLGELFLSNNSLFGPLPACFGDLISLRILHLHSNNFTSGIPFSLWSLKDVLE 346

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LS N ++G IP+ +G ++VL+ +    NS++G IP+ + S   +  L+L+ N FEG I
Sbjct: 347 LNLSSNSLSGHIPLSIGNLKVLTQVDFSYNSLSGIIPNAIGSLRNLMSLSLTHNRFEGPI 406

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P+ FG       LDLS N L+G++P SL + K++ +L++S N+L G +P    F +  A+
Sbjct: 407 PEPFGELISLESLDLSSNNLSGKIPKSLEQLKYLKYLNVSFNNLDGEVPNKGAFANFSAS 466

Query: 543 SFSNNDCLCGN 575
           SF  N  LCG+
Sbjct: 467 SFLGNLALCGS 477

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 55/168 (32%), Positives = 82/168 (48%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S+ R   L  L L  N +   LP+  G L  +    +    + G IP  +  ++ L  L 
Sbjct: 193 SLARCKELRRLVLIGNPLNSTLPTSIGNLSSIEYFNVQSCNIKGNIPSEIGVLSNLITLH 252

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           L  N + GSIPV +G ++ L  L L GN + G IP+ +   + +G L LS N   G +P 
Sbjct: 253 LQNNELVGSIPVTIGGLQKLQRLYLHGNLLYGSIPTDICHLSNLGELFLSNNSLFGPLPA 312

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
            FG      +L L  N  T  +P SL   K +  L++S+N L G+IP+
Sbjct: 313 CFGDLISLRILHLHSNNFTSGIPFSLWSLKDVLELNLSSNSLSGHIPL 360

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 59/174 (33%), Positives = 89/174 (51%), Gaps = 2/174 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +S + + ++ +  I G +PS+ G L  L    L  N+L+G+IP ++  + +L  
Sbjct: 215 PTSIGNLSSIEYFNVQSCNIKGNIPSEIGVLSNLITLHLQNNELVGSIPVTIGGLQKLQR 274

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N + GSIP  +  +  L  L L  NS+ G +P+       + IL+L  N F   I
Sbjct: 275 LYLHGNLLYGSIPTDICHLSNLGELFLSNNSLFGPLPACFGDLISLRILHLHSNNFTSGI 334

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS 518
           P    S    + L+LS N L+G +P S+   K +  +D S N L G IP  IGS
Sbjct: 335 PFSLWSLKDVLELNLSSNSLSGHIPLSIGNLKVLTQVDFSYNSLSGIIPNAIGS 388

 Score = 87.0 bits (214), Expect = 9e-16
 Identities = 58/178 (32%), Positives = 83/178 (46%), Gaps = 25/178 (14%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L +  N   GE+P D G L  +    +  N   GTIP S+     +  L L  N +T
Sbjct: 5   LQLLSILLNNFAGEIPVDIGSLHAVELFRIRGNDFNGTIPKSLFNCTSMRHLSLGGNSLT 64

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLL--------------------SNTGMGIL 329
           G IP  +GK+  L  L L  N +TG IPSTLL                    S  G G+ 
Sbjct: 65  GPIPTEIGKLSNLVHLLLRYNFLTGSIPSTLLNISAIKTISINVNQLSGHLPSTLGYGLP 124

Query: 330 NL-----SRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNN 488
           NL     +RN F GT+P    + S   +L+ S N L+G +P++L   K +  L++++N
Sbjct: 125 NLEELYITRNQFIGTLPPSISNASKLTILESSSNSLSGPIPDTLCNLKNLKRLNLADN 182

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 50/172 (29%), Positives = 87/172 (50%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+   + + HL L  N + G +P++ GKL  L   LL  N L G+IP ++L ++ +  
Sbjct: 44  PKSLFNCTSMRHLSLGGNSLTGPIPTEIGKLSNLVHLLLRYNFLTGSIPSTLLNISAIKT 103

Query: 183 LDLSMNRITGSIPVRLG-KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           + +++N+++G +P  LG  +  L  L +  N   G +P ++ + + + IL  S N   G 
Sbjct: 104 ISINVNQLSGHLPSTLGYGLPNLEELYITRNQFIGTLPPSISNASKLTILESSSNSLSGP 163

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
           IPD   +      L+L+ N  T  +    SLA+ K +  L +  N L   +P
Sbjct: 164 IPDTLCNLKNLKRLNLADNSFTDELGFLASLARCKELRRLVLIGNPLNSTLP 215

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 36/109 (33%), Positives = 56/109 (51%)
 Frame = +3

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L + +N   G IPV +G +  +   ++ GN   G IP +L + T M  L+L  N   G I
Sbjct: 8   LSILLNNFAGEIPVDIGSLHAVELFRIRGNDFNGTIPKSLFNCTSMRHLSLGGNSLTGPI 67

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G  S  + L L +N LTG +P++L     +  + I+ N L G++P
Sbjct: 68  PTEIGKLSNLVHLLLRYNFLTGSIPSTLLNISAIKTISINVNQLSGHLP 116

[60][TOP]
>UniRef100_UPI00019844B5 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
            RepID=UPI00019844B5
          Length = 1193

 Score =  129 bits (325), Expect = 1e-28
 Identities = 76/192 (39%), Positives = 104/192 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  ++ L  LDLS+N++ G +PS FG L  L R  L  N L   IP S+  +  L  
Sbjct: 640  PSDLCHLTNLGFLDLSSNKLSGTIPSCFGNLTSLRRINLHSNGLASEIPSSLWILRYLLF 699

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N + G +P+ +G M+ L  L L  N  +G IPST+     +  L LS N  +G I
Sbjct: 700  LNLSSNFLNGELPLEVGNMKSLEELDLSKNQFSGNIPSTISLLQNLLQLYLSHNKLQGHI 759

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  F        LDLS N L+G +P SL   K++ +L++S N L G IP G PF +  A 
Sbjct: 760  PPNFDDLVSLEYLDLSGNNLSGFIPKSLEALKYLKYLNVSFNKLQGEIPNGGPFANFTAE 819

Query: 543  SFSNNDCLCGNP 578
            SF +N  LCG P
Sbjct: 820  SFISNLALCGAP 831

 Score = 97.4 bits (241), Expect = 7e-19
 Identities = 65/189 (34%), Positives = 90/189 (47%), Gaps = 3/189 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  IS L  +  SNN + G LP D  K L  L R  LS NQL G +P ++     L 
Sbjct: 294 PAQIFNISSLQVIAFSNNSLSGSLPIDICKHLPNLQRLHLSWNQLSGQLPTTLSLCGELL 353

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N+  GSI   +G +  L  + L  N+ T  IP +  + T +  L L  N F+G 
Sbjct: 354 SLSLYYNKYAGSIIREIGNLSKLEQIYLGRNNFTSTIPPSFGNLTAIQELGLEENNFQGN 413

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHL 533
           IP   G      +L L  N LTG VP ++     +  L +S NHL G++P  IG+   +L
Sbjct: 414 IPKELGKLINLQILHLGQNNLTGIVPEAIINISKLQVLSLSLNHLSGSLPSSIGTWLPNL 473

Query: 534 DAASFSNND 560
           +      N+
Sbjct: 474 EGLYIGANE 482

 Score = 96.3 bits (238), Expect = 2e-18
 Identities = 57/169 (33%), Positives = 88/169 (52%), Gaps = 1/169 (0%)
 Frame = +3

Query: 9    SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRN-QLIGTIPDSVLKMNRLADL 185
            S+     L  L +  N + G +P+  G L      + +R+ QL GTIP  V  +  L  L
Sbjct: 545  SLTNCISLRKLRIGGNPLKGIIPNSLGNLSISIERIGARSCQLRGTIPTGVSNLTNLIGL 604

Query: 186  DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
             L  N +TG IP   G+++ L  L +  N + G IPS L   T +G L+LS N   GTIP
Sbjct: 605  GLDDNDLTGLIPTSFGRLQKLQALGISQNRIRGSIPSDLCHLTNLGFLDLSSNKLSGTIP 664

Query: 366  DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
              FG+ +    ++L  N L   +P+SL   +++  L++S+N L G +P+
Sbjct: 665  SCFGNLTSLRRINLHSNGLASEIPSSLWILRYLLFLNLSSNFLNGELPL 713

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 54/159 (33%), Positives = 79/159 (49%), Gaps = 1/159 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L+ LDLSNN ++G +P     L KL    L  N+L G IP  +  +  L  L   MN
Sbjct: 14  LSFLISLDLSNNNLVGSIPEAICNLSKLEELYLGNNKLAGEIPKKMSDLLNLKILSFPMN 73

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLL-SNTGMGILNLSRNGFEGTIPDVFG 377
            +TGSIP  +  +  L  + L  NS++G +P  +  +N  +  LNLS N   G IP    
Sbjct: 74  NLTGSIPATIFNISSLLNISLSYNSLSGNLPMVMCNTNPKLKELNLSSNHLSGEIPTSLS 133

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHL 494
                 V+ LS+N+ TG +P  +     +  L   NN+L
Sbjct: 134 QCIKLQVISLSYNEFTGSIPKGIGNLVELQRLSFRNNNL 172

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 53/170 (31%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++     L+ L L  N+  G +  + G L KL +  L RN    TIP S   +  + +
Sbjct: 343 PTTLSLCGELLSLSLYYNKYAGSIIREIGNLSKLEQIYLGRNNFTSTIPPSFGNLTAIQE 402

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N   G+IP  LGK+  L  L L  N++TG +P  +++ + + +L+LS N   G++
Sbjct: 403 LGLEENNFQGNIPKELGKLINLQILHLGQNNLTGIVPEAIINISKLQVLSLSLNHLSGSL 462

Query: 363 PDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+       L +  N+ +G++P S++    +  +DISNN+  GN+P
Sbjct: 463 PSSIGTWLPNLEGLYIGANEFSGKIPMSISNMSKLLFMDISNNYFIGNLP 512

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 52/169 (30%), Positives = 91/169 (53%), Gaps = 1/169 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  IS L  L+L+ NQ+ GE+PS+    R+L    LS NQ  G IP ++  ++ L +
Sbjct: 198 PQSLFNISSLRFLNLAANQLEGEIPSNLSHCRELRVLSLSLNQFTGGIPQAIGSLSNLEE 257

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N + G IP  +G +  L+ L  +   ++G IP+ + + + + ++  S N   G++
Sbjct: 258 LYLGYNNLGGGIPSEIGNLHNLNILNFESARLSGPIPAQIFNISSLQVIAFSNNSLSGSL 317

Query: 363 P-DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P D+         L LS+N+L+G++P +L+    +  L +  N   G+I
Sbjct: 318 PIDICKHLPNLQRLHLSWNQLSGQLPTTLSLCGELLSLSLYYNKYAGSI 366

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 55/151 (36%), Positives = 74/151 (49%)
 Frame = +3

Query: 57   QIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGK 236
            Q+ G +P+    L  L    L  N L G IP S  ++ +L  L +S NRI GSIP  L  
Sbjct: 586  QLRGTIPTGVSNLTNLIGLGLDDNDLTGLIPTSFGRLQKLQALGISQNRIRGSIPSDLCH 645

Query: 237  MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFN 416
            +  L  L L  N ++G IPS   + T +  +NL  NG    IP       Y + L+LS N
Sbjct: 646  LTNLGFLDLSSNKLSGTIPSCFGNLTSLRRINLHSNGLASEIPSSLWILRYLLFLNLSSN 705

Query: 417  KLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             L G +P  +   K +  LD+S N   GNIP
Sbjct: 706  FLNGELPLEVGNMKSLEELDLSKNQFSGNIP 736

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 52/169 (30%), Positives = 89/169 (52%), Gaps = 2/169 (1%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRV 245
           G +    G L  L    LS N L+G+IP+++  +++L +L L  N++ G IP ++  +  
Sbjct: 5   GTIAPQVGNLSFLISLDLSNNNLVGSIPEAICNLSKLEELYLGNNKLAGEIPKKMSDLLN 64

Query: 246 LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVF-GSKSYFMVLDLSFNKL 422
           L  L    N++TG IP+T+ + + +  ++LS N   G +P V   +      L+LS N L
Sbjct: 65  LKILSFPMNNLTGSIPATIFNISSLLNISLSYNSLSGNLPMVMCNTNPKLKELNLSSNHL 124

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSNNDCL 566
           +G +P SL++   +  + +S N   G+IP G      L   SF NN+ +
Sbjct: 125 SGEIPTSLSQCIKLQVISLSYNEFTGSIPKGIGNLVELQRLSFRNNNLI 173

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 56/191 (29%), Positives = 90/191 (47%), Gaps = 22/191 (11%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  +S L  L L NN++ GE+P     L  L       N L G+IP ++  ++ L +
Sbjct: 32  PEAICNLSKLEELYLGNNKLAGEIPKKMSDLLNLKILSFPMNNLTGSIPATIFNISSLLN 91

Query: 183 LDLSMNRITGSIP-VRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           + LS N ++G++P V       L  L L  N ++G+IP++L     + +++LS N F G+
Sbjct: 92  ISLSYNSLSGNLPMVMCNTNPKLKELNLSSNHLSGEIPTSLSQCIKLQVISLSYNEFTGS 151

Query: 360 IPDVFG-----------SKSYFMVLDLS----------FNKLTGRVPNSLAKAKFMGHLD 476
           IP   G           + +     D+S          FN L G +P SL     +  L+
Sbjct: 152 IPKGIGNLVELQRLSFRNNNLIAFKDVSNALKFFQPTHFNFLAGEIPQSLFNISSLRFLN 211

Query: 477 ISNNHLCGNIP 509
           ++ N L G IP
Sbjct: 212 LAANQLEGEIP 222

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 55/191 (28%), Positives = 82/191 (42%), Gaps = 21/191 (10%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLI--------------- 137
           P S+ +   L  + LS N+  G +P   G L +L R     N LI               
Sbjct: 129 PTSLSQCIKLQVISLSYNEFTGSIPKGIGNLVELQRLSFRNNNLIAFKDVSNALKFFQPT 188

Query: 138 ------GTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPST 299
                 G IP S+  ++ L  L+L+ N++ G IP  L   R L  L L  N  TG IP  
Sbjct: 189 HFNFLAGEIPQSLFNISSLRFLNLAANQLEGEIPSNLSHCRELRVLSLSLNQFTGGIPQA 248

Query: 300 LLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDI 479
           + S + +  L L  N   G IP   G+     +L+    +L+G +P  +     +  +  
Sbjct: 249 IGSLSNLEELYLGYNNLGGGIPSEIGNLHNLNILNFESARLSGPIPAQIFNISSLQVIAF 308

Query: 480 SNNHLCGNIPI 512
           SNN L G++PI
Sbjct: 309 SNNSLSGSLPI 319

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 50/153 (32%), Positives = 73/153 (47%), Gaps = 1/153 (0%)
 Frame = +3

Query: 54  NQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLG 233
           N + GE+P     +  L    L+ NQL G IP ++     L  L LS+N+ TG IP  +G
Sbjct: 191 NFLAGEIPQSLFNISSLRFLNLAANQLEGEIPSNLSHCRELRVLSLSLNQFTGGIPQAIG 250

Query: 234 KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSF 413
            +  L  L L  N++ G IPS + +   + ILN       G IP    + S   V+  S 
Sbjct: 251 SLSNLEELYLGYNNLGGGIPSEIGNLHNLNILNFESARLSGPIPAQIFNISSLQVIAFSN 310

Query: 414 NKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIP 509
           N L+G +P  + K    +  L +S N L G +P
Sbjct: 311 NSLSGSLPIDICKHLPNLQRLHLSWNQLSGQLP 343

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 48/145 (33%), Positives = 71/145 (48%), Gaps = 2/145 (1%)
 Frame = +3

Query: 132 LIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN 311
           L GTI   V  ++ L  LDLS N + GSIP  +  +  L  L L  N + G+IP  +   
Sbjct: 3   LEGTIAPQVGNLSFLISLDLSNNNLVGSIPEAICNLSKLEELYLGNNKLAGEIPKKMSDL 62

Query: 312 TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAK-FMGHLDISNN 488
             + IL+   N   G+IP    + S  + + LS+N L+G +P  +      +  L++S+N
Sbjct: 63  LNLKILSFPMNNLTGSIPATIFNISSLLNISLSYNSLSGNLPMVMCNTNPKLKELNLSSN 122

Query: 489 HLCGNIPIG-SPFDHLDAASFSNND 560
           HL G IP   S    L   S S N+
Sbjct: 123 HLSGEIPTSLSQCIKLQVISLSYNE 147

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 56/222 (25%), Positives = 89/222 (40%), Gaps = 36/222 (16%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P S   ++ +  L L  N   G +P + GKL  L    L +N L G +P++++ +++L  
Sbjct: 391  PPSFGNLTAIQELGLEENNFQGNIPKELGKLINLQILHLGQNNLTGIVPEAIINISKLQV 450

Query: 183  LDLSMNRITGS-------------------------IPVRLGKMRVLSTLKLDGNSMTGQ 287
            L LS+N ++GS                         IP+ +  M  L  + +  N   G 
Sbjct: 451  LSLSLNHLSGSLPSSIGTWLPNLEGLYIGANEFSGKIPMSISNMSKLLFMDISNNYFIGN 510

Query: 288  IPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLD---------LSFNKLTGRVPN 440
            +P  L +   + ILNLS N       D     ++F  L          +  N L G +PN
Sbjct: 511  LPKDLGNMRRLQILNLSYNQLTNEQSD--SELAFFTSLTNCISLRKLRIGGNPLKGIIPN 568

Query: 441  SLAKAKF-MGHLDISNNHLCGNIPIG-SPFDHLDAASFSNND 560
            SL      +  +   +  L G IP G S   +L      +ND
Sbjct: 569  SLGNLSISIERIGARSCQLRGTIPTGVSNLTNLIGLGLDDND 610

[61][TOP]
>UniRef100_Q7EZN6 Putative uncharacterized protein OJ1005_B10.16 n=1 Tax=Oryza sativa
           Japonica Group RepID=Q7EZN6_ORYSJ
          Length = 996

 Score =  129 bits (325), Expect = 1e-28
 Identities = 71/191 (37%), Positives = 111/191 (58%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  ++ L+ LDLSNNQ+ G +P   G + +L+   LS N+L+ +IPD +  +  L D
Sbjct: 419 PFSIGNLTQLLTLDLSNNQLNGSIPKSLGSMERLTNLDLSSNRLVESIPDVIFSLPSLTD 478

Query: 183 -LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L LS N ++G++P ++G +R  +TL L  N+++G+IP+TL     +  L L  N F G+
Sbjct: 479 SLLLSDNYLSGALPPKVGNLRRATTLSLSRNNLSGKIPTTLGDCASLVYLALDSNHFTGS 538

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
           IP   G+     +L+L+ N L+G +P  L K+  +  LD+S NHL G +P    F ++  
Sbjct: 539 IPPSLGNLRGLSILNLTRNALSGTIPQFLEKSSALIELDLSYNHLSGEVPSHGLFANMSG 598

Query: 540 ASFSNNDCLCG 572
            S   N  LCG
Sbjct: 599 FSVLGNYALCG 609

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 55/162 (33%), Positives = 89/162 (54%), Gaps = 2/162 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKL-RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  +DLS+N + G LPS    L R +    +++NQ+ G IP  +  +  + DL+   N +
Sbjct: 331 LQVIDLSDNTLGGILPSFIANLSRSIQWLSMAKNQISGIIPPGIGSLKGIEDLEFQGNNL 390

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
            G IP  +G++R L  L L+ N+M+G IP ++ + T +  L+LS N   G+IP   GS  
Sbjct: 391 FGDIPGDIGRLRNLKVLWLNMNNMSGGIPFSIGNLTQLLTLDLSNNQLNGSIPKSLGSME 450

Query: 387 YFMVLDLSFNKLTGRVPNSL-AKAKFMGHLDISNNHLCGNIP 509
               LDLS N+L   +P+ + +       L +S+N+L G +P
Sbjct: 451 RLTNLDLSSNRLVESIPDVIFSLPSLTDSLLLSDNYLSGALP 492

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 51/172 (29%), Positives = 84/172 (48%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ +   S L+ L +  N++ G +PS  G L +L    L  N L GT+P S+  +  L  
Sbjct: 122 PVGLCNCSNLVFLSVEANELHGAIPSCLGSLLQLKVLYLGENNLTGTVPPSLGNLTMLLQ 181

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           + L  N++ G+IP  L  +R L  ++   NS++G +P    + + +  L  S N   G +
Sbjct: 182 IALYQNQLEGTIPEGLSGLRYLQYIQASRNSLSGTLPPLFFNISSLQYLGFSSNKLHGRL 241

Query: 363 PDVFGSK-SYFMVLDLS--FNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G++     VL L    N  +G +P SL+ A  +  L ++ N   G IP
Sbjct: 242 PPDAGTRLPNLQVLRLGGIGNNFSGTIPASLSNATEIQVLGLARNSFEGRIP 293

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 62/204 (30%), Positives = 96/204 (47%), Gaps = 33/204 (16%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ L+ + L  NQ+ G +P     LR L     SRN L GT+P     ++ L  
Sbjct: 170 PPSLGNLTMLLQIALYQNQLEGTIPEGLSGLRYLQYIQASRNSLSGTLPPLFFNISSLQY 229

Query: 183 LDLSMNRITGSIPVRLG-KMRVLSTLKLDG--NSMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L  S N++ G +P   G ++  L  L+L G  N+ +G IP++L + T + +L L+RN FE
Sbjct: 230 LGFSSNKLHGRLPPDAGTRLPNLQVLRLGGIGNNFSGTIPASLSNATEIQVLGLARNSFE 289

Query: 354 GTIPDVFGS-----------------------KSYF------MVLDLSFNKLTGRVPNSL 446
           G IP   G                          YF       V+DLS N L G +P+ +
Sbjct: 290 GRIPPEIGKLCPVSVQMGSNKLQANDAGDWEFLRYFTNCTRLQVIDLSDNTLGGILPSFI 349

Query: 447 AK-AKFMGHLDISNNHLCGNIPIG 515
           A  ++ +  L ++ N + G IP G
Sbjct: 350 ANLSRSIQWLSMAKNQISGIIPPG 373

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 48/145 (33%), Positives = 70/145 (48%), Gaps = 3/145 (2%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGE---LPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           I  ++ L  LDL NN + G+   LP        L    +  N+L G IP  +  + +L  
Sbjct: 98  IGNLTFLQSLDLFNNTLSGDGGDLPVGLCNCSNLVFLSVEANELHGAIPSCLGSLLQLKV 157

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N +TG++P  LG + +L  + L  N + G IP  L     +  +  SRN   GT+
Sbjct: 158 LYLGENNLTGTVPPSLGNLTMLLQIALYQNQLEGTIPEGLSGLRYLQYIQASRNSLSGTL 217

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVP 437
           P +F + S    L  S NKL GR+P
Sbjct: 218 PPLFFNISSLQYLGFSSNKLHGRLP 242

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 48/160 (30%), Positives = 75/160 (46%), Gaps = 3/160 (1%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGT---IPDSVLKMNRLADLDLSMNRIT 209
           L+LS+  + G +    G L  L    L  N L G    +P  +   + L  L +  N + 
Sbjct: 83  LNLSSLGLAGSISPVIGNLTFLQSLDLFNNTLSGDGGDLPVGLCNCSNLVFLSVEANELH 142

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G+IP  LG +  L  L L  N++TG +P +L + T +  + L +N  EGTIP+      Y
Sbjct: 143 GAIPSCLGSLLQLKVLYLGENNLTGTVPPSLGNLTMLLQIALYQNQLEGTIPEGLSGLRY 202

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              +  S N L+G +P        + +L  S+N L G +P
Sbjct: 203 LQYIQASRNSLSGTLPPLFFNISSLQYLGFSSNKLHGRLP 242

[62][TOP]
>UniRef100_UPI0001984497 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
            RepID=UPI0001984497
          Length = 1475

 Score =  129 bits (324), Expect = 2e-28
 Identities = 75/192 (39%), Positives = 105/192 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  + R+  L +L LS+NQ+ G +PS  G L  L    L  N L   IP S+  +  L  
Sbjct: 925  PNDLCRLKNLGYLFLSSNQLTGSIPSCLGYLPPLRELYLHSNALASNIPPSLWTLRGLLV 984

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N +TG +P  +G ++ + TL L  N ++G IP TL     +  L+LS+N  +G I
Sbjct: 985  LNLSSNFLTGHLPPEVGNIKSIRTLDLSKNQVSGHIPRTLGELQNLEDLSLSQNRLQGPI 1044

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  FG       LDLS N L+G +P SL    ++ +L++S N L G IP G PF +  A 
Sbjct: 1045 PLEFGDLLSLKFLDLSQNNLSGVIPKSLKALTYLKYLNVSFNKLQGEIPDGGPFMNFTAE 1104

Query: 543  SFSNNDCLCGNP 578
            SF  N+ LCG P
Sbjct: 1105 SFIFNEALCGAP 1116

 Score =  118 bits (296), Expect = 3e-25
 Identities = 62/164 (37%), Positives = 96/164 (58%), Gaps = 1/164 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L+ LDLSNN     LP D GK ++L +  L  N+L+G+IP+++  +++L +L L  N
Sbjct: 74  LSFLVSLDLSNNYFHASLPKDIGKCKELQQLNLFNNKLVGSIPEAICNLSKLEELYLGNN 133

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLL-SNTGMGILNLSRNGFEGTIPDVFG 377
           ++TG IP     +R L  L L  N++TG IP+T+  +N  +  LNL+ N   G IP   G
Sbjct: 134 QLTGEIPKTFSHLRNLKILSLRMNNLTGSIPATIFNTNPNLKELNLTSNNLSGKIPTSLG 193

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             +   V+ LS+N+LTG +P ++     +  L + NN L G IP
Sbjct: 194 QCTKLQVISLSYNELTGSMPRAIGNLVELQRLSLLNNSLTGEIP 237

 Score =  103 bits (258), Expect = 7e-21
 Identities = 73/220 (33%), Positives = 103/220 (46%), Gaps = 28/220 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMN---- 170
           P +I  +S L  L L NNQ+ GE+P  F  LR L    L  N L G+IP ++   N    
Sbjct: 116 PEAICNLSKLEELYLGNNQLTGEIPKTFSHLRNLKILSLRMNNLTGSIPATIFNTNPNLK 175

Query: 171 ---------------------RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQ 287
                                +L  + LS N +TGS+P  +G +  L  L L  NS+TG+
Sbjct: 176 ELNLTSNNLSGKIPTSLGQCTKLQVISLSYNELTGSMPRAIGNLVELQRLSLLNNSLTGE 235

Query: 288 IPSTLLSNTGMGILNLSRNGFEGTIPDVFG-SKSYFMVLDLSFNKLTGRVPNSLAKAKFM 464
           IP +LL+ + +  L L  N   G +P   G        +DLS N+L G +P+SL   + +
Sbjct: 236 IPQSLLNISSLRFLRLGENNLVGILPTSMGYDLPKLEFIDLSSNQLKGEIPSSLLHCRQL 295

Query: 465 GHLDISNNHLCGNIP--IGSPFDHLDAASFSNNDCLCGNP 578
             L +S NHL G IP  IGS   +L+      N+   G P
Sbjct: 296 RVLSLSVNHLTGGIPKAIGS-LSNLEELYLDYNNLAGGIP 334

 Score =  100 bits (250), Expect = 6e-20
 Identities = 59/176 (33%), Positives = 88/176 (50%), Gaps = 1/176 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I +   L  L+L NN+++G +P     L KL    L  NQL G IP +   +  L  
Sbjct: 92  PKDIGKCKELQQLNLFNNKLVGSIPEAICNLSKLEELYLGNNQLTGEIPKTFSHLRNLKI 151

Query: 183 LDLSMNRITGSIPVRLGKMRV-LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           L L MN +TGSIP  +      L  L L  N+++G+IP++L   T + +++LS N   G+
Sbjct: 152 LSLRMNNLTGSIPATIFNTNPNLKELNLTSNNLSGKIPTSLGQCTKLQVISLSYNELTGS 211

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFD 527
           +P   G+      L L  N LTG +P SL     +  L +  N+L G +P    +D
Sbjct: 212 MPRAIGNLVELQRLSLLNNSLTGEIPQSLLNISSLRFLRLGENNLVGILPTSMGYD 267

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 63/171 (36%), Positives = 91/171 (53%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P S++ IS L  L L  N ++G LP+  G  L KL    LS NQL G IP S+L   +L 
Sbjct: 237 PQSLLNISSLRFLRLGENNLVGILPTSMGYDLPKLEFIDLSSNQLKGEIPSSLLHCRQLR 296

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L LS+N +TG IP  +G +  L  L LD N++ G IP  + + + + IL+   +G  G 
Sbjct: 297 VLSLSVNHLTGGIPKAIGSLSNLEELYLDYNNLAGGIPREIGNLSNLNILDFGSSGISGP 356

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIP 509
           IP    + S   ++DL+ N L G +P  + K    +  L +S N L G +P
Sbjct: 357 IPPEIFNISSLQIIDLTDNSLPGSLPMDICKHLPNLQGLYLSWNKLSGQLP 407

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 70/198 (35%), Positives = 96/198 (48%), Gaps = 6/198 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  IS L  +DL++N + G LP D  K L  L    LS N+L G +P ++    +L 
Sbjct: 358 PPEIFNISSLQIIDLTDNSLPGSLPMDICKHLPNLQGLYLSWNKLSGQLPSTLSLCGQLQ 417

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  NR TG+IP   G +  L  L+L  N++ G IPS L +   +  L LS N   G 
Sbjct: 418 SLSLWGNRFTGNIPPSFGNLTALQVLELAENNIPGNIPSELGNLINLQYLKLSANNLTGI 477

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAK----AKFMGHLDISNNHLCGNIPIG-SPF 524
           IP+   + S    +D S N L+G +P  + K       +  +D+S+N L G IP   S  
Sbjct: 478 IPEAIFNISSLQEIDFSNNSLSGCLPMDICKHLPDLPKLEFIDLSSNQLKGEIPSSLSHC 537

Query: 525 DHLDAASFSNNDCLCGNP 578
            HL   S S N    G P
Sbjct: 538 PHLRGLSLSLNQFTGGIP 555

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 63/174 (36%), Positives = 87/174 (50%), Gaps = 5/174 (2%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGK----LRKLSRALLSRNQLIGTIPDSVLKMN 170
            P +I  IS L  +D SNN + G LP D  K    L KL    LS NQL G IP S+    
Sbjct: 479  PEAIFNISSLQEIDFSNNSLSGCLPMDICKHLPDLPKLEFIDLSSNQLKGEIPSSLSHCP 538

Query: 171  RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
             L  L LS+N+ TG IP  +G +  L  L L  N++ G IP  + + + + IL+   +G 
Sbjct: 539  HLRGLSLSLNQFTGGIPQAIGSLSNLEELYLAYNNLVGGIPREIGNLSNLNILDFGSSGI 598

Query: 351  EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIP 509
             G IP    + S   + DL+ N L G +P  + K    +  L +S N L G +P
Sbjct: 599  SGPIPPEIFNISSLQIFDLTDNSLLGSLPMDIYKHLPNLQELYLSWNKLSGQLP 652

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 56/171 (32%), Positives = 85/171 (49%), Gaps = 1/171 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLK-MNRLA 179
           P  I  +S L  LD  ++ I G +P +   +  L    L+ N L G++P  + K +  L 
Sbjct: 334 PREIGNLSNLNILDFGSSGISGPIPPEIFNISSLQIIDLTDNSLPGSLPMDICKHLPNLQ 393

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L LS N+++G +P  L     L +L L GN  TG IP +  + T + +L L+ N   G 
Sbjct: 394 GLYLSWNKLSGQLPSTLSLCGQLQSLSLWGNRFTGNIPPSFGNLTALQVLELAENNIPGN 453

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           IP   G+      L LS N LTG +P ++     +  +D SNN L G +P+
Sbjct: 454 IPSELGNLINLQYLKLSANNLTGIIPEAIFNISSLQEIDFSNNSLSGCLPM 504

 Score = 91.7 bits (226), Expect = 4e-17
 Identities = 57/171 (33%), Positives = 92/171 (53%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3    PMSIVR-ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
            PM I + +  L  L LS N++ G+LPS      +L    L  N+  G IP S   +  L 
Sbjct: 627  PMDIYKHLPNLQELYLSWNKLSGQLPSTLSLCGQLQSLSLWGNRFTGNIPPSFGNLTALQ 686

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            DL+L  N I G+IP  LG +  L  LKL  N++TG IP  + + + +  L+L++N F G+
Sbjct: 687  DLELGDNNIQGNIPNELGNLINLQNLKLSENNLTGIIPEAIFNISKLQSLSLAQNHFSGS 746

Query: 360  IPDVFGSKSYFMV-LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +P   G++   +  L +  N+ +G +P S++    +  LDI +N   G++P
Sbjct: 747  LPSSLGTQLPDLEGLAIGRNEFSGIIPMSISNMSELTELDIWDNFFTGDVP 797

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 64/188 (34%), Positives = 94/188 (50%), Gaps = 3/188 (1%)
 Frame = +3

Query: 3    PMSIVRIS-GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
            P S+  +S  L   D S  Q  G +P+  G L  L    L  N L G IP ++ ++ +L 
Sbjct: 852  PNSLGNLSISLESFDASACQFRGTIPTGIGNLTSLISLELGDNDLTGLIPTTLGQLKKLQ 911

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            +L ++ NR+ GSIP  L +++ L  L L  N +TG IPS L     +  L L  N     
Sbjct: 912  ELGIAGNRLRGSIPNDLCRLKNLGYLFLSSNQLTGSIPSCLGYLPPLRELYLHSNALASN 971

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHL 533
            IP    +    +VL+LS N LTG +P  +   K +  LD+S N + G+IP  +G    +L
Sbjct: 972  IPPSLWTLRGLLVLNLSSNFLTGHLPPEVGNIKSIRTLDLSKNQVSGHIPRTLGE-LQNL 1030

Query: 534  DAASFSNN 557
            +  S S N
Sbjct: 1031 EDLSLSQN 1038

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 65/202 (32%), Positives = 94/202 (46%), Gaps = 33/202 (16%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
            P +I  IS L  L L+ N   G LPS  G +L  L    + RN+  G IP S+  M+ L 
Sbjct: 724  PEAIFNISKLQSLSLAQNHFSGSLPSSLGTQLPDLEGLAIGRNEFSGIIPMSISNMSELT 783

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS------TLLSN---------- 311
            +LD+  N  TG +P  LG +R L  L L  N +T +  +      T L+N          
Sbjct: 784  ELDIWDNFFTGDVPKDLGNLRRLEFLNLGSNQLTDEHSASEVGFLTSLTNCNFLRTLWIE 843

Query: 312  ---------TGMGILNLSRNGFE-------GTIPDVFGSKSYFMVLDLSFNKLTGRVPNS 443
                       +G L++S   F+       GTIP   G+ +  + L+L  N LTG +P +
Sbjct: 844  DNPLKGILPNSLGNLSISLESFDASACQFRGTIPTGIGNLTSLISLELGDNDLTGLIPTT 903

Query: 444  LAKAKFMGHLDISNNHLCGNIP 509
            L + K +  L I+ N L G+IP
Sbjct: 904  LGQLKKLQELGIAGNRLRGSIP 925

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 53/171 (30%), Positives = 85/171 (49%), Gaps = 1/171 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSV-LKMNRLA 179
           P +I  +  L  L L NN + GE+P     +  L    L  N L+G +P S+   + +L 
Sbjct: 213 PRAIGNLVELQRLSLLNNSLTGEIPQSLLNISSLRFLRLGENNLVGILPTSMGYDLPKLE 272

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            +DLS N++ G IP  L   R L  L L  N +TG IP  + S + +  L L  N   G 
Sbjct: 273 FIDLSSNQLKGEIPSSLLHCRQLRVLSLSVNHLTGGIPKAIGSLSNLEELYLDYNNLAGG 332

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           IP   G+ S   +LD   + ++G +P  +     +  +D+++N L G++P+
Sbjct: 333 IPREIGNLSNLNILDFGSSGISGPIPPEIFNISSLQIIDLTDNSLPGSLPM 383

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 51/158 (32%), Positives = 81/158 (51%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           ++LSN  + G + S  G L  L    LS N    ++P  + K   L  L+L  N++ GSI
Sbjct: 56  INLSNMGLQGTIVSQVGNLSFLVSLDLSNNYFHASLPKDIGKCKELQQLNLFNNKLVGSI 115

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFM 395
           P  +  +  L  L L  N +TG+IP T      + IL+L  N   G+IP  +F +     
Sbjct: 116 PEAICNLSKLEELYLGNNQLTGEIPKTFSHLRNLKILSLRMNNLTGSIPATIFNTNPNLK 175

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L+L+ N L+G++P SL +   +  + +S N L G++P
Sbjct: 176 ELNLTSNNLSGKIPTSLGQCTKLQVISLSYNELTGSMP 213

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 45/139 (32%), Positives = 68/139 (48%), Gaps = 1/139 (0%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           +++S   LS   L GTI   V  ++ L  LDLS N    S+P  +GK + L  L L  N 
Sbjct: 51  QRVSAINLSNMGLQGTIVSQVGNLSFLVSLDLSNNYFHASLPKDIGKCKELQQLNLFNNK 110

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA 455
           + G IP  + + + +  L L  N   G IP  F       +L L  N LTG +P ++   
Sbjct: 111 LVGSIPEAICNLSKLEELYLGNNQLTGEIPKTFSHLRNLKILSLRMNNLTGSIPATIFNT 170

Query: 456 K-FMGHLDISNNHLCGNIP 509
              +  L++++N+L G IP
Sbjct: 171 NPNLKELNLTSNNLSGKIP 189

[63][TOP]
>UniRef100_B9RVA8 Receptor-kinase, putative n=1 Tax=Ricinus communis RepID=B9RVA8_RICCO
          Length = 2793

 Score =  129 bits (324), Expect = 2e-28
 Identities = 70/191 (36%), Positives = 108/191 (56%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P S+  ++GL  L LS N   G +PS  G L+ L+   +S N+L G IP  +L +  L+ 
Sbjct: 560  PSSLGNLTGLSMLYLSRNLFEGSIPSSIGNLKNLNTLAISHNKLTGAIPHEILGLTSLSQ 619

Query: 183  -LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
             LDLS N +TG++P  +GK+  L+ L + GN+++G+IP ++ +   +  L +  N F+GT
Sbjct: 620  ALDLSQNSLTGNLPPEIGKLTSLTALFISGNNLSGEIPGSIGNCLSLEYLYMKDNFFQGT 679

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
            IP    S      +DLS N LTG +P  L   +++  L++S N L G +P    F +L A
Sbjct: 680  IPSSLASLKGLQYVDLSGNILTGPIPEGLQSMQYLKSLNLSFNDLEGEVPTEGVFRNLSA 739

Query: 540  ASFSNNDCLCG 572
             S + N  LCG
Sbjct: 740  LSLTGNSKLCG 750

 Score =  103 bits (257), Expect = 1e-20
 Identities = 65/169 (38%), Positives = 89/169 (52%), Gaps = 2/169 (1%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           S+   + L  LD   N   G LP+    L  +LS     RNQ+ G IP  +  +  L  L
Sbjct: 465 SLNNCTKLRILDFGRNNFGGVLPNSVANLSTELSLFYFGRNQIRGIIPAGLENLINLVGL 524

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
            +  N  TG +P   GK + L  L L GN ++G+IPS+L + TG+ +L LSRN FEG+IP
Sbjct: 525 VMHYNLFTGVVPSYFGKFQKLQVLDLFGNRLSGRIPSSLGNLTGLSMLYLSRNLFEGSIP 584

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNS-LAKAKFMGHLDISNNHLCGNIP 509
              G+      L +S NKLTG +P+  L        LD+S N L GN+P
Sbjct: 585 SSIGNLKNLNTLAISHNKLTGAIPHEILGLTSLSQALDLSQNSLTGNLP 633

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 53/166 (31%), Positives = 87/166 (52%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  +S L  ++L NN I GE+P + G+L +L   LL  N L G IP ++ + ++L  + L
Sbjct: 221 IGNLSFLRFINLQNNSIHGEVPQEVGRLFRLQELLLINNTLQGEIPINLTRCSQLRVIGL 280

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
             N ++G IP  LG +  L  L L  N +TG+IP++L + + + I   + N   G IP  
Sbjct: 281 LGNNLSGKIPAELGSLLKLEVLSLSMNKLTGEIPASLGNLSSLTIFQATYNSLVGNIPQE 340

Query: 372 FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G  +   V  +  N+L+G +P S+     +  L  + N L  ++P
Sbjct: 341 MGRLTSLTVFGVGANQLSGIIPPSIFNFSSVTRLLFTQNQLNASLP 386

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 55/165 (33%), Positives = 87/165 (52%)
 Frame = +3

Query: 15   VRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLS 194
            + +  L  LD++NN   G++  DF    +LS   +S+N++ G IP  +  ++ +  LDLS
Sbjct: 1481 MNLEELTVLDMNNNNFSGKIDVDFFYCPRLSVLDISKNKVAGVIPIQLCNLSSVEILDLS 1540

Query: 195  MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVF 374
             NR  G++P        L  L L  N + G IP  L  ++ + +++L  N F G IP   
Sbjct: 1541 ENRFFGAMPSCFNASS-LRYLFLQKNGLNGLIPHVLSRSSNLVVVDLRNNKFSGNIPSWI 1599

Query: 375  GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
               S   VL L  N L G +PN L + + +  +D+S+N LCG+IP
Sbjct: 1600 SQLSELHVLLLGGNALGGHIPNQLCQLRNLKIMDLSHNLLCGSIP 1644

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 61/170 (35%), Positives = 85/170 (50%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELP-SDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
            P SI ++ GL  LDLSNN   GELP S       L   +LS N   G I    + +  L 
Sbjct: 1428 PSSISQMEGLSILDLSNNYFSGELPRSLLSNSTYLVALVLSNNNFQGRIFPETMNLEELT 1487

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
             LD++ N  +G I V       LS L +  N + G IP  L + + + IL+LS N F G 
Sbjct: 1488 VLDMNNNNFSGKIDVDFFYCPRLSVLDISKNKVAGVIPIQLCNLSSVEILDLSENRFFGA 1547

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +P  F + S    L L  N L G +P+ L+++  +  +D+ NN   GNIP
Sbjct: 1548 MPSCFNASS-LRYLFLQKNGLNGLIPHVLSRSSNLVVVDLRNNKFSGNIP 1596

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 57/165 (34%), Positives = 79/165 (47%), Gaps = 8/165 (4%)
 Frame = +3

Query: 39   LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
            LDLSNN   G++P   G    L+   L  N   G I      + R   +DLS NR +GS+
Sbjct: 2353 LDLSNNHFHGKIPRWMGNFTNLAYLSLHNNCFEGHI---FCDLFRAEYIDLSQNRFSGSL 2409

Query: 219  PVRLGK--------MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVF 374
            P             +R    + L GN  TG IP + L+ + +  LNL  N F G+IP  F
Sbjct: 2410 PSCFNMQSDIHPYILRYPLHINLQGNRFTGSIPVSFLNFSKLLTLNLRDNNFSGSIPHAF 2469

Query: 375  GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G+      L L  N+L G +P+ L +   +G LD+S N   G+IP
Sbjct: 2470 GAFPNLRALLLGGNRLNGLIPDWLCELNEVGILDLSMNSFSGSIP 2514

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 51/172 (29%), Positives = 80/172 (46%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLD---LSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNR 173
           P SI   S L  +    L    + G +    G L  L    L  N + G +P  V ++ R
Sbjct: 191 PPSIFNFSSLTRVTSFVLEGQNLFGSISPFIGNLSFLRFINLQNNSIHGEVPQEVGRLFR 250

Query: 174 LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L +L L  N + G IP+ L +   L  + L GN+++G+IP+ L S   + +L+LS N   
Sbjct: 251 LQELLLINNTLQGEIPINLTRCSQLRVIGLLGNNLSGKIPAELGSLLKLEVLSLSMNKLT 310

Query: 354 GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G IP   G+ S   +   ++N L G +P  + +   +    +  N L G IP
Sbjct: 311 GEIPASLGNLSSLTIFQATYNSLVGNIPQEMGRLTSLTVFGVGANQLSGIIP 362

 Score = 80.9 bits (198), Expect = 7e-14
 Identities = 58/193 (30%), Positives = 88/193 (45%), Gaps = 23/193 (11%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + R+  L  L L NN + GE+P +  +  +L    L  N L G IP  +  + +L  
Sbjct: 242 PQEVGRLFRLQELLLINNTLQGEIPINLTRCSQLRVIGLLGNNLSGKIPAELGSLLKLEV 301

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LSMN++TG IP  LG +  L+  +   NS+ G IP  +   T + +  +  N   G I
Sbjct: 302 LSLSMNKLTGEIPASLGNLSSLTIFQATYNSLVGNIPQEMGRLTSLTVFGVGANQLSGII 361

Query: 363 -PDVFGSKSYFMVL-----------------DLSF-----NKLTGRVPNSLAKAKFMGHL 473
            P +F   S   +L                 +L+F     N L G +PNSL  A  +  +
Sbjct: 362 PPSIFNFSSVTRLLFTQNQLNASLPDNIHLPNLTFFGIGDNNLFGSIPNSLFNASRLEII 421

Query: 474 DISNNHLCGNIPI 512
           D+  N+  G +PI
Sbjct: 422 DLGWNYFNGQVPI 434

 Score = 80.9 bits (198), Expect = 7e-14
 Identities = 55/162 (33%), Positives = 82/162 (50%), Gaps = 2/162 (1%)
 Frame = +3

Query: 30   LMHLDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
            L++L +S+N I G++P D G L    R L +S N   G IP S+ +M  L+ LDLS N  
Sbjct: 1388 LINLKISSNSIAGQIPKDIGLLLSNLRYLNMSWNCFEGNIPSSISQMEGLSILDLSNNYF 1447

Query: 207  TGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
            +G +P  L      L  L L  N+  G+I    ++   + +L+++ N F G I   F   
Sbjct: 1448 SGELPRSLLSNSTYLVALVLSNNNFQGRIFPETMNLEELTVLDMNNNNFSGKIDVDFFYC 1507

Query: 384  SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                VLD+S NK+ G +P  L     +  LD+S N   G +P
Sbjct: 1508 PRLSVLDISKNKVAGVIPIQLCNLSSVEILDLSENRFFGAMP 1549

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 59/216 (27%), Positives = 93/216 (43%), Gaps = 25/216 (11%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPS-----DFGKLRKLSRALLSRNQLIGTIPDSVLKM 167
            P  + ++  L  +DLS+N + G +PS      FG + + S +  S    + +  DS    
Sbjct: 1620 PNQLCQLRNLKIMDLSHNLLCGSIPSCFHNISFGSMVEESFSSSSIGVAMASHYDSYAYY 1679

Query: 168  NRLADLDLS--------------------MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQ 287
                +LDL                      N   GS+      + +++ + L  N + G+
Sbjct: 1680 KATLELDLPGLLSWSSSSEVQVEFIMKYRYNSYKGSV------INLMAGIDLSRNELRGE 1733

Query: 288  IPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
            IPS +     +  LNLS N   G+IP  F +      LDL  N L+G +P  L +  F+G
Sbjct: 1734 IPSEIGDIQEIRSLNLSYNHLSGSIPFSFSNLKNLESLDLRNNSLSGEIPTQLVELNFLG 1793

Query: 468  HLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCGN 575
              D+S N+L G I     F   D +S+  N  LCG+
Sbjct: 1794 TFDVSYNNLSGRILEKGQFGTFDESSYKGNPELCGD 1829

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 64/213 (30%), Positives = 94/213 (44%), Gaps = 44/213 (20%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P+S +  S L+ L+L +N   G +P  FG    L   LL  N+L G IPD + ++N +  
Sbjct: 2442 PVSFLNFSKLLTLNLRDNNFSGSIPHAFGAFPNLRALLLGGNRLNGLIPDWLCELNEVGI 2501

Query: 183  LDLSMNRITGSIPVRLGKM--------------------RVLSTLKLDG-NSMTGQIPST 299
            LDLSMN  +GSIP  L  +                    R + T+   G     G++ + 
Sbjct: 2502 LDLSMNSFSGSIPKCLYNLSFGSEGLHGTFEEEHWMYFIRTVDTIYSGGLIPGMGEVENH 2561

Query: 300  LL----------------SNTGMG-ILN------LSRNGFEGTIPDVFGSKSYFMVLDLS 410
             +                +NT  G ILN      LS N   G IP   G  S  + L++S
Sbjct: 2562 YIIDMYVKEEIEFVTKHRANTYKGDILNFMSGLDLSHNNLIGVIPLELGMLSEILALNIS 2621

Query: 411  FNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +N+L G +P S +    +  LD+S+  L G IP
Sbjct: 2622 YNRLVGYIPVSFSNLTQLESLDLSHYSLSGQIP 2654

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 45/138 (32%), Positives = 75/138 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P+ +  +S +  LDLS N+  G +PS F     L    L +N L G IP  + + + L  
Sbjct: 1525 PIQLCNLSSVEILDLSENRFFGAMPSCFNA-SSLRYLFLQKNGLNGLIPHVLSRSSNLVV 1583

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            +DL  N+ +G+IP  + ++  L  L L GN++ G IP+ L     + I++LS N   G+I
Sbjct: 1584 VDLRNNKFSGNIPSWISQLSELHVLLLGGNALGGHIPNQLCQLRNLKIMDLSHNLLCGSI 1643

Query: 363  PDVFGSKSYFMVLDLSFN 416
            P  F + S+  +++ SF+
Sbjct: 1644 PSCFHNISFGSMVEESFS 1661

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 57/167 (34%), Positives = 86/167 (51%), Gaps = 4/167 (2%)
 Frame = +3

Query: 24   SGLMHLDLSNNQIIG--ELPSDFGKLRKLSRALLSRNQLIGTIPDSV-LKMNRLADLDLS 194
            S L  +++ NN   G  +LPS   +L  L    +S N + G IP  + L ++ L  L++S
Sbjct: 1363 SRLEVMNMMNNSFTGTFQLPSYRHELINLK---ISSNSIAGQIPKDIGLLLSNLRYLNMS 1419

Query: 195  MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN-TGMGILNLSRNGFEGTIPDV 371
             N   G+IP  + +M  LS L L  N  +G++P +LLSN T +  L LS N F+G I   
Sbjct: 1420 WNCFEGNIPSSISQMEGLSILDLSNNYFSGELPRSLLSNSTYLVALVLSNNNFQGRIFPE 1479

Query: 372  FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
              +     VLD++ N  +G++         +  LDIS N + G IPI
Sbjct: 1480 TMNLEELTVLDMNNNNFSGKIDVDFFYCPRLSVLDISKNKVAGVIPI 1526

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 58/200 (29%), Positives = 91/200 (45%), Gaps = 31/200 (15%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI   S +  L  + NQ+   LP +   L  L+   +  N L G+IP+S+   +RL  
Sbjct: 362 PPSIFNFSSVTRLLFTQNQLNASLPDNI-HLPNLTFFGIGDNNLFGSIPNSLFNASRLEI 420

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS-----TLLSN-TGMGILNLSRN 344
           +DL  N   G +P+ +G ++ L  ++L GN++     S     T L+N T + IL+  RN
Sbjct: 421 IDLGWNYFNGQVPINIGSLKNLWRIRLHGNNLGSNSSSDLAFLTSLNNCTKLRILDFGRN 480

Query: 345 GFEGTIPDVFGSKS------YF-------------------MVLDLSFNKLTGRVPNSLA 449
            F G +P+   + S      YF                   + L + +N  TG VP+   
Sbjct: 481 NFGGVLPNSVANLSTELSLFYFGRNQIRGIIPAGLENLINLVGLVMHYNLFTGVVPSYFG 540

Query: 450 KAKFMGHLDISNNHLCGNIP 509
           K + +  LD+  N L G IP
Sbjct: 541 KFQKLQVLDLFGNRLSGRIP 560

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 52/165 (31%), Positives = 77/165 (46%), Gaps = 1/165 (0%)
 Frame = +3

Query: 39   LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVL-KMNRLADLDLSMNRITGS 215
            LDLS N + G + S    L  L+   LS N + G+ P         L  LDLS++  TG+
Sbjct: 1962 LDLSYNWLNGSILSSVSSLTSLTTLNLSFNSMAGSFPSQEFASFKNLEVLDLSLSEFTGT 2021

Query: 216  IPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFM 395
            +P        L  L L GN   G + S       +  L+LS N F G +P    + +   
Sbjct: 2022 VPQHSWAPLSLKVLSLFGNHFNGSLTS-FCGLKRLQQLDLSYNHFGGNLPPCLHNMTSLT 2080

Query: 396  VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDH 530
            +LDLS N+ TG V + LA  K + ++D+S+N   G+       +H
Sbjct: 2081 LLDLSENQFTGHVSSLLASLKSLKYIDLSHNLFEGSFSFNLFAEH 2125

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 58/220 (26%), Positives = 86/220 (39%), Gaps = 51/220 (23%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +  L  L L  N   GE+P+  G L  +    ++ N L+G IPD + ++  L  
Sbjct: 119 PAQLGSLVNLEELRLLTNNRRGEIPASLGNLSSIRIFHVTLNNLVGHIPDDMGRLTSLTT 178

Query: 183 LDLSMNRITGSIPVR---------------------------LGKMRVLSTLKLDGNSMT 281
             + +N+I+G IP                             +G +  L  + L  NS+ 
Sbjct: 179 FAVGVNKISGVIPPSIFNFSSLTRVTSFVLEGQNLFGSISPFIGNLSFLRFINLQNNSIH 238

Query: 282 GQIPS-----------TLLSNTGMG-------------ILNLSRNGFEGTIPDVFGSKSY 389
           G++P             L++NT  G             ++ L  N   G IP   GS   
Sbjct: 239 GEVPQEVGRLFRLQELLLINNTLQGEIPINLTRCSQLRVIGLLGNNLSGKIPAELGSLLK 298

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             VL LS NKLTG +P SL     +     + N L GNIP
Sbjct: 299 LEVLSLSMNKLTGEIPASLGNLSSLTIFQATYNSLVGNIP 338

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 47/126 (37%), Positives = 62/126 (49%), Gaps = 8/126 (6%)
 Frame = +3

Query: 36   HLDLSNNQIIGELPSDFGK--------LRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
            ++DLS N+  G LPS F          LR      L  N+  G+IP S L  ++L  L+L
Sbjct: 2397 YIDLSQNRFSGSLPSCFNMQSDIHPYILRYPLHINLQGNRFTGSIPVSFLNFSKLLTLNL 2456

Query: 192  SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
              N  +GSIP   G    L  L L GN + G IP  L     +GIL+LS N F G+IP  
Sbjct: 2457 RDNNFSGSIPHAFGAFPNLRALLLGGNRLNGLIPDWLCELNEVGILDLSMNSFSGSIPKC 2516

Query: 372  FGSKSY 389
              + S+
Sbjct: 2517 LYNLSF 2522

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 54/158 (34%), Positives = 78/158 (49%), Gaps = 2/158 (1%)
 Frame = +3

Query: 39   LDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLADLDLSMNRITGS 215
            LD+S+N   G+L    GK+    + L LS N+  G    S  K  +L  LDLS N  +G 
Sbjct: 2231 LDVSDNLFKGQLQDVGGKMFPEMKFLNLSGNRFRGDFLFSPAKDCKLTILDLSFNNFSGE 2290

Query: 216  IPVRLGKMRV-LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYF 392
            +P +L    V L  LKL  N+  GQI +   + TG+  L L+ N F GT+  +       
Sbjct: 2291 VPKKLLSSCVSLKYLKLSHNNFHGQIFTREFNLTGLSSLKLNDNQFGGTLSSLVNQFYDL 2350

Query: 393  MVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
             VLDLS N   G++P  +     + +L + NN   G+I
Sbjct: 2351 WVLDLSNNHFHGKIPRWMGNFTNLAYLSLHNNCFEGHI 2388

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 34/92 (36%), Positives = 53/92 (57%)
 Frame = +3

Query: 117  LSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS 296
            LS N LIG IP  +  ++ +  L++S NR+ G IPV    +  L +L L   S++GQIPS
Sbjct: 2596 LSHNNLIGVIPLELGMLSEILALNISYNRLVGYIPVSFSNLTQLESLDLSHYSLSGQIPS 2655

Query: 297  TLLSNTGMGILNLSRNGFEGTIPDVFGSKSYF 392
             L++   + + +++ N   G IPD+ G  S F
Sbjct: 2656 ELINLHFLEVFSVAYNNLSGRIPDMIGQFSTF 2687

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 45/120 (37%), Positives = 61/120 (50%), Gaps = 1/120 (0%)
 Frame = +3

Query: 153  SVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS-TLLSNTGMGIL 329
            S+LK  +L  LDLS N + GSI   +  +  L+TL L  NSM G  PS    S   + +L
Sbjct: 1954 SILK--KLEVLDLSYNWLNGSILSSVSSLTSLTTLNLSFNSMAGSFPSQEFASFKNLEVL 2011

Query: 330  NLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +LS + F GT+P    +     VL L  N   G +  S    K +  LD+S NH  GN+P
Sbjct: 2012 DLSLSEFTGTVPQHSWAPLSLKVLSLFGNHFNGSL-TSFCGLKRLQQLDLSYNHFGGNLP 2070

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 50/158 (31%), Positives = 74/158 (46%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39   LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMN-RLADLDLSMNRITGS 215
            L+LS N+  G+      K  KL+   LS N   G +P  +L     L  L LS N   G 
Sbjct: 2256 LNLSGNRFRGDFLFSPAKDCKLTILDLSFNNFSGEVPKKLLSSCVSLKYLKLSHNNFHGQ 2315

Query: 216  IPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFM 395
            I  R   +  LS+LKL+ N   G + S +     + +L+LS N F G IP   G+ +   
Sbjct: 2316 IFTREFNLTGLSSLKLNDNQFGGTLSSLVNQFYDLWVLDLSNNHFHGKIPRWMGNFTNLA 2375

Query: 396  VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             L L  N   G +   L +A++   +D+S N   G++P
Sbjct: 2376 YLSLHNNCFEGHIFCDLFRAEY---IDLSQNRFSGSLP 2410

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 46/161 (28%), Positives = 68/161 (42%), Gaps = 8/161 (4%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRL-- 176
            P  +   + L +L L NN   G +  D  +   +    LS+N+  G++P      + +  
Sbjct: 2365 PRWMGNFTNLAYLSLHNNCFEGHIFCDLFRAEYID---LSQNRFSGSLPSCFNMQSDIHP 2421

Query: 177  ------ADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLS 338
                    ++L  NR TGSIPV       L TL L  N+ +G IP    +   +  L L 
Sbjct: 2422 YILRYPLHINLQGNRFTGSIPVSFLNFSKLLTLNLRDNNFSGSIPHAFGAFPNLRALLLG 2481

Query: 339  RNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF 461
             N   G IPD     +   +LDLS N  +G +P  L    F
Sbjct: 2482 GNRLNGLIPDWLCELNEVGILDLSMNSFSGSIPKCLYNLSF 2522

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 31/88 (35%), Positives = 51/88 (57%)
 Frame = +3

Query: 39   LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
            LDLS+N +IG +P + G L ++    +S N+L+G IP S   + +L  LDLS   ++G I
Sbjct: 2594 LDLSHNNLIGVIPLELGMLSEILALNISYNRLVGYIPVSFSNLTQLESLDLSHYSLSGQI 2653

Query: 219  PVRLGKMRVLSTLKLDGNSMTGQIPSTL 302
            P  L  +  L    +  N+++G+IP  +
Sbjct: 2654 PSELINLHFLEVFSVAYNNLSGRIPDMI 2681

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 36/136 (26%), Positives = 60/136 (44%)
 Frame = +3

Query: 165  MNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRN 344
            +N ++ LDLS N + G IP+ LG +  +  L +  N + G IP +  + T +  L+LS  
Sbjct: 2588 LNFMSGLDLSHNNLIGVIPLELGMLSEILALNISYNRLVGYIPVSFSNLTQLESLDLSHY 2647

Query: 345  GFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF 524
               G IP    +  +  V  +++N L+GR+P+ + +                       F
Sbjct: 2648 SLSGQIPSELINLHFLEVFSVAYNNLSGRIPDMIGQ-----------------------F 2684

Query: 525  DHLDAASFSNNDCLCG 572
               D  S+  N  LCG
Sbjct: 2685 STFDNGSYEGNPLLCG 2700

[64][TOP]
>UniRef100_A7PJI9 Chromosome chr12 scaffold_18, whole genome shotgun sequence n=1
            Tax=Vitis vinifera RepID=A7PJI9_VITVI
          Length = 1058

 Score =  129 bits (324), Expect = 2e-28
 Identities = 75/192 (39%), Positives = 105/192 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  + R+  L +L LS+NQ+ G +PS  G L  L    L  N L   IP S+  +  L  
Sbjct: 507  PNDLCRLKNLGYLFLSSNQLTGSIPSCLGYLPPLRELYLHSNALASNIPPSLWTLRGLLV 566

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N +TG +P  +G ++ + TL L  N ++G IP TL     +  L+LS+N  +G I
Sbjct: 567  LNLSSNFLTGHLPPEVGNIKSIRTLDLSKNQVSGHIPRTLGELQNLEDLSLSQNRLQGPI 626

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  FG       LDLS N L+G +P SL    ++ +L++S N L G IP G PF +  A 
Sbjct: 627  PLEFGDLLSLKFLDLSQNNLSGVIPKSLKALTYLKYLNVSFNKLQGEIPDGGPFMNFTAE 686

Query: 543  SFSNNDCLCGNP 578
            SF  N+ LCG P
Sbjct: 687  SFIFNEALCGAP 698

 Score = 96.3 bits (238), Expect = 2e-18
 Identities = 52/162 (32%), Positives = 84/162 (51%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L+L NN+++G +P     L KL    L  NQL G IP +   +  L  L L MN +T
Sbjct: 78  LQQLNLFNNKLVGSIPEAICNLSKLEELYLGNNQLTGEIPKTFSHLRNLKILSLRMNNLT 137

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLL-SNTGMGILNLSRNGFEGTIPDVFGSKS 386
           GSIP  +  +  L  + L  NS++G +P  +  +N  +  LNL+ N   G IP   G+ S
Sbjct: 138 GSIPATIFNISSLLNISLSYNSLSGSLPMDMCNTNPNLKELNLTSNNLSGKIPTKIGNLS 197

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
              +LD   + ++G +P  +     +   D+++N L G++P+
Sbjct: 198 NLNILDFGSSGISGPIPPEIFNISSLQIFDLTDNSLLGSLPM 239

 Score = 93.6 bits (231), Expect = 1e-17
 Identities = 56/171 (32%), Positives = 91/171 (53%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  +S L  L L NNQ+ GE+P  F  LR L    L  N L G+IP ++  ++ L +
Sbjct: 93  PEAICNLSKLEELYLGNNQLTGEIPKTFSHLRNLKILSLRMNNLTGSIPATIFNISSLLN 152

Query: 183 LDLSMNRITGSIPVRLGKMRV-LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           + LS N ++GS+P+ +      L  L L  N+++G+IP+ + + + + IL+   +G  G 
Sbjct: 153 ISLSYNSLSGSLPMDMCNTNPNLKELNLTSNNLSGKIPTKIGNLSNLNILDFGSSGISGP 212

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIP 509
           IP    + S   + DL+ N L G +P  + K    +  L +S N L G +P
Sbjct: 213 IPPEIFNISSLQIFDLTDNSLLGSLPMDIYKHLPNLQELYLSWNKLSGQLP 263

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 57/189 (30%), Positives = 94/189 (49%), Gaps = 3/189 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLK-MNRLA 179
           P  I  +S L  LD  ++ I G +P +   +  L    L+ N L+G++P  + K +  L 
Sbjct: 190 PTKIGNLSNLNILDFGSSGISGPIPPEIFNISSLQIFDLTDNSLLGSLPMDIYKHLPNLQ 249

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           +L LS N+++G +P  L     L +L L GN  TG IP +  + T +  L L  N  +G 
Sbjct: 250 ELYLSWNKLSGQLPSTLSLCGQLQSLSLWGNRFTGNIPPSFGNLTALQDLELGDNNIQGN 309

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHL 533
           IP+  G+      L LS N LTG +P ++     +  L ++ NH  G++P  +G+    L
Sbjct: 310 IPNELGNLINLQNLKLSENNLTGIIPEAIFNISKLQSLSLAQNHFSGSLPSSLGTQLPDL 369

Query: 534 DAASFSNND 560
           +  +   N+
Sbjct: 370 EGLAIGRNE 378

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 56/170 (32%), Positives = 91/170 (53%), Gaps = 2/170 (1%)
 Frame = +3

Query: 3   PMSIVR-ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           PM I + +  L  L LS N++ G+LPS      +L    L  N+  G IP S   +  L 
Sbjct: 238 PMDIYKHLPNLQELYLSWNKLSGQLPSTLSLCGQLQSLSLWGNRFTGNIPPSFGNLTALQ 297

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           DL+L  N I G+IP  LG +  L  LKL  N++TG IP  + + + +  L+L++N F G+
Sbjct: 298 DLELGDNNIQGNIPNELGNLINLQNLKLSENNLTGIIPEAIFNISKLQSLSLAQNHFSGS 357

Query: 360 IPDVFGSKSYFMV-LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           +P   G++   +  L +  N+ +G +P S++    +  LDI +N   G++
Sbjct: 358 LPSSLGTQLPDLEGLAIGRNEFSGIIPMSISNMSELTELDIWDNFFTGDV 407

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 64/188 (34%), Positives = 94/188 (50%), Gaps = 3/188 (1%)
 Frame = +3

Query: 3   PMSIVRIS-GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P S+  +S  L   D S  Q  G +P+  G L  L    L  N L G IP ++ ++ +L 
Sbjct: 434 PNSLGNLSISLESFDASACQFRGTIPTGIGNLTSLISLELGDNDLTGLIPTTLGQLKKLQ 493

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           +L ++ NR+ GSIP  L +++ L  L L  N +TG IPS L     +  L L  N     
Sbjct: 494 ELGIAGNRLRGSIPNDLCRLKNLGYLFLSSNQLTGSIPSCLGYLPPLRELYLHSNALASN 553

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHL 533
           IP    +    +VL+LS N LTG +P  +   K +  LD+S N + G+IP  +G    +L
Sbjct: 554 IPPSLWTLRGLLVLNLSSNFLTGHLPPEVGNIKSIRTLDLSKNQVSGHIPRTLGE-LQNL 612

Query: 534 DAASFSNN 557
           +  S S N
Sbjct: 613 EDLSLSQN 620

[65][TOP]
>UniRef100_Q5N7Z4 Putative bacterial blight resistance protein n=2 Tax=Oryza sativa
           Japonica Group RepID=Q5N7Z4_ORYSJ
          Length = 942

 Score =  129 bits (323), Expect = 2e-28
 Identities = 72/192 (37%), Positives = 100/192 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +S L  LDL  N++ G +P   G L +L   +LS NQL  TIP S   + +L  
Sbjct: 389 PTQIGMLSSLQRLDLQRNRLFGSIPDSIGNLSELEHIMLSHNQLNSTIPASFFNLGKLVR 448

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LS N  TG++P  L +++   T+ L  NS+ G IP +      +  LNLS N F  +I
Sbjct: 449 LNLSHNSFTGALPNDLSRLKQGDTIDLSSNSLLGSIPESFGQIRMLTYLNLSHNSFGDSI 508

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P  F   +    LDLS N L+G +P  LA   ++  L++S N L G IP G  F ++   
Sbjct: 509 PYSFQELANLATLDLSSNNLSGTIPKFLANFTYLTALNLSFNRLEGQIPDGGVFSNITLQ 568

Query: 543 SFSNNDCLCGNP 578
           S   N  LCG P
Sbjct: 569 SLIGNAALCGAP 580

 Score =  102 bits (255), Expect = 2e-20
 Identities = 58/154 (37%), Positives = 85/154 (55%)
 Frame = +3

Query: 48  SNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVR 227
           S N++ G LPS    L  L +  L  NQL G IP+S+  M  L  LD+S N I+G IP +
Sbjct: 332 SENKLTGGLPSSLSNLSSLEQLQLPGNQLTGPIPESITMMPNLVRLDVSSNDISGPIPTQ 391

Query: 228 LGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDL 407
           +G +  L  L L  N + G IP ++ + + +  + LS N    TIP  F +    + L+L
Sbjct: 392 IGMLSSLQRLDLQRNRLFGSIPDSIGNLSELEHIMLSHNQLNSTIPASFFNLGKLVRLNL 451

Query: 408 SFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           S N  TG +PN L++ K    +D+S+N L G+IP
Sbjct: 452 SHNSFTGALPNDLSRLKQGDTIDLSSNSLLGSIP 485

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 62/196 (31%), Positives = 96/196 (48%), Gaps = 4/196 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +     L  L +S+N  +  +P+   +L  L+   L  NQL G+IP  +  +  +  
Sbjct: 146 PAGLAACRYLQTLSISSNSFVDVVPAWLAQLPYLTELFLGGNQLTGSIPPGLGNLTGVTS 205

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS   +TG IP  LG MR LSTL+L  N +TG IP++L + + +  L+L  N   G +
Sbjct: 206 LDLSFCNLTGEIPSELGLMRSLSTLRLTYNQLTGPIPTSLGNLSQLSFLDLQMNQLTGAV 265

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP--IGSPFDH 530
           P   G+      L LS N L G +   +SL+  + +  + + +N   G++P   G+    
Sbjct: 266 PATLGNIPALNWLTLSLNNLEGNLGFLSSLSNCRQIWIITLDSNSFTGDLPDHTGNLSAQ 325

Query: 531 LDAASFSNNDCLCGNP 578
           L   S S N    G P
Sbjct: 326 LSIFSASENKLTGGLP 341

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 53/159 (33%), Positives = 82/159 (51%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L    +S+N   G +P+     R L    +S N  +  +P  + ++  L +L L  N++T
Sbjct: 131 LRTFSISSNGFAGRIPAGLAACRYLQTLSISSNSFVDVVPAWLAQLPYLTELFLGGNQLT 190

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           GSIP  LG +  +++L L   ++TG+IPS L     +  L L+ N   G IP   G+ S 
Sbjct: 191 GSIPPGLGNLTGVTSLDLSFCNLTGEIPSELGLMRSLSTLRLTYNQLTGPIPTSLGNLSQ 250

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
              LDL  N+LTG VP +L     +  L +S N+L GN+
Sbjct: 251 LSFLDLQMNQLTGAVPATLGNIPALNWLTLSLNNLEGNL 289

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 58/196 (29%), Positives = 89/196 (45%), Gaps = 27/196 (13%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQL---------------- 134
           P S+  +S L  LDL  NQ+ G +P+  G +  L+   LS N L                
Sbjct: 242 PTSLGNLSQLSFLDLQMNQLTGAVPATLGNIPALNWLTLSLNNLEGNLGFLSSLSNCRQI 301

Query: 135 ----------IGTIPDSVLKMN-RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMT 281
                      G +PD    ++ +L+    S N++TG +P  L  +  L  L+L GN +T
Sbjct: 302 WIITLDSNSFTGDLPDHTGNLSAQLSIFSASENKLTGGLPSSLSNLSSLEQLQLPGNQLT 361

Query: 282 GQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF 461
           G IP ++     +  L++S N   G IP   G  S    LDL  N+L G +P+S+     
Sbjct: 362 GPIPESITMMPNLVRLDVSSNDISGPIPTQIGMLSSLQRLDLQRNRLFGSIPDSIGNLSE 421

Query: 462 MGHLDISNNHLCGNIP 509
           + H+ +S+N L   IP
Sbjct: 422 LEHIMLSHNQLNSTIP 437

 Score = 85.1 bits (209), Expect = 4e-15
 Identities = 56/172 (32%), Positives = 81/172 (47%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG---KLRKLSRALLSRNQLIGTIPDSVLKMNR 173
           P ++  +S L  L LS+N + G +P+       L  L    +S N   G IP  +     
Sbjct: 95  PPAVYNMSRLRGLVLSHNNLTGWIPTTSNGSFHLPMLRTFSISSNGFAGRIPAGLAACRY 154

Query: 174 LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L  L +S N     +P  L ++  L+ L L GN +TG IP  L + TG+  L+LS     
Sbjct: 155 LQTLSISSNSFVDVVPAWLAQLPYLTELFLGGNQLTGSIPPGLGNLTGVTSLDLSFCNLT 214

Query: 354 GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G IP   G       L L++N+LTG +P SL     +  LD+  N L G +P
Sbjct: 215 GEIPSELGLMRSLSTLRLTYNQLTGPIPTSLGNLSQLSFLDLQMNQLTGAVP 266

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 59/192 (30%), Positives = 85/192 (44%), Gaps = 33/192 (17%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDF-GKLRKLSRALLSRNQLIGTIP---------------------- 149
           L L NN + GE+P D    +R+LSR  L  NQL G +P                      
Sbjct: 5   LHLGNNNLSGEIPPDLLHGMRRLSRIALHMNQLTGDLPPLLFNGTPSLTFVNLGNNSLTG 64

Query: 150 -------DSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLS 308
                   S   +  L  L+L  NR+ G++P  +  M  L  L L  N++TG IP+T   
Sbjct: 65  GVPHGVASSPSSLPMLEYLNLRGNRLAGAVPPAVYNMSRLRGLVLSHNNLTGWIPTTSNG 124

Query: 309 NTGMGIL---NLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDI 479
           +  + +L   ++S NGF G IP    +  Y   L +S N     VP  LA+  ++  L +
Sbjct: 125 SFHLPMLRTFSISSNGFAGRIPAGLAACRYLQTLSISSNSFVDVVPAWLAQLPYLTELFL 184

Query: 480 SNNHLCGNIPIG 515
             N L G+IP G
Sbjct: 185 GGNQLTGSIPPG 196

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 52/157 (33%), Positives = 73/157 (46%), Gaps = 10/157 (6%)
 Frame = +3

Query: 117 LSRNQLIGTIPDSVLK-MNRLADLDLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQI 290
           L  N L G IP  +L  M RL+ + L MN++TG +P  L      L+ + L  NS+TG +
Sbjct: 7   LGNNNLSGEIPPDLLHGMRRLSRIALHMNQLTGDLPPLLFNGTPSLTFVNLGNNSLTGGV 66

Query: 291 PSTLLSNTG----MGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVP---NSLA 449
           P  + S+      +  LNL  N   G +P    + S    L LS N LTG +P   N   
Sbjct: 67  PHGVASSPSSLPMLEYLNLRGNRLAGAVPPAVYNMSRLRGLVLSHNNLTGWIPTTSNGSF 126

Query: 450 KAKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
               +    IS+N   G IP G +   +L   S S+N
Sbjct: 127 HLPMLRTFSISSNGFAGRIPAGLAACRYLQTLSISSN 163

[66][TOP]
>UniRef100_Q53PD8 Leucine Rich Repeat family protein, expressed n=1 Tax=Oryza sativa
           Japonica Group RepID=Q53PD8_ORYSJ
          Length = 1003

 Score =  129 bits (323), Expect = 2e-28
 Identities = 69/190 (36%), Positives = 102/190 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +S L +L L +NQ  G LP   G  + L    +    + G IP  + K+  L  
Sbjct: 412 PSSLSNLSQLGYLYLQSNQFYGHLPPSLGNHKMLQELTIGYKNIQGMIPKEIFKIPSLLQ 471

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +DLS N + GSIP  +G  + L  L+L  N ++G IP++L ++  M I+ L RN F G+I
Sbjct: 472 IDLSFNNLDGSIPKEVGDAKQLMYLRLSSNKLSGDIPNSLGNSESMEIIMLDRNIFSGSI 531

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P    +     VL+LS N L+G +P SL   +F+  LD+S NHL G +P+   F +  A 
Sbjct: 532 PTSLDNILSLKVLNLSQNNLSGSIPPSLGNLQFLEKLDLSFNHLKGEVPVKGIFKNASAI 591

Query: 543 SFSNNDCLCG 572
               N+ LCG
Sbjct: 592 RIDGNEALCG 601

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 59/191 (30%), Positives = 90/191 (47%), Gaps = 25/191 (13%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           +   +GL    +S+N + G +PS  G L  +L + LL  NQL G  P     +  L  + 
Sbjct: 318 LANCTGLTDFSVSDNCLEGHVPSSLGNLSVQLQQFLLGGNQLSGVFPSGFQYLRNLISIS 377

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           +  N  +G +P  LG ++ L  + L  N  TG IPS+L + + +G L L  N F G +P 
Sbjct: 378 IDSNNFSGVLPEWLGSLQNLQLIGLYNNYFTGIIPSSLSNLSQLGYLYLQSNQFYGHLPP 437

Query: 369 VFGS-------------------KSYFMV-----LDLSFNKLTGRVPNSLAKAKFMGHLD 476
             G+                   K  F +     +DLSFN L G +P  +  AK + +L 
Sbjct: 438 SLGNHKMLQELTIGYKNIQGMIPKEIFKIPSLLQIDLSFNNLDGSIPKEVGDAKQLMYLR 497

Query: 477 ISNNHLCGNIP 509
           +S+N L G+IP
Sbjct: 498 LSSNKLSGDIP 508

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 60/192 (31%), Positives = 86/192 (44%), Gaps = 24/192 (12%)
 Frame = +3

Query: 6   MSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLI---------------- 137
           +S+  +  L  LDLSNN + G++P DF     L    LSRN L+                
Sbjct: 95  LSLGHLHRLETLDLSNNTLQGDIP-DFTNCSNLKSLWLSRNHLVGQFNSNFSPRLQDLIL 153

Query: 138 ------GTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPST 299
                 GTIP S+  +  L  L +  N I G+IP       +L  L  DGN + G+ P  
Sbjct: 154 ASNNITGTIPSSLANITSLQRLSIMDNNINGNIPHEFAGFPILQILYADGNKLAGRFPRA 213

Query: 300 LLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFMVLDLSFNK-LTGRVPNSLAKAKFMGHL 473
           +L+   +  L  S N   G IP ++F S       ++ +N    G +P+SLA A  +   
Sbjct: 214 ILNIFTIVGLAFSSNYLNGEIPSNLFDSLPEMQWFEVDYNNFFQGGIPSSLANASKLKVF 273

Query: 474 DISNNHLCGNIP 509
           DIS N+  G IP
Sbjct: 274 DISRNNFTGVIP 285

 Score = 77.8 bits (190), Expect = 6e-13
 Identities = 58/168 (34%), Positives = 76/168 (45%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L LS N   GE+    G L +L    LS N L G IPD     + L  L LS N + 
Sbjct: 79  LKFLSLSTNSFTGEIHLSLGHLHRLETLDLSNNTLQGDIPDFT-NCSNLKSLWLSRNHLV 137

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G           L  L L  N++TG IPS+L + T +  L++  N   G IP  F     
Sbjct: 138 GQFNSNFSPR--LQDLILASNNITGTIPSSLANITSLQRLSIMDNNINGNIPHEFAGFPI 195

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHL 533
             +L    NKL GR P ++     +  L  S+N+L G IP  + FD L
Sbjct: 196 LQILYADGNKLAGRFPRAILNIFTIVGLAFSSNYLNGEIP-SNLFDSL 242

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/178 (28%), Positives = 86/178 (48%), Gaps = 9/178 (5%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSD-FGKLRKLSRALLSRNQLI-GTIPDSVLKMNRL 176
           P +I+ I  ++ L  S+N + GE+PS+ F  L ++    +  N    G IP S+   ++L
Sbjct: 211 PRAILNIFTIVGLAFSSNYLNGEIPSNLFDSLPEMQWFEVDYNNFFQGGIPSSLANASKL 270

Query: 177 ADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTG------QIPSTLLSNTGMGILNLS 338
              D+S N  TG IP  +GK+  +  L L+ N +        +  S L + TG+   ++S
Sbjct: 271 KVFDISRNNFTGVIPCSIGKLTKVYWLNLEKNQLHARNKQDWEFMSCLANCTGLTDFSVS 330

Query: 339 RNGFEGTIPDVFGSKS-YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            N  EG +P   G+ S       L  N+L+G  P+     + +  + I +N+  G +P
Sbjct: 331 DNCLEGHVPSSLGNLSVQLQQFLLGGNQLSGVFPSGFQYLRNLISISIDSNNFSGVLP 388

 Score = 57.4 bits (137), Expect = 8e-07
 Identities = 42/135 (31%), Positives = 66/135 (48%), Gaps = 21/135 (15%)
 Frame = +3

Query: 168 NRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNG 347
           +R+  L+L+   + G I   LG M  L  L L  NS TG+I  +L     +  L+LS N 
Sbjct: 53  HRVISLNLTNRGLVGQISPALGNMTFLKFLSLSTNSFTGEIHLSLGHLHRLETLDLSNNT 112

Query: 348 FEGTIPD---------VFGSKSYFM------------VLDLSFNKLTGRVPNSLAKAKFM 464
            +G IPD         ++ S+++ +             L L+ N +TG +P+SLA    +
Sbjct: 113 LQGDIPDFTNCSNLKSLWLSRNHLVGQFNSNFSPRLQDLILASNNITGTIPSSLANITSL 172

Query: 465 GHLDISNNHLCGNIP 509
             L I +N++ GNIP
Sbjct: 173 QRLSIMDNNINGNIP 187

[67][TOP]
>UniRef100_Q2EZ15 Receptor kinase MRKa n=1 Tax=Oryza sativa Indica Group
            RepID=Q2EZ15_ORYSI
          Length = 1098

 Score =  129 bits (323), Expect = 2e-28
 Identities = 68/178 (38%), Positives = 100/178 (56%)
 Frame = +3

Query: 39   LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
            L L +N++ G +P D G L KL   +LS NQL  T+P S+  ++ L  LDLS N  +  +
Sbjct: 545  LFLQSNKLSGSIPKDMGNLTKLEHLVLSNNQLSSTVPPSIFHLSSLIQLDLSHNFFSDVL 604

Query: 219  PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
            PV +G M+ ++ + L  N  TG IP+++     +  LNLS N F+ +IPD FG  +    
Sbjct: 605  PVDIGNMKQINNIDLSTNRFTGSIPNSIGQLQMISYLNLSVNSFDDSIPDSFGELTSLQT 664

Query: 399  LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
            LDLS N ++G +P  LA    +  L++S N+L G IP G  F ++   S   N  LCG
Sbjct: 665  LDLSHNNISGTIPKYLANFTILISLNLSFNNLHGQIPKGGVFSNITLQSLVGNSGLCG 722

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 63/183 (34%), Positives = 94/183 (51%), Gaps = 3/183 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  L+L+N  + G +P+D G+L +L    L  N L G+IP ++  + RL  LDL  N
Sbjct: 101 LSFLSILNLTNTGLTGSVPNDIGRLHRLEILELGYNTLSGSIPATIGNLTRLQVLDLQFN 160

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFG 377
            ++G IP  L  ++ LS++ L  N + G IP+ L +NT  +  LN+  N   G IP   G
Sbjct: 161 SLSGPIPADLQNLQNLSSINLRRNYLIGLIPNNLFNNTHLLTYLNIGNNSLSGPIPGCIG 220

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFD--HLDAASFS 551
           S      L L  N LTG VP ++     +  L +  N L G +P  + F+   L   S +
Sbjct: 221 SLPILQTLVLQVNNLTGPVPPAIFNMSTLRALALGLNGLTGPLPGNASFNLPALQWFSIT 280

Query: 552 NND 560
            ND
Sbjct: 281 RND 283

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 52/169 (30%), Positives = 89/169 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  ++GLM L LS+NQ    +P    ++  L    LS N L G++P +   +     
Sbjct: 485 PSTISNLTGLMVLALSDNQFHSTIPESIMEMVNLRWLDLSGNSLAGSVPSNAGMLKNAEK 544

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+++GSIP  +G +  L  L L  N ++  +P ++   + +  L+LS N F   +
Sbjct: 545 LFLQSNKLSGSIPKDMGNLTKLEHLVLSNNQLSSTVPPSIFHLSSLIQLDLSHNFFSDVL 604

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+      +DLS N+ TG +PNS+ + + + +L++S N    +IP
Sbjct: 605 PVDIGNMKQINNIDLSTNRFTGSIPNSIGQLQMISYLNLSVNSFDDSIP 653

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 55/162 (33%), Positives = 83/162 (51%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L    ++ N++ GE+PS    L  L    LS NQ   TIP+S+++M  L  LDLS N 
Sbjct: 468 STLQSFVVAGNKLGGEIPSTISNLTGLMVLALSDNQFHSTIPESIMEMVNLRWLDLSGNS 527

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           + GS+P   G ++    L L  N ++G IP  + + T +  L LS N    T+P      
Sbjct: 528 LAGSVPSNAGMLKNAEKLFLQSNKLSGSIPKDMGNLTKLEHLVLSNNQLSSTVPPSIFHL 587

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           S  + LDLS N  +  +P  +   K + ++D+S N   G+IP
Sbjct: 588 SSLIQLDLSHNFFSDVLPVDIGNMKQINNIDLSTNRFTGSIP 629

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 51/158 (32%), Positives = 85/158 (53%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           LDL +  ++GEL    G L  LS   L+   L G++P+ + +++RL  L+L  N ++GSI
Sbjct: 83  LDLRDTPLLGELSPQLGNLSFLSILNLTNTGLTGSVPNDIGRLHRLEILELGYNTLSGSI 142

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFM 395
           P  +G +  L  L L  NS++G IP+ L +   +  +NL RN   G IP ++F +     
Sbjct: 143 PATIGNLTRLQVLDLQFNSLSGPIPADLQNLQNLSSINLRRNYLIGLIPNNLFNNTHLLT 202

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L++  N L+G +P  +     +  L +  N+L G +P
Sbjct: 203 YLNIGNNSLSGPIPGCIGSLPILQTLVLQVNNLTGPVP 240

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 54/174 (31%), Positives = 89/174 (51%), Gaps = 5/174 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  ++ L  LDL  N + G +P+D   L+ LS   L RN LIG IP+++     L  
Sbjct: 143 PATIGNLTRLQVLDLQFNSLSGPIPADLQNLQNLSSINLRRNYLIGLIPNNLFNNTHLLT 202

Query: 183 -LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L++  N ++G IP  +G + +L TL L  N++TG +P  + + + +  L L  NG  G 
Sbjct: 203 YLNIGNNSLSGPIPGCIGSLPILQTLVLQVNNLTGPVPPAIFNMSTLRALALGLNGLTGP 262

Query: 360 IPDVFGSKSY----FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+ S+         ++ N  TG +P  LA  +++  L + +N   G  P
Sbjct: 263 LP---GNASFNLPALQWFSITRNDFTGPIPVGLAACQYLQVLGLPDNLFQGAFP 313

 Score = 84.3 bits (207), Expect = 6e-15
 Identities = 47/121 (38%), Positives = 72/121 (59%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +S L+ LDLS+N     LP D G +++++   LS N+  G+IP+S+ ++  ++ 
Sbjct: 581 PPSIFHLSSLIQLDLSHNFFSDVLPVDIGNMKQINNIDLSTNRFTGSIPNSIGQLQMISY 640

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LS+N    SIP   G++  L TL L  N+++G IP  L + T +  LNLS N   G I
Sbjct: 641 LNLSVNSFDDSIPDSFGELTSLQTLDLSHNNISGTIPKYLANFTILISLNLSFNNLHGQI 700

Query: 363 P 365
           P
Sbjct: 701 P 701

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 61/221 (27%), Positives = 97/221 (43%), Gaps = 52/221 (23%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQI-IGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  + +++ L  + L  NQ+  G +P+  G L  LS   L+   L G IP  +  + +L+
Sbjct: 313 PPWLGKLTNLNIISLGGNQLDAGPIPAALGNLTMLSVLDLASCNLTGPIPADIRHLGQLS 372

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNG---- 347
           +L LSMN++TGSIP  +G +  LS L L GN + G +P+T+ +   +  LN++ N     
Sbjct: 373 ELHLSMNQLTGSIPASIGNLSALSYLLLMGNMLDGLVPATVGNINSLRGLNIAENHLQGD 432

Query: 348 ----------------------FEGTIPDVFGSKSY------------------------ 389
                                 F G +PD  G+ S                         
Sbjct: 433 LEFLSTVSNCRKLSFLRVDSNYFTGNLPDYVGNLSSTLQSFVVAGNKLGGEIPSTISNLT 492

Query: 390 -FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             MVL LS N+    +P S+ +   +  LD+S N L G++P
Sbjct: 493 GLMVLALSDNQFHSTIPESIMEMVNLRWLDLSGNSLAGSVP 533

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 50/172 (29%), Positives = 87/172 (50%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQL-IGTIPDSVLKMNRLA 179
           P+ +     L  L L +N   G  P   GKL  L+   L  NQL  G IP ++  +  L+
Sbjct: 289 PVGLAACQYLQVLGLPDNLFQGAFPPWLGKLTNLNIISLGGNQLDAGPIPAALGNLTMLS 348

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            LDL+   +TG IP  +  +  LS L L  N +TG IP+++ + + +  L L  N  +G 
Sbjct: 349 VLDLASCNLTGPIPADIRHLGQLSELHLSMNQLTGSIPASIGNLSALSYLLLMGNMLDGL 408

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+ +    L+++ N L G +   ++++  + +  L + +N+  GN+P
Sbjct: 409 VPATVGNINSLRGLNIAENHLQGDLEFLSTVSNCRKLSFLRVDSNYFTGNLP 460

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 52/181 (28%), Positives = 80/181 (44%), Gaps = 1/181 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +  L    ++ N   G +P      + L    L  N   G  P  + K+  L  + L  N
Sbjct: 271 LPALQWFSITRNDFTGPIPVGLAACQYLQVLGLPDNLFQGAFPPWLGKLTNLNIISLGGN 330

Query: 201 RI-TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
           ++  G IP  LG + +LS L L   ++TG IP+ +     +  L+LS N   G+IP   G
Sbjct: 331 QLDAGPIPAALGNLTMLSVLDLASCNLTGPIPADIRHLGQLSELHLSMNQLTGSIPASIG 390

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNN 557
           + S    L L  N L G VP ++     +  L+I+ NHL G++   S   +    SF   
Sbjct: 391 NLSALSYLLLMGNMLDGLVPATVGNINSLRGLNIAENHLQGDLEFLSTVSNCRKLSFLRV 450

Query: 558 D 560
           D
Sbjct: 451 D 451

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 37/113 (32%), Positives = 58/113 (51%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  LDL    + G +  +LG +  LS L L    +TG +P+ +     + IL L  N  
Sbjct: 79  RVTALDLRDTPLLGELSPQLGNLSFLSILNLTNTGLTGSVPNDIGRLHRLEILELGYNTL 138

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G+IP   G+ +   VLDL FN L+G +P  L   + +  +++  N+L G IP
Sbjct: 139 SGSIPATIGNLTRLQVLDLQFNSLSGPIPADLQNLQNLSSINLRRNYLIGLIP 191

[68][TOP]
>UniRef100_Q2EZ12 Receptor kinase TRKa n=1 Tax=Oryza sativa Indica Group
            RepID=Q2EZ12_ORYSI
          Length = 1098

 Score =  129 bits (323), Expect = 2e-28
 Identities = 68/178 (38%), Positives = 100/178 (56%)
 Frame = +3

Query: 39   LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
            L L +N++ G +P D G L KL   +LS NQL  T+P S+  ++ L  LDLS N  +  +
Sbjct: 545  LFLQSNKLSGSIPKDMGNLTKLEHLVLSNNQLSSTVPPSIFHLSSLIQLDLSHNFFSDVL 604

Query: 219  PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
            PV +G M+ ++ + L  N  TG IP+++     +  LNLS N F+ +IPD FG  +    
Sbjct: 605  PVDIGNMKQINNIDLSTNRFTGSIPNSIGQLQMISYLNLSVNSFDDSIPDSFGELTSLQT 664

Query: 399  LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
            LDLS N ++G +P  LA    +  L++S N+L G IP G  F ++   S   N  LCG
Sbjct: 665  LDLSHNNISGTIPKYLANFTILISLNLSFNNLHGQIPKGGVFSNITLQSLVGNSGLCG 722

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 64/183 (34%), Positives = 92/183 (50%), Gaps = 3/183 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  L+L+N  + G LP D G+L +L    L  N L G IP ++  + RL  LDL  N
Sbjct: 101 LSFLSILNLTNTGLTGSLPDDIGRLHRLEILELGYNTLSGRIPATIGNLTRLQVLDLQFN 160

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFG 377
            ++G IP  L  ++ LS++ L  N + G IP+ L +NT  +  LN+  N   G IP   G
Sbjct: 161 SLSGPIPADLQNLQNLSSINLRRNYLIGLIPNNLFNNTHLLTYLNIGNNSLSGPIPGCIG 220

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFD--HLDAASFS 551
           S      L L  N LTG VP ++     +  L +  N L G +P  + F+   L   S +
Sbjct: 221 SLPILQTLVLQVNNLTGPVPPAIFNMSTLRALALGLNGLTGPLPGNASFNLPALQWFSIT 280

Query: 552 NND 560
            ND
Sbjct: 281 RND 283

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 52/169 (30%), Positives = 89/169 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  ++GLM L LS+NQ    +P    ++  L    LS N L G++P +   +     
Sbjct: 485 PSTISNLTGLMVLALSDNQFHSTIPESIMEMVNLRWLDLSGNSLAGSVPSNAGMLKNAEK 544

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+++GSIP  +G +  L  L L  N ++  +P ++   + +  L+LS N F   +
Sbjct: 545 LFLQSNKLSGSIPKDMGNLTKLEHLVLSNNQLSSTVPPSIFHLSSLIQLDLSHNFFSDVL 604

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+      +DLS N+ TG +PNS+ + + + +L++S N    +IP
Sbjct: 605 PVDIGNMKQINNIDLSTNRFTGSIPNSIGQLQMISYLNLSVNSFDDSIP 653

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 55/162 (33%), Positives = 83/162 (51%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L    ++ N++ GE+PS    L  L    LS NQ   TIP+S+++M  L  LDLS N 
Sbjct: 468 STLQSFVVAGNKLGGEIPSTISNLTGLMVLALSDNQFHSTIPESIMEMVNLRWLDLSGNS 527

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           + GS+P   G ++    L L  N ++G IP  + + T +  L LS N    T+P      
Sbjct: 528 LAGSVPSNAGMLKNAEKLFLQSNKLSGSIPKDMGNLTKLEHLVLSNNQLSSTVPPSIFHL 587

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           S  + LDLS N  +  +P  +   K + ++D+S N   G+IP
Sbjct: 588 SSLIQLDLSHNFFSDVLPVDIGNMKQINNIDLSTNRFTGSIP 629

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 51/158 (32%), Positives = 84/158 (53%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           LDL +  ++GEL    G L  LS   L+   L G++PD + +++RL  L+L  N ++G I
Sbjct: 83  LDLRDTPLLGELSPQLGNLSFLSILNLTNTGLTGSLPDDIGRLHRLEILELGYNTLSGRI 142

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFM 395
           P  +G +  L  L L  NS++G IP+ L +   +  +NL RN   G IP ++F +     
Sbjct: 143 PATIGNLTRLQVLDLQFNSLSGPIPADLQNLQNLSSINLRRNYLIGLIPNNLFNNTHLLT 202

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L++  N L+G +P  +     +  L +  N+L G +P
Sbjct: 203 YLNIGNNSLSGPIPGCIGSLPILQTLVLQVNNLTGPVP 240

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 55/174 (31%), Positives = 89/174 (51%), Gaps = 5/174 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  ++ L  LDL  N + G +P+D   L+ LS   L RN LIG IP+++     L  
Sbjct: 143 PATIGNLTRLQVLDLQFNSLSGPIPADLQNLQNLSSINLRRNYLIGLIPNNLFNNTHLLT 202

Query: 183 -LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L++  N ++G IP  +G + +L TL L  N++TG +P  + + + +  L L  NG  G 
Sbjct: 203 YLNIGNNSLSGPIPGCIGSLPILQTLVLQVNNLTGPVPPAIFNMSTLRALALGLNGLTGP 262

Query: 360 IPDVFGSKSY----FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+ S+         ++ N  TG +P  LA  +++  L + NN   G  P
Sbjct: 263 LP---GNASFNLPALQWFSITRNDFTGPIPVGLAACQYLQVLGLPNNLFQGAFP 313

 Score = 84.3 bits (207), Expect = 6e-15
 Identities = 47/121 (38%), Positives = 72/121 (59%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +S L+ LDLS+N     LP D G +++++   LS N+  G+IP+S+ ++  ++ 
Sbjct: 581 PPSIFHLSSLIQLDLSHNFFSDVLPVDIGNMKQINNIDLSTNRFTGSIPNSIGQLQMISY 640

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LS+N    SIP   G++  L TL L  N+++G IP  L + T +  LNLS N   G I
Sbjct: 641 LNLSVNSFDDSIPDSFGELTSLQTLDLSHNNISGTIPKYLANFTILISLNLSFNNLHGQI 700

Query: 363 P 365
           P
Sbjct: 701 P 701

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 60/221 (27%), Positives = 96/221 (43%), Gaps = 52/221 (23%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQI-IGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  + +++ L  + L  NQ+  G +P+  G L  LS   L+   L G IP  +  + +L+
Sbjct: 313 PPWLGKLTNLNIVSLGGNQLDAGPIPAALGNLTMLSVLDLASCNLTGPIPADIRHLGQLS 372

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNG---- 347
           +L LSMN++TG IP  +G +  LS L L GN + G +P+T+ +   +  LN++ N     
Sbjct: 373 ELHLSMNQLTGPIPASIGNLSALSYLLLMGNMLDGLVPATVGNMNSLRGLNIAENHLQGD 432

Query: 348 ----------------------FEGTIPDVFGSKSY------------------------ 389
                                 F G +PD  G+ S                         
Sbjct: 433 LEFLSTVSNCRKLSFLRVDSNYFTGNLPDYVGNLSSTLQSFVVAGNKLGGEIPSTISNLT 492

Query: 390 -FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             MVL LS N+    +P S+ +   +  LD+S N L G++P
Sbjct: 493 GLMVLALSDNQFHSTIPESIMEMVNLRWLDLSGNSLAGSVP 533

 Score = 77.8 bits (190), Expect = 6e-13
 Identities = 51/172 (29%), Positives = 87/172 (50%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQL-IGTIPDSVLKMNRLA 179
           P+ +     L  L L NN   G  P   GKL  L+   L  NQL  G IP ++  +  L+
Sbjct: 289 PVGLAACQYLQVLGLPNNLFQGAFPPWLGKLTNLNIVSLGGNQLDAGPIPAALGNLTMLS 348

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            LDL+   +TG IP  +  +  LS L L  N +TG IP+++ + + +  L L  N  +G 
Sbjct: 349 VLDLASCNLTGPIPADIRHLGQLSELHLSMNQLTGPIPASIGNLSALSYLLLMGNMLDGL 408

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+ +    L+++ N L G +   ++++  + +  L + +N+  GN+P
Sbjct: 409 VPATVGNMNSLRGLNIAENHLQGDLEFLSTVSNCRKLSFLRVDSNYFTGNLP 460

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 52/181 (28%), Positives = 79/181 (43%), Gaps = 1/181 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +  L    ++ N   G +P      + L    L  N   G  P  + K+  L  + L  N
Sbjct: 271 LPALQWFSITRNDFTGPIPVGLAACQYLQVLGLPNNLFQGAFPPWLGKLTNLNIVSLGGN 330

Query: 201 RI-TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
           ++  G IP  LG + +LS L L   ++TG IP+ +     +  L+LS N   G IP   G
Sbjct: 331 QLDAGPIPAALGNLTMLSVLDLASCNLTGPIPADIRHLGQLSELHLSMNQLTGPIPASIG 390

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNN 557
           + S    L L  N L G VP ++     +  L+I+ NHL G++   S   +    SF   
Sbjct: 391 NLSALSYLLLMGNMLDGLVPATVGNMNSLRGLNIAENHLQGDLEFLSTVSNCRKLSFLRV 450

Query: 558 D 560
           D
Sbjct: 451 D 451

[69][TOP]
>UniRef100_Q0JPD9 Os01g0228200 protein n=1 Tax=Oryza sativa Japonica Group
            RepID=Q0JPD9_ORYSJ
          Length = 1369

 Score =  129 bits (323), Expect = 2e-28
 Identities = 72/192 (37%), Positives = 100/192 (52%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I  +S L  LDL  N++ G +P   G L +L   +LS NQL  TIP S   + +L  
Sbjct: 816  PTQIGMLSSLQRLDLQRNRLFGSIPDSIGNLSELEHIMLSHNQLNSTIPASFFNLGKLVR 875

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N  TG++P  L +++   T+ L  NS+ G IP +      +  LNLS N F  +I
Sbjct: 876  LNLSHNSFTGALPNDLSRLKQGDTIDLSSNSLLGSIPESFGQIRMLTYLNLSHNSFGDSI 935

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  F   +    LDLS N L+G +P  LA   ++  L++S N L G IP G  F ++   
Sbjct: 936  PYSFQELANLATLDLSSNNLSGTIPKFLANFTYLTALNLSFNRLEGQIPDGGVFSNITLQ 995

Query: 543  SFSNNDCLCGNP 578
            S   N  LCG P
Sbjct: 996  SLIGNAALCGAP 1007

 Score =  102 bits (255), Expect = 2e-20
 Identities = 58/154 (37%), Positives = 85/154 (55%)
 Frame = +3

Query: 48   SNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVR 227
            S N++ G LPS    L  L +  L  NQL G IP+S+  M  L  LD+S N I+G IP +
Sbjct: 759  SENKLTGGLPSSLSNLSSLEQLQLPGNQLTGPIPESITMMPNLVRLDVSSNDISGPIPTQ 818

Query: 228  LGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDL 407
            +G +  L  L L  N + G IP ++ + + +  + LS N    TIP  F +    + L+L
Sbjct: 819  IGMLSSLQRLDLQRNRLFGSIPDSIGNLSELEHIMLSHNQLNSTIPASFFNLGKLVRLNL 878

Query: 408  SFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            S N  TG +PN L++ K    +D+S+N L G+IP
Sbjct: 879  SHNSFTGALPNDLSRLKQGDTIDLSSNSLLGSIP 912

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 62/196 (31%), Positives = 96/196 (48%), Gaps = 4/196 (2%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +     L  L +S+N  +  +P+   +L  L+   L  NQL G+IP  +  +  +  
Sbjct: 573  PAGLAACRYLQTLSISSNSFVDVVPAWLAQLPYLTELFLGGNQLTGSIPPGLGNLTGVTS 632

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS   +TG IP  LG MR LSTL+L  N +TG IP++L + + +  L+L  N   G +
Sbjct: 633  LDLSFCNLTGEIPSELGLMRSLSTLRLTYNQLTGPIPTSLGNLSQLSFLDLQMNQLTGAV 692

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP--IGSPFDH 530
            P   G+      L LS N L G +   +SL+  + +  + + +N   G++P   G+    
Sbjct: 693  PATLGNIPALNWLTLSLNNLEGNLGFLSSLSNCRQIWIITLDSNSFTGDLPDHTGNLSAQ 752

Query: 531  LDAASFSNNDCLCGNP 578
            L   S S N    G P
Sbjct: 753  LSIFSASENKLTGGLP 768

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 53/159 (33%), Positives = 82/159 (51%)
 Frame = +3

Query: 30   LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
            L    +S+N   G +P+     R L    +S N  +  +P  + ++  L +L L  N++T
Sbjct: 558  LRTFSISSNGFAGRIPAGLAACRYLQTLSISSNSFVDVVPAWLAQLPYLTELFLGGNQLT 617

Query: 210  GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
            GSIP  LG +  +++L L   ++TG+IPS L     +  L L+ N   G IP   G+ S 
Sbjct: 618  GSIPPGLGNLTGVTSLDLSFCNLTGEIPSELGLMRSLSTLRLTYNQLTGPIPTSLGNLSQ 677

Query: 390  FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
               LDL  N+LTG VP +L     +  L +S N+L GN+
Sbjct: 678  LSFLDLQMNQLTGAVPATLGNIPALNWLTLSLNNLEGNL 716

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 59/172 (34%), Positives = 88/172 (51%), Gaps = 6/172 (3%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  LDL+N  ++G +P+D G+LR+L   LL  N L   IP ++  +  L  L L  N
Sbjct: 378 LSFLYTLDLTNTSLVGPVPADLGRLRRLRSLLLGDNLLSAAIPPAIANLTMLELLHLGNN 437

Query: 201 RITGSIPV-RLGKMRVLSTLKLDGNSMTGQIPSTLLSNT-GMGILNLSRNGFEGTIPDVF 374
            ++G IP   L  MR LS + L  N +TG +P  L + T  +  +NL  N   G +P   
Sbjct: 438 NLSGEIPPDLLHGMRRLSRIALHMNQLTGDLPPLLFNGTPSLTFVNLGNNSLTGGVPHGV 497

Query: 375 GSKSYFM----VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGS 518
            S    +     L+L  N+L G VP ++     +  L +S+N+L G IP  S
Sbjct: 498 ASSPSSLPMLEYLNLRGNRLAGAVPPAVYNMSRLRGLVLSHNNLTGWIPTTS 549

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 58/196 (29%), Positives = 89/196 (45%), Gaps = 27/196 (13%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQL---------------- 134
            P S+  +S L  LDL  NQ+ G +P+  G +  L+   LS N L                
Sbjct: 669  PTSLGNLSQLSFLDLQMNQLTGAVPATLGNIPALNWLTLSLNNLEGNLGFLSSLSNCRQI 728

Query: 135  ----------IGTIPDSVLKMN-RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMT 281
                       G +PD    ++ +L+    S N++TG +P  L  +  L  L+L GN +T
Sbjct: 729  WIITLDSNSFTGDLPDHTGNLSAQLSIFSASENKLTGGLPSSLSNLSSLEQLQLPGNQLT 788

Query: 282  GQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF 461
            G IP ++     +  L++S N   G IP   G  S    LDL  N+L G +P+S+     
Sbjct: 789  GPIPESITMMPNLVRLDVSSNDISGPIPTQIGMLSSLQRLDLQRNRLFGSIPDSIGNLSE 848

Query: 462  MGHLDISNNHLCGNIP 509
            + H+ +S+N L   IP
Sbjct: 849  LEHIMLSHNQLNSTIP 864

 Score = 85.1 bits (209), Expect = 4e-15
 Identities = 56/172 (32%), Positives = 81/172 (47%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFG---KLRKLSRALLSRNQLIGTIPDSVLKMNR 173
            P ++  +S L  L LS+N + G +P+       L  L    +S N   G IP  +     
Sbjct: 522  PPAVYNMSRLRGLVLSHNNLTGWIPTTSNGSFHLPMLRTFSISSNGFAGRIPAGLAACRY 581

Query: 174  LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
            L  L +S N     +P  L ++  L+ L L GN +TG IP  L + TG+  L+LS     
Sbjct: 582  LQTLSISSNSFVDVVPAWLAQLPYLTELFLGGNQLTGSIPPGLGNLTGVTSLDLSFCNLT 641

Query: 354  GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G IP   G       L L++N+LTG +P SL     +  LD+  N L G +P
Sbjct: 642  GEIPSELGLMRSLSTLRLTYNQLTGPIPTSLGNLSQLSFLDLQMNQLTGAVP 693

 Score = 80.5 bits (197), Expect = 9e-14
 Identities = 62/204 (30%), Positives = 91/204 (44%), Gaps = 33/204 (16%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSD-FGKLRKLSRALLSRNQLIGTIP---------- 149
            P +I  ++ L  L L NN + GE+P D    +R+LSR  L  NQL G +P          
Sbjct: 420  PPAIANLTMLELLHLGNNNLSGEIPPDLLHGMRRLSRIALHMNQLTGDLPPLLFNGTPSL 479

Query: 150  -------------------DSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGN 272
                                S   +  L  L+L  NR+ G++P  +  M  L  L L  N
Sbjct: 480  TFVNLGNNSLTGGVPHGVASSPSSLPMLEYLNLRGNRLAGAVPPAVYNMSRLRGLVLSHN 539

Query: 273  SMTGQIPSTLLSNTGMGIL---NLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNS 443
            ++TG IP+T   +  + +L   ++S NGF G IP    +  Y   L +S N     VP  
Sbjct: 540  NLTGWIPTTSNGSFHLPMLRTFSISSNGFAGRIPAGLAACRYLQTLSISSNSFVDVVPAW 599

Query: 444  LAKAKFMGHLDISNNHLCGNIPIG 515
            LA+  ++  L +  N L G+IP G
Sbjct: 600  LAQLPYLTELFLGGNQLTGSIPPG 623

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 51/174 (29%), Positives = 85/174 (48%), Gaps = 10/174 (5%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           R++GL    L +  + GEL +  G L  L    L+   L+G +P  + ++ RL  L L  
Sbjct: 356 RVTGL---SLPDAPLGGELTAHLGNLSFLYTLDLTNTSLVGPVPADLGRLRRLRSLLLGD 412

Query: 198 NRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR-----NGFEGTI 362
           N ++ +IP  +  + +L  L L  N+++G+IP  LL     G+  LSR     N   G +
Sbjct: 413 NLLSAAIPPAIANLTMLELLHLGNNNLSGEIPPDLLH----GMRRLSRIALHMNQLTGDL 468

Query: 363 PD-VFGSKSYFMVLDLSFNKLTGRVPNSLAKA----KFMGHLDISNNHLCGNIP 509
           P  +F        ++L  N LTG VP+ +A +      + +L++  N L G +P
Sbjct: 469 PPLLFNGTPSLTFVNLGNNSLTGGVPHGVASSPSSLPMLEYLNLRGNRLAGAVP 522

[70][TOP]
>UniRef100_B9GRE8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GRE8_POPTR
          Length = 1202

 Score =  129 bits (323), Expect = 2e-28
 Identities = 73/191 (38%), Positives = 106/191 (55%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  + ++  L  L L +N + G +P++ G L +L    LS NQL G +P S+  +  L  
Sbjct: 645  PAELGKLPQLRVLSLGSNDLAGRIPAELGNLSRLFMLNLSNNQLTGEVPQSLTSLEGLEY 704

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLS-NTGMGILNLSRNGFEGT 359
            LDLS N++TG+I   LG    LS+L L  N++ G+IP  L + N+   +L+LS N   G 
Sbjct: 705  LDLSDNKLTGNISKELGSYEKLSSLDLSHNNLAGEIPFELGNLNSLRYLLDLSSNSLSGA 764

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
            IP  F   S   +L++S N L+GR+P+SL+    +   D S N L G +P GS F +  A
Sbjct: 765  IPQNFAKLSQLEILNVSHNHLSGRIPDSLSSMLSLSSFDFSYNELTGPLPSGSVFKNASA 824

Query: 540  ASFSNNDCLCG 572
             SF  N  LCG
Sbjct: 825  RSFVGNSGLCG 835

 Score =  103 bits (257), Expect = 1e-20
 Identities = 62/188 (32%), Positives = 99/188 (52%), Gaps = 3/188 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGEL-PSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P+S+  +S +  + LS N + GE+ P+      +L    +  N   G IP  + K+  L 
Sbjct: 355 PLSLSNLSKIADMGLSENSLSGEISPTLISNWTELISLQVQNNLFSGNIPPEIGKLTMLQ 414

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N  +GSIP  +G ++ L +L L GN ++G +P  L + T + ILNL  N   G 
Sbjct: 415 YLFLYNNTFSGSIPPEIGNLKELLSLDLSGNQLSGPLPPALWNLTNLQILNLFSNNINGK 474

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHL 533
           IP   G+ +   +LDL+ N+L G +P +++    +  +++  N+L G+IP   G     L
Sbjct: 475 IPPEVGNLTMLQILDLNTNQLHGELPLTISDITSLTSINLFGNNLSGSIPSDFGKYMPSL 534

Query: 534 DAASFSNN 557
             ASFSNN
Sbjct: 535 AYASFSNN 542

 Score =  103 bits (257), Expect = 1e-20
 Identities = 62/169 (36%), Positives = 85/169 (50%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +   S L  + L  N+  G +   FG L  L    LS NQ IG I     +   L +
Sbjct: 573  PTCLRNCSELSRVRLEKNRFTGNITDAFGVLPNLVFVALSDNQFIGEISPDWGECKNLTN 632

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L +  NRI+G IP  LGK+  L  L L  N + G+IP+ L + + + +LNLS N   G +
Sbjct: 633  LQMDGNRISGEIPAELGKLPQLRVLSLGSNDLAGRIPAELGNLSRLFMLNLSNNQLTGEV 692

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            P    S      LDLS NKLTG +   L   + +  LD+S+N+L G IP
Sbjct: 693  PQSLTSLEGLEYLDLSDNKLTGNISKELGSYEKLSSLDLSHNNLAGEIP 741

 Score =  103 bits (256), Expect = 1e-20
 Identities = 63/188 (33%), Positives = 102/188 (54%), Gaps = 2/188 (1%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  + R   L    +++N   G LP+      +LSR  L +N+  G I D+   +  L  
Sbjct: 549  PPELCRGRSLQQFTVNSNSFTGSLPTCLRNCSELSRVRLEKNRFTGNITDAFGVLPNLVF 608

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            + LS N+  G I    G+ + L+ L++DGN ++G+IP+ L     + +L+L  N   G I
Sbjct: 609  VALSDNQFIGEISPDWGECKNLTNLQMDGNRISGEIPAELGKLPQLRVLSLGSNDLAGRI 668

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI--PIGSPFDHLD 536
            P   G+ S   +L+LS N+LTG VP SL   + + +LD+S+N L GNI   +GS ++ L 
Sbjct: 669  PAELGNLSRLFMLNLSNNQLTGEVPQSLTSLEGLEYLDLSDNKLTGNISKELGS-YEKLS 727

Query: 537  AASFSNND 560
            +   S+N+
Sbjct: 728  SLDLSHNN 735

 Score = 93.6 bits (231), Expect = 1e-17
 Identities = 57/170 (33%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  ISGL  ++L  N   G +P   G+L+ L +  L  N L  TIP  +     L  
Sbjct: 283 PESIGSISGLQIVELLGNSFQGNIPPSIGQLKHLEKLDLRMNALNSTIPPELGLCTNLTY 342

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN-TGMGILNLSRNGFEGT 359
           L L+ N+++G +P+ L  +  ++ + L  NS++G+I  TL+SN T +  L +  N F G 
Sbjct: 343 LALADNQLSGELPLSLSNLSKIADMGLSENSLSGEISPTLISNWTELISLQVQNNLFSGN 402

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G  +    L L  N  +G +P  +   K +  LD+S N L G +P
Sbjct: 403 IPPEIGKLTMLQYLFLYNNTFSGSIPPEIGNLKELLSLDLSGNQLSGPLP 452

 Score = 80.9 bits (198), Expect = 7e-14
 Identities = 49/162 (30%), Positives = 78/162 (48%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVL-KMNRLADLDLSMNRI 206
           L +L    N++  E P      R L+   LS N+  G IP+ V   + +L  L+L  N  
Sbjct: 195 LEYLSFFLNELTAEFPHFITNCRNLTFLDLSLNKFTGQIPELVYTNLGKLEALNLYNNSF 254

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
            G +   + K+  L  + L  N + GQIP ++ S +G+ I+ L  N F+G IP   G   
Sbjct: 255 QGPLSSNISKLSNLKNISLQYNLLRGQIPESIGSISGLQIVELLGNSFQGNIPPSIGQLK 314

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           +   LDL  N L   +P  L     + +L +++N L G +P+
Sbjct: 315 HLEKLDLRMNALNSTIPPELGLCTNLTYLALADNQLSGELPL 356

 Score = 80.9 bits (198), Expect = 7e-14
 Identities = 52/169 (30%), Positives = 81/169 (47%), Gaps = 1/169 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPS-DFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I     L  LDLS N+  G++P   +  L KL    L  N   G +  ++ K++ L 
Sbjct: 210 PHFITNCRNLTFLDLSLNKFTGQIPELVYTNLGKLEALNLYNNSFQGPLSSNISKLSNLK 269

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           ++ L  N + G IP  +G +  L  ++L GNS  G IP ++     +  L+L  N    T
Sbjct: 270 NISLQYNLLRGQIPESIGSISGLQIVELLGNSFQGNIPPSIGQLKHLEKLDLRMNALNST 329

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           IP   G  +    L L+ N+L+G +P SL+    +  + +S N L G I
Sbjct: 330 IPPELGLCTNLTYLALADNQLSGELPLSLSNLSKIADMGLSENSLSGEI 378

 Score = 74.7 bits (182), Expect = 5e-12
 Identities = 51/158 (32%), Positives = 77/158 (48%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+L NN   G L S+  KL  L    L  N L G IP+S+  ++ L  ++L  N   G+I
Sbjct: 247 LNLYNNSFQGPLSSNISKLSNLKNISLQYNLLRGQIPESIGSISGLQIVELLGNSFQGNI 306

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  +G+++ L  L L  N++   IP  L   T +  L L+ N   G +P    + S    
Sbjct: 307 PPSIGQLKHLEKLDLRMNALNSTIPPELGLCTNLTYLALADNQLSGELPLSLSNLSKIAD 366

Query: 399 LDLSFNKLTGRV-PNSLAKAKFMGHLDISNNHLCGNIP 509
           + LS N L+G + P  ++    +  L + NN   GNIP
Sbjct: 367 MGLSENSLSGEISPTLISNWTELISLQVQNNLFSGNIP 404

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 54/208 (25%), Positives = 81/208 (38%), Gaps = 48/208 (23%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L   D+ +N + G +PS  G L KL+   LS N   G+IP  + ++  L  L L  N + 
Sbjct: 100 LTRFDIQSNNVNGTIPSAIGSLSKLTHLDLSANFFEGSIPVEISQLTELQYLSLYNNNLN 159

Query: 210 GSIPVRLGKM-----------------------------------------------RVL 248
           G IP +L  +                                               R L
Sbjct: 160 GIIPFQLANLPKVRHLDLGANYLENPDWSKFSMPSLEYLSFFLNELTAEFPHFITNCRNL 219

Query: 249 STLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLT 425
           + L L  N  TGQIP  + +N G +  LNL  N F+G +       S    + L +N L 
Sbjct: 220 TFLDLSLNKFTGQIPELVYTNLGKLEALNLYNNSFQGPLSSNISKLSNLKNISLQYNLLR 279

Query: 426 GRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G++P S+     +  +++  N   GNIP
Sbjct: 280 GQIPESIGSISGLQIVELLGNSFQGNIP 307

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 53/176 (30%), Positives = 83/176 (47%), Gaps = 3/176 (1%)
 Frame = +3

Query: 39  LDLSNNQIIGELPS-DFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGS 215
           ++L +  I G L   +F     L+R  +  N + GTIP ++  +++L  LDLS N   GS
Sbjct: 78  INLRSLNITGTLAHFNFTPFTDLTRFDIQSNNVNGTIPSAIGSLSKLTHLDLSANFFEGS 137

Query: 216 IPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFM 395
           IPV + ++  L  L L  N++ G IP  L +   +  L+L  N  E      F   S   
Sbjct: 138 IPVEISQLTELQYLSLYNNNLNGIIPFQLANLPKVRHLDLGANYLENPDWSKFSMPS-LE 196

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAASFSNN 557
            L    N+LT   P+ +   + +  LD+S N   G IP  + +    L+A +  NN
Sbjct: 197 YLSFFLNELTAEFPHFITNCRNLTFLDLSLNKFTGQIPELVYTNLGKLEALNLYNN 252

[71][TOP]
>UniRef100_B9EUG6 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=B9EUG6_ORYSJ
          Length = 1040

 Score =  129 bits (323), Expect = 2e-28
 Identities = 72/192 (37%), Positives = 100/192 (52%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I  +S L  LDL  N++ G +P   G L +L   +LS NQL  TIP S   + +L  
Sbjct: 487  PTQIGMLSSLQRLDLQRNRLFGSIPDSIGNLSELEHIMLSHNQLNSTIPASFFNLGKLVR 546

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N  TG++P  L +++   T+ L  NS+ G IP +      +  LNLS N F  +I
Sbjct: 547  LNLSHNSFTGALPNDLSRLKQGDTIDLSSNSLLGSIPESFGQIRMLTYLNLSHNSFGDSI 606

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  F   +    LDLS N L+G +P  LA   ++  L++S N L G IP G  F ++   
Sbjct: 607  PYSFQELANLATLDLSSNNLSGTIPKFLANFTYLTALNLSFNRLEGQIPDGGVFSNITLQ 666

Query: 543  SFSNNDCLCGNP 578
            S   N  LCG P
Sbjct: 667  SLIGNAALCGAP 678

 Score =  102 bits (255), Expect = 2e-20
 Identities = 58/154 (37%), Positives = 85/154 (55%)
 Frame = +3

Query: 48  SNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVR 227
           S N++ G LPS    L  L +  L  NQL G IP+S+  M  L  LD+S N I+G IP +
Sbjct: 430 SENKLTGGLPSSLSNLSSLEQLQLPGNQLTGPIPESITMMPNLVRLDVSSNDISGPIPTQ 489

Query: 228 LGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDL 407
           +G +  L  L L  N + G IP ++ + + +  + LS N    TIP  F +    + L+L
Sbjct: 490 IGMLSSLQRLDLQRNRLFGSIPDSIGNLSELEHIMLSHNQLNSTIPASFFNLGKLVRLNL 549

Query: 408 SFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           S N  TG +PN L++ K    +D+S+N L G+IP
Sbjct: 550 SHNSFTGALPNDLSRLKQGDTIDLSSNSLLGSIP 583

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 62/196 (31%), Positives = 96/196 (48%), Gaps = 4/196 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +     L  L +S+N  +  +P+   +L  L+   L  NQL G+IP  +  +  +  
Sbjct: 244 PAGLAACRYLQTLSISSNSFVDVVPAWLAQLPYLTELFLGGNQLTGSIPPGLGNLTGVTS 303

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS   +TG IP  LG MR LSTL+L  N +TG IP++L + + +  L+L  N   G +
Sbjct: 304 LDLSFCNLTGEIPSELGLMRSLSTLRLTYNQLTGPIPTSLGNLSQLSFLDLQMNQLTGAV 363

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP--IGSPFDH 530
           P   G+      L LS N L G +   +SL+  + +  + + +N   G++P   G+    
Sbjct: 364 PATLGNIPALNWLTLSLNNLEGNLGFLSSLSNCRQIWIITLDSNSFTGDLPDHTGNLSAQ 423

Query: 531 LDAASFSNNDCLCGNP 578
           L   S S N    G P
Sbjct: 424 LSIFSASENKLTGGLP 439

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 53/159 (33%), Positives = 82/159 (51%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L    +S+N   G +P+     R L    +S N  +  +P  + ++  L +L L  N++T
Sbjct: 229 LRTFSISSNGFAGRIPAGLAACRYLQTLSISSNSFVDVVPAWLAQLPYLTELFLGGNQLT 288

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           GSIP  LG +  +++L L   ++TG+IPS L     +  L L+ N   G IP   G+ S 
Sbjct: 289 GSIPPGLGNLTGVTSLDLSFCNLTGEIPSELGLMRSLSTLRLTYNQLTGPIPTSLGNLSQ 348

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
              LDL  N+LTG VP +L     +  L +S N+L GN+
Sbjct: 349 LSFLDLQMNQLTGAVPATLGNIPALNWLTLSLNNLEGNL 387

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 58/196 (29%), Positives = 89/196 (45%), Gaps = 27/196 (13%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQL---------------- 134
           P S+  +S L  LDL  NQ+ G +P+  G +  L+   LS N L                
Sbjct: 340 PTSLGNLSQLSFLDLQMNQLTGAVPATLGNIPALNWLTLSLNNLEGNLGFLSSLSNCRQI 399

Query: 135 ----------IGTIPDSVLKMN-RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMT 281
                      G +PD    ++ +L+    S N++TG +P  L  +  L  L+L GN +T
Sbjct: 400 WIITLDSNSFTGDLPDHTGNLSAQLSIFSASENKLTGGLPSSLSNLSSLEQLQLPGNQLT 459

Query: 282 GQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF 461
           G IP ++     +  L++S N   G IP   G  S    LDL  N+L G +P+S+     
Sbjct: 460 GPIPESITMMPNLVRLDVSSNDISGPIPTQIGMLSSLQRLDLQRNRLFGSIPDSIGNLSE 519

Query: 462 MGHLDISNNHLCGNIP 509
           + H+ +S+N L   IP
Sbjct: 520 LEHIMLSHNQLNSTIP 535

 Score = 85.1 bits (209), Expect = 4e-15
 Identities = 56/172 (32%), Positives = 81/172 (47%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG---KLRKLSRALLSRNQLIGTIPDSVLKMNR 173
           P ++  +S L  L LS+N + G +P+       L  L    +S N   G IP  +     
Sbjct: 193 PPAVYNMSRLRGLVLSHNNLTGWIPTTSNGSFHLPMLRTFSISSNGFAGRIPAGLAACRY 252

Query: 174 LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L  L +S N     +P  L ++  L+ L L GN +TG IP  L + TG+  L+LS     
Sbjct: 253 LQTLSISSNSFVDVVPAWLAQLPYLTELFLGGNQLTGSIPPGLGNLTGVTSLDLSFCNLT 312

Query: 354 GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G IP   G       L L++N+LTG +P SL     +  LD+  N L G +P
Sbjct: 313 GEIPSELGLMRSLSTLRLTYNQLTGPIPTSLGNLSQLSFLDLQMNQLTGAVP 364

 Score = 74.7 bits (182), Expect = 5e-12
 Identities = 55/170 (32%), Positives = 81/170 (47%), Gaps = 8/170 (4%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSD-FGKLRKLSRALLSRNQLIGTIPDSVLK----MNRLADLDLS 194
           L  + L  NQ+ G+LP   F     L+   L  N L G +P  V      +  L  L+L 
Sbjct: 125 LSRIALHMNQLTGDLPPLLFNGTPSLTFVNLGNNSLTGGVPHGVASSPSSLPMLEYLNLR 184

Query: 195 MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGIL---NLSRNGFEGTIP 365
            NR+ G++P  +  M  L  L L  N++TG IP+T   +  + +L   ++S NGF G IP
Sbjct: 185 GNRLAGAVPPAVYNMSRLRGLVLSHNNLTGWIPTTSNGSFHLPMLRTFSISSNGFAGRIP 244

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
               +  Y   L +S N     VP  LA+  ++  L +  N L G+IP G
Sbjct: 245 AGLAACRYLQTLSISSNSFVDVVPAWLAQLPYLTELFLGGNQLTGSIPPG 294

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 47/146 (32%), Positives = 68/146 (46%), Gaps = 9/146 (6%)
 Frame = +3

Query: 147 PDSVLKMNRLADLDLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTG-- 317
           PD +  M RL+ + L MN++TG +P  L      L+ + L  NS+TG +P  + S+    
Sbjct: 116 PDLLHGMRRLSRIALHMNQLTGDLPPLLFNGTPSLTFVNLGNNSLTGGVPHGVASSPSSL 175

Query: 318 --MGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVP---NSLAKAKFMGHLDIS 482
             +  LNL  N   G +P    + S    L LS N LTG +P   N       +    IS
Sbjct: 176 PMLEYLNLRGNRLAGAVPPAVYNMSRLRGLVLSHNNLTGWIPTTSNGSFHLPMLRTFSIS 235

Query: 483 NNHLCGNIPIG-SPFDHLDAASFSNN 557
           +N   G IP G +   +L   S S+N
Sbjct: 236 SNGFAGRIPAGLAACRYLQTLSISSN 261

[72][TOP]
>UniRef100_B8BIG9 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8BIG9_ORYSI
          Length = 695

 Score =  129 bits (323), Expect = 2e-28
 Identities = 68/178 (38%), Positives = 100/178 (56%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L +N++ G +P D G L KL   +LS NQL  T+P S+  ++ L  LDLS N  +  +
Sbjct: 142 LFLQSNKLSGSIPKDMGNLTKLEHLVLSNNQLSSTVPPSIFHLSSLIQLDLSHNFFSDVL 201

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           PV +G M+ ++ + L  N  TG IP+++     +  LNLS N F+ +IPD FG  +    
Sbjct: 202 PVDIGNMKQINNIDLSTNRFTGSIPNSIGQLQMISYLNLSVNSFDDSIPDSFGELTSLQT 261

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
           LDLS N ++G +P  LA    +  L++S N+L G IP G  F ++   S   N  LCG
Sbjct: 262 LDLSHNNISGTIPKYLANFTILISLNLSFNNLHGQIPKGGVFSNITLQSLVGNSGLCG 319

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 52/169 (30%), Positives = 89/169 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  ++GLM L LS+NQ    +P    ++  L    LS N L G++P +   +     
Sbjct: 82  PSTISNLTGLMVLALSDNQFHSTIPESIMEMVNLRWLDLSGNSLAGSVPSNAGMLKNAEK 141

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+++GSIP  +G +  L  L L  N ++  +P ++   + +  L+LS N F   +
Sbjct: 142 LFLQSNKLSGSIPKDMGNLTKLEHLVLSNNQLSSTVPPSIFHLSSLIQLDLSHNFFSDVL 201

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+      +DLS N+ TG +PNS+ + + + +L++S N    +IP
Sbjct: 202 PVDIGNMKQINNIDLSTNRFTGSIPNSIGQLQMISYLNLSVNSFDDSIP 250

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 55/162 (33%), Positives = 83/162 (51%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L    ++ N++ GE+PS    L  L    LS NQ   TIP+S+++M  L  LDLS N 
Sbjct: 65  STLQSFVVAGNKLGGEIPSTISNLTGLMVLALSDNQFHSTIPESIMEMVNLRWLDLSGNS 124

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           + GS+P   G ++    L L  N ++G IP  + + T +  L LS N    T+P      
Sbjct: 125 LAGSVPSNAGMLKNAEKLFLQSNKLSGSIPKDMGNLTKLEHLVLSNNQLSSTVPPSIFHL 184

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           S  + LDLS N  +  +P  +   K + ++D+S N   G+IP
Sbjct: 185 SSLIQLDLSHNFFSDVLPVDIGNMKQINNIDLSTNRFTGSIP 226

 Score = 84.3 bits (207), Expect = 6e-15
 Identities = 47/121 (38%), Positives = 72/121 (59%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +S L+ LDLS+N     LP D G +++++   LS N+  G+IP+S+ ++  ++ 
Sbjct: 178 PPSIFHLSSLIQLDLSHNFFSDVLPVDIGNMKQINNIDLSTNRFTGSIPNSIGQLQMISY 237

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LS+N    SIP   G++  L TL L  N+++G IP  L + T +  LNLS N   G I
Sbjct: 238 LNLSVNSFDDSIPDSFGELTSLQTLDLSHNNISGTIPKYLANFTILISLNLSFNNLHGQI 297

Query: 363 P 365
           P
Sbjct: 298 P 298

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 48/172 (27%), Positives = 80/172 (46%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELP--SDFGKLRKLSRALLSRNQLIGTIPDSVLKM-NR 173
           P ++  ++ L  L+++ N + G+L   S     RKLS   +  N   G +PD V  + + 
Sbjct: 7   PATVGNMNSLRGLNIAENHLQGDLEFLSTVSNCRKLSFLRVDSNYFTGNLPDYVGNLSST 66

Query: 174 LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L    ++ N++ G IP  +  +  L  L L  N     IP +++    +  L+LS N   
Sbjct: 67  LQSFVVAGNKLGGEIPSTISNLTGLMVLALSDNQFHSTIPESIMEMVNLRWLDLSGNSLA 126

Query: 354 GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G++P   G       L L  NKL+G +P  +     + HL +SNN L   +P
Sbjct: 127 GSVPSNAGMLKNAEKLFLQSNKLSGSIPKDMGNLTKLEHLVLSNNQLSSTVP 178

[73][TOP]
>UniRef100_C5XCS2 Putative uncharacterized protein Sb02g006280 n=1 Tax=Sorghum
           bicolor RepID=C5XCS2_SORBI
          Length = 713

 Score =  128 bits (322), Expect = 3e-28
 Identities = 74/191 (38%), Positives = 110/191 (57%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLA 179
           P SI  +S L+ LDLSNN++ G +P++  +L  +SR L LS N L G +P  V  +  L 
Sbjct: 299 PPSIGNLSKLLALDLSNNKLTGLIPNEILELPSISRFLDLSNNMLEGLVPLEVGSLVHLG 358

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L+LS N+++G IP   G  RV+  L +DGNS  G IP+TL +  G+ +L+L+ N  +G+
Sbjct: 359 QLNLSGNKLSGEIPDTFGNCRVMEILLMDGNSFQGSIPATLKNMAGLTVLDLTDNKLDGS 418

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
           IP    + +    L L+ N L+G +P  L  +  +  LD+S N+L G IP    F +L  
Sbjct: 419 IPSDLATLTNLQELYLAHNNLSGPIPELLGNSTSLLRLDLSYNNLQGEIPKEGVFKNLTG 478

Query: 540 ASFSNNDCLCG 572
            S   N+ LCG
Sbjct: 479 LSIVGNNALCG 489

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 73/229 (31%), Positives = 106/229 (46%), Gaps = 46/229 (20%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLK-------- 164
           +I  ++ L  LDLS N + GE+P   G LR+L R  L  N L G IP ++ +        
Sbjct: 138 AIGNLTFLRLLDLSYNSLQGEIPGSIGSLRRLQRLHLRENMLTGVIPSNISRCISLRNRF 197

Query: 165 --------------------------------MNRLADLDL---SMNRITGSIPVRLGKM 239
                                           +  LA L++     N  TG IP  +GK+
Sbjct: 198 AGKLPDSLANLSTNLQWLQIQNNNISGVMPSDIGNLAGLEMLAFGKNFFTGVIPKSIGKL 257

Query: 240 RVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNK 419
             L  L L  N ++G +PS++ + + +  L L+ N FEG IP   G+ S  + LDLS NK
Sbjct: 258 TRLQHLGLISNYLSGHLPSSIGNLSSLLQLYLANNSFEGPIPPSIGNLSKLLALDLSNNK 317

Query: 420 LTGRVPNSLAKAKFMGH-LDISNNHLCGNIP--IGSPFDHLDAASFSNN 557
           LTG +PN + +   +   LD+SNN L G +P  +GS   HL   + S N
Sbjct: 318 LTGLIPNEILELPSISRFLDLSNNMLEGLVPLEVGS-LVHLGQLNLSGN 365

 Score = 93.6 bits (231), Expect = 1e-17
 Identities = 58/170 (34%), Positives = 84/170 (49%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++GL  L    N   G +P   GKL +L    L  N L G +P S+  ++ L  
Sbjct: 227 PSDIGNLAGLEMLAFGKNFFTGVIPKSIGKLTRLQHLGLISNYLSGHLPSSIGNLSSLLQ 286

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMG-ILNLSRNGFEGT 359
           L L+ N   G IP  +G +  L  L L  N +TG IP+ +L    +   L+LS N  EG 
Sbjct: 287 LYLANNSFEGPIPPSIGNLSKLLALDLSNNKLTGLIPNEILELPSISRFLDLSNNMLEGL 346

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P   GS  +   L+LS NKL+G +P++    + M  L +  N   G+IP
Sbjct: 347 VPLEVGSLVHLGQLNLSGNKLSGEIPDTFGNCRVMEILLMDGNSFQGSIP 396

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 46/150 (30%), Positives = 70/150 (46%), Gaps = 19/150 (12%)
 Frame = +3

Query: 117 LSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS 296
           L+   L GTI  ++  +  L  LDLS N + G IP  +G +R L  L L  N +TG IPS
Sbjct: 126 LTSQGLTGTISAAIGNLTFLRLLDLSYNSLQGEIPGSIGSLRRLQRLHLRENMLTGVIPS 185

Query: 297 TL-----------------LSN--TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNK 419
            +                 L+N  T +  L +  N   G +P   G+ +   +L    N 
Sbjct: 186 NISRCISLRNRFAGKLPDSLANLSTNLQWLQIQNNNISGVMPSDIGNLAGLEMLAFGKNF 245

Query: 420 LTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            TG +P S+ K   + HL + +N+L G++P
Sbjct: 246 FTGVIPKSIGKLTRLQHLGLISNYLSGHLP 275

[74][TOP]
>UniRef100_B9SRS9 Brassinosteroid LRR receptor kinase, putative n=1 Tax=Ricinus
           communis RepID=B9SRS9_RICCO
          Length = 968

 Score =  128 bits (322), Expect = 3e-28
 Identities = 68/185 (36%), Positives = 107/185 (57%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           + GL  LDLS+N + GE+P+D G +  L    +SRN+L G+IP S+ ++  +  LD S N
Sbjct: 386 LQGLKVLDLSSNALSGEIPADIGVISSLLLFNISRNRLFGSIPSSIGELKMIQVLDFSNN 445

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           ++ G IP  +G    L  L+L+ NS+TG IP+ + + + +  L LS N   G +P    +
Sbjct: 446 KLNGRIPSEIGGAASLVELRLEKNSLTGNIPTQIKNCSSLTSLILSHNNLTGPVPAAIAN 505

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNND 560
            S    +DLSFN L+G +P  L     +   +IS+N+L G +P+G  F+ +  +S S N 
Sbjct: 506 LSNLEYVDLSFNNLSGSLPKELTNLSRLVSFNISHNNLHGELPLGGFFNTISPSSVSVNP 565

Query: 561 CLCGN 575
            LCG+
Sbjct: 566 SLCGS 570

 Score =  102 bits (253), Expect = 3e-20
 Identities = 61/169 (36%), Positives = 84/169 (49%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+     L  ++ S+NQ+ GELPS    LR L    LS N L G IP  +  +  L  
Sbjct: 160 PESLSWCPSLAAVNFSSNQLSGELPSGLWFLRGLQSLDLSDNLLDGQIPGGIANVYDLRA 219

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           + L  NR +G +PV +G   +L  L    NS++G +P +L        L L  N F G I
Sbjct: 220 IHLQKNRFSGQLPVDIGGCVLLKMLDFSENSLSGSLPESLQRLGSCTTLRLRGNSFAGEI 279

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G       LDLS NK +GR+P S+     +  L++S NHL G +P
Sbjct: 280 PGWIGELPTLESLDLSANKFSGRIPTSIGNLNTLKELNLSMNHLIGGLP 328

 Score =  102 bits (253), Expect = 3e-20
 Identities = 64/197 (32%), Positives = 94/197 (47%), Gaps = 28/197 (14%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L  LDLS N+  G +P+  G L  L    LS N LIG +P+S+     L  
Sbjct: 280 PGWIGELPTLESLDLSANKFSGRIPTSIGNLNTLKELNLSMNHLIGGLPESMENCANLLV 339

Query: 183 LDLSMNRITGSIPVRLGKMRV----------------------------LSTLKLDGNSM 278
           LD+S NR++G++P  + KM +                            L  L L  N++
Sbjct: 340 LDISQNRLSGTLPTWIFKMGLHSISISGNRLGWSMHYPSVASLASSLQGLKVLDLSSNAL 399

Query: 279 TGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAK 458
           +G+IP+ +   + + + N+SRN   G+IP   G      VLD S NKL GR+P+ +  A 
Sbjct: 400 SGEIPADIGVISSLLLFNISRNRLFGSIPSSIGELKMIQVLDFSNNKLNGRIPSEIGGAA 459

Query: 459 FMGHLDISNNHLCGNIP 509
            +  L +  N L GNIP
Sbjct: 460 SLVELRLEKNSLTGNIP 476

 Score = 97.1 bits (240), Expect = 9e-19
 Identities = 58/169 (34%), Positives = 87/169 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  + GL  LDLS+N + G++P     +  L    L +N+  G +P  +     L  
Sbjct: 184 PSGLWFLRGLQSLDLSDNLLDGQIPGGIANVYDLRAIHLQKNRFSGQLPVDIGGCVLLKM 243

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LD S N ++GS+P  L ++   +TL+L GNS  G+IP  +     +  L+LS N F G I
Sbjct: 244 LDFSENSLSGSLPESLQRLGSCTTLRLRGNSFAGEIPGWIGELPTLESLDLSANKFSGRI 303

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+ +    L+LS N L G +P S+     +  LDIS N L G +P
Sbjct: 304 PTSIGNLNTLKELNLSMNHLIGGLPESMENCANLLVLDISQNRLSGTLP 352

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 56/168 (33%), Positives = 88/168 (52%), Gaps = 4/168 (2%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDF----GKLRKLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           ++ GL  +DLS N++ G +P +F    G LR +S A   +N L G IP+S+     LA +
Sbjct: 116 QLGGLQVIDLSRNKLSGFIPDEFFKQCGSLRSVSFA---KNNLSGQIPESLSWCPSLAAV 172

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           + S N+++G +P  L  +R L +L L  N + GQIP  + +   +  ++L +N F G +P
Sbjct: 173 NFSSNQLSGELPSGLWFLRGLQSLDLSDNLLDGQIPGGIANVYDLRAIHLQKNRFSGQLP 232

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              G      +LD S N L+G +P SL +      L +  N   G IP
Sbjct: 233 VDIGGCVLLKMLDFSENSLSGSLPESLQRLGSCTTLRLRGNSFAGEIP 280

 Score = 84.7 bits (208), Expect = 5e-15
 Identities = 52/167 (31%), Positives = 81/167 (48%), Gaps = 1/167 (0%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKM-NRLADLD 188
           ++R+  L  L LSNN   G +  D  +L  L    LSRN+L G IPD   K    L  + 
Sbjct: 90  LIRLQFLQILSLSNNNFTGTINPDLSQLGGLQVIDLSRNKLSGFIPDEFFKQCGSLRSVS 149

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
            + N ++G IP  L     L+ +    N ++G++PS L    G+  L+LS N  +G IP 
Sbjct: 150 FAKNNLSGQIPESLSWCPSLAAVNFSSNQLSGELPSGLWFLRGLQSLDLSDNLLDGQIPG 209

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              +      + L  N+ +G++P  +     +  LD S N L G++P
Sbjct: 210 GIANVYDLRAIHLQKNRFSGQLPVDIGGCVLLKMLDFSENSLSGSLP 256

 Score = 84.0 bits (206), Expect = 8e-15
 Identities = 51/164 (31%), Positives = 84/164 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L  + L  N+  G+LP D G    L     S N L G++P+S+ ++     
Sbjct: 208 PGGIANVYDLRAIHLQKNRFSGQLPVDIGGCVLLKMLDFSENSLSGSLPESLQRLGSCTT 267

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N   G IP  +G++  L +L L  N  +G+IP+++ +   +  LNLS N   G +
Sbjct: 268 LRLRGNSFAGEIPGWIGELPTLESLDLSANKFSGRIPTSIGNLNTLKELNLSMNHLIGGL 327

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHL 494
           P+   + +  +VLD+S N+L+G +P  + K   +  + IS N L
Sbjct: 328 PESMENCANLLVLDISQNRLSGTLPTWIFKMG-LHSISISGNRL 370

 Score = 74.7 bits (182), Expect = 5e-12
 Identities = 38/121 (31%), Positives = 61/121 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +  +  LD SNN++ G +PS+ G    L    L +N L G IP  +   + L  
Sbjct: 428 PSSIGELKMIQVLDFSNNKLNGRIPSEIGGAASLVELRLEKNSLTGNIPTQIKNCSSLTS 487

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N +TG +P  +  +  L  + L  N+++G +P  L + + +   N+S N   G +
Sbjct: 488 LILSHNNLTGPVPAAIANLSNLEYVDLSFNNLSGSLPKELTNLSRLVSFNISHNNLHGEL 547

Query: 363 P 365
           P
Sbjct: 548 P 548

 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 40/120 (33%), Positives = 63/120 (52%), Gaps = 2/120 (1%)
 Frame = +3

Query: 162 KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
           K  R+ +L L    ++G I   L +++ L  L L  N+ TG I   L    G+ +++LSR
Sbjct: 68  KTQRVTELALDGFFLSGHIGRGLIRLQFLQILSLSNNNFTGTINPDLSQLGGLQVIDLSR 127

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSF--NKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           N   G IPD F  K    +  +SF  N L+G++P SL+    +  ++ S+N L G +P G
Sbjct: 128 NKLSGFIPDEF-FKQCGSLRSVSFAKNNLSGQIPESLSWCPSLAAVNFSSNQLSGELPSG 186

 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 30/104 (28%), Positives = 53/104 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I   + L+ L L  N + G +P+       L+  +LS N L G +P ++  ++ L  
Sbjct: 452 PSEIGGAASLVELRLEKNSLTGNIPTQIKNCSSLTSLILSHNNLTGPVPAAIANLSNLEY 511

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT 314
           +DLS N ++GS+P  L  +  L +  +  N++ G++P     NT
Sbjct: 512 VDLSFNNLSGSLPKELTNLSRLVSFNISHNNLHGELPLGGFFNT 555

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 40/143 (27%), Positives = 70/143 (48%), Gaps = 1/143 (0%)
 Frame = +3

Query: 90  KLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDG 269
           K ++++   L    L G I   ++++  L  L LS N  TG+I   L ++  L  + L  
Sbjct: 68  KTQRVTELALDGFFLSGHIGRGLIRLQFLQILSLSNNNFTGTINPDLSQLGGLQVIDLSR 127

Query: 270 NSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSL 446
           N ++G IP       G +  ++ ++N   G IP+          ++ S N+L+G +P+ L
Sbjct: 128 NKLSGFIPDEFFKQCGSLRSVSFAKNNLSGQIPESLSWCPSLAAVNFSSNQLSGELPSGL 187

Query: 447 AKAKFMGHLDISNNHLCGNIPIG 515
              + +  LD+S+N L G IP G
Sbjct: 188 WFLRGLQSLDLSDNLLDGQIPGG 210

[75][TOP]
>UniRef100_A7PJJ6 Chromosome chr12 scaffold_18, whole genome shotgun sequence n=1
            Tax=Vitis vinifera RepID=A7PJJ6_VITVI
          Length = 1058

 Score =  128 bits (321), Expect = 4e-28
 Identities = 74/192 (38%), Positives = 103/192 (53%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  ++ L  LDLS+N++ G +PS  G L  L    L  N L   IP S+  +  L  
Sbjct: 505  PSGLCHLTNLAFLDLSSNKLSGTIPSCSGNLTGLRNVYLHSNGLASEIPSSLCNLRGLLV 564

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N +   +P+++G M+ L  L L  N  +G IPST+     +  L LS N  +G I
Sbjct: 565  LNLSSNFLNSQLPLQVGNMKSLVALDLSKNQFSGNIPSTISLLQNLLQLYLSHNKLQGHI 624

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  FG       LDLS N L+G +P SL   K++ +L++S N L G IP G PF +  A 
Sbjct: 625  PPNFGDLVSLESLDLSGNNLSGTIPKSLEHLKYLEYLNVSFNKLQGEIPNGGPFANFTAE 684

Query: 543  SFSNNDCLCGNP 578
            SF +N  LCG P
Sbjct: 685  SFISNLALCGAP 696

 Score =  103 bits (257), Expect = 1e-20
 Identities = 65/189 (34%), Positives = 93/189 (49%), Gaps = 3/189 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  IS L  +  +NN + G LP D  K L  L   LLS NQL G +P ++     L 
Sbjct: 212 PAEIFNISSLQEIGFANNSLSGSLPMDICKHLPNLQWLLLSLNQLSGQLPTTLSLCGELL 271

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L+ N  TGSIP  +G +  L  +    +S TG IP +  + T +  L+L  N  +G 
Sbjct: 272 TLTLAYNNFTGSIPREIGNLSKLEQIYFRRSSFTGTIPPSFGNLTALQHLDLGENNIQGN 331

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHL 533
           IP   G+      L L+ N LTG VP ++     +  L ++ NHL G++P  IGS   +L
Sbjct: 332 IPKELGNLVNLQFLSLNVNNLTGIVPEAIFNISKLQVLSLAGNHLSGSLPSSIGSWLPNL 391

Query: 534 DAASFSNND 560
           +      N+
Sbjct: 392 EQLLIGGNE 400

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 54/165 (32%), Positives = 87/165 (52%), Gaps = 1/165 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L+ LDLSNN     LP D GK+  ++   L  NQL G IP +V  ++ L  L L MN
Sbjct: 74  LSFLVSLDLSNNYFHASLPKDIGKI-LITFLYLGNNQLTGEIPKAVSHLHNLKILSLQMN 132

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLL-SNTGMGILNLSRNGFEGTIPDVFG 377
            + GSIP  +  +  L  + L  NS++G +P  +  +N  +  L+ S N   G IP   G
Sbjct: 133 NLIGSIPATIFNISSLLNISLSYNSLSGSLPMDMCNANPKLKELDFSSNHLSGKIPTKIG 192

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           + S   +L+ + + L+G +P  +     +  +  +NN L G++P+
Sbjct: 193 NLSNLNLLNSASSGLSGPIPAEIFNISSLQEIGFANNSLSGSLPM 237

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 54/162 (33%), Positives = 81/162 (50%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  L +S+N + G +P+  G L   L     S  QL GTIP  +  +  L  L L  N +
Sbjct: 417 LRTLSISDNPLKGMIPNSLGNLSISLEIIYASDCQLRGTIPTGISNLTNLIGLRLDDNDL 476

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           TG IP   G+++ L  L +  N + G IPS L   T +  L+LS N   GTIP   G+ +
Sbjct: 477 TGLIPTPFGRLQKLQMLSISQNRIHGSIPSGLCHLTNLAFLDLSSNKLSGTIPSCSGNLT 536

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               + L  N L   +P+SL   + +  L++S+N L   +P+
Sbjct: 537 GLRNVYLHSNGLASEIPSSLCNLRGLLVLNLSSNFLNSQLPL 578

 Score = 84.7 bits (208), Expect = 5e-15
 Identities = 54/154 (35%), Positives = 77/154 (50%)
 Frame = +3

Query: 48  SNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVR 227
           S+ Q+ G +P+    L  L    L  N L G IP    ++ +L  L +S NRI GSIP  
Sbjct: 448 SDCQLRGTIPTGISNLTNLIGLRLDDNDLTGLIPTPFGRLQKLQMLSISQNRIHGSIPSG 507

Query: 228 LGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDL 407
           L  +  L+ L L  N ++G IPS   + TG+  + L  NG    IP    +    +VL+L
Sbjct: 508 LCHLTNLAFLDLSSNKLSGTIPSCSGNLTGLRNVYLHSNGLASEIPSSLCNLRGLLVLNL 567

Query: 408 SFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           S N L  ++P  +   K +  LD+S N   GNIP
Sbjct: 568 SSNFLNSQLPLQVGNMKSLVALDLSKNQFSGNIP 601

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 56/199 (28%), Positives = 90/199 (45%), Gaps = 28/199 (14%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S   ++ L HLDL  N I G +P + G L  L    L+ N L G +P+++  +++L  
Sbjct: 309 PPSFGNLTALQHLDLGENNIQGNIPKELGNLVNLQFLSLNVNNLTGIVPEAIFNISKLQV 368

Query: 183 LDLSMNRITGSIPVRLGKMR---------------------------VLSTLKLDGNSMT 281
           L L+ N ++GS+P  +G                               L TL +  N + 
Sbjct: 369 LSLAGNHLSGSLPSSIGSWLPNLEQLLIGGNEFTSELAFLTSLTNCIFLRTLSISDNPLK 428

Query: 282 GQIPSTLLS-NTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAK 458
           G IP++L + +  + I+  S     GTIP    + +  + L L  N LTG +P    + +
Sbjct: 429 GMIPNSLGNLSISLEIIYASDCQLRGTIPTGISNLTNLIGLRLDDNDLTGLIPTPFGRLQ 488

Query: 459 FMGHLDISNNHLCGNIPIG 515
            +  L IS N + G+IP G
Sbjct: 489 KLQMLSISQNRIHGSIPSG 507

 Score = 79.0 bits (193), Expect = 3e-13
 Identities = 48/159 (30%), Positives = 82/159 (51%), Gaps = 2/159 (1%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L NNQ+ GE+P     L  L    L  N LIG+IP ++  ++ L ++ LS N ++GS+
Sbjct: 103 LYLGNNQLTGEIPKAVSHLHNLKILSLQMNNLIGSIPATIFNISSLLNISLSYNSLSGSL 162

Query: 219 PVRLGKMR-VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFM 395
           P+ +      L  L    N ++G+IP+ + + + + +LN + +G  G IP    + S   
Sbjct: 163 PMDMCNANPKLKELDFSSNHLSGKIPTKIGNLSNLNLLNSASSGLSGPIPAEIFNISSLQ 222

Query: 396 VLDLSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIP 509
            +  + N L+G +P  + K    +  L +S N L G +P
Sbjct: 223 EIGFANNSLSGSLPMDICKHLPNLQWLLLSLNQLSGQLP 261

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 49/139 (35%), Positives = 75/139 (53%), Gaps = 1/139 (0%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           +++S   LS   L GTI   V  ++ L  LDLS N    S+P  +GK+ +++ L L  N 
Sbjct: 51  QRVSTINLSNMGLEGTIAPQVGNLSFLVSLDLSNNYFHASLPKDIGKI-LITFLYLGNNQ 109

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA 455
           +TG+IP  +     + IL+L  N   G+IP    + S  + + LS+N L+G +P  +  A
Sbjct: 110 LTGEIPKAVSHLHNLKILSLQMNNLIGSIPATIFNISSLLNISLSYNSLSGSLPMDMCNA 169

Query: 456 K-FMGHLDISNNHLCGNIP 509
              +  LD S+NHL G IP
Sbjct: 170 NPKLKELDFSSNHLSGKIP 188

[76][TOP]
>UniRef100_C5Y692 Putative uncharacterized protein Sb05g005490 n=1 Tax=Sorghum bicolor
            RepID=C5Y692_SORBI
          Length = 1020

 Score =  127 bits (320), Expect = 5e-28
 Identities = 68/192 (35%), Positives = 108/192 (56%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P SI  +S L+ L L +NQ+ G++P   G L+ L   L+S N L GTIP  +  +  +  
Sbjct: 432  PSSISNLSQLVSLVLESNQLNGQVPPSLGNLQVLQALLISFNNLHGTIPKEIFAIPTIVR 491

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            + LS N +   + V +G  + L+ L++  N+++G+IPSTL +   + ++ L  N F G+I
Sbjct: 492  ISLSFNSLHAPLHVDIGNAKQLTYLEISSNNLSGEIPSTLGNCESLEVIELGHNFFSGSI 551

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P + G+ S    L+LS N LTG +P +L+  +F+  LD+S NHL G +P    F ++   
Sbjct: 552  PPLLGNISNLNFLNLSHNNLTGSIPVALSGLQFLQQLDLSFNHLKGEVPTKGIFKNVTDL 611

Query: 543  SFSNNDCLCGNP 578
                N  LCG P
Sbjct: 612  WIDGNQGLCGGP 623

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 55/176 (31%), Positives = 92/176 (52%), Gaps = 7/176 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ L     + N+I G +P++F  L  L    +S NQ+ G  P +VL ++ LA+
Sbjct: 184 PDSVANLTRLQFFSCAINEIEGNIPNEFANLLGLQILRVSINQMSGQFPQAVLNLSNLAE 243

Query: 183 LDLSMNRITGSIPVRLG-KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           L L++N  +G +P  +G  +  L  L L  N   G IPS+L +++ + ++++SRN F G 
Sbjct: 244 LSLAVNNFSGVVPSGIGNSLPDLEALLLARNFFHGHIPSSLTNSSKLSVIDMSRNNFTGL 303

Query: 360 IPDVFGSKSYFMVLDLSFNKLTG------RVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P  FG  S    L+L  N L        R  +SLA    +    ++ N+L G +P
Sbjct: 304 VPSSFGKLSKLSTLNLESNNLQAQNKQDWRFMDSLANCTELNAFSVAYNYLTGKVP 359

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 59/183 (32%), Positives = 93/183 (50%), Gaps = 1/183 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           ++   S L  L L+NN++ G++ +D  +   L    L+ N L GTIPDSV  + RL    
Sbjct: 140 ALANCSKLTELWLTNNKLTGQIHADLPQ--SLESFDLTTNNLTGTIPDSVANLTRLQFFS 197

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
            ++N I G+IP     +  L  L++  N M+GQ P  +L+ + +  L+L+ N F G +P 
Sbjct: 198 CAINEIEGNIPNEFANLLGLQILRVSINQMSGQFPQAVLNLSNLAELSLAVNNFSGVVPS 257

Query: 369 VFG-SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAAS 545
             G S      L L+ N   G +P+SL  +  +  +D+S N+  G +P  S F  L   S
Sbjct: 258 GIGNSLPDLEALLLARNFFHGHIPSSLTNSSKLSVIDMSRNNFTGLVP--SSFGKLSKLS 315

Query: 546 FSN 554
             N
Sbjct: 316 TLN 318

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 56/170 (32%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISG-LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P S+  +S  L  L L  NQ+ G+ PS    LR L    L  N+  G +P+ +  +N L 
Sbjct: 359 PNSVGNLSSQLQGLYLGGNQLSGDFPSGIANLRNLVVVSLFENKFTGLLPEWLGTLNSLQ 418

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            + L+ N  TG IP  +  +  L +L L+ N + GQ+P +L +   +  L +S N   GT
Sbjct: 419 VVQLTNNLFTGPIPSSISNLSQLVSLVLESNQLNGQVPPSLGNLQVLQALLISFNNLHGT 478

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP    +    + + LSFN L   +   +  AK + +L+IS+N+L G IP
Sbjct: 479 IPKEIFAIPTIVRISLSFNSLHAPLHVDIGNAKQLTYLEISSNNLSGEIP 528

 Score = 57.4 bits (137), Expect = 8e-07
 Identities = 44/132 (33%), Positives = 67/132 (50%), Gaps = 1/132 (0%)
 Frame = +3

Query: 117 LSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS 296
           L+   L+G I  S+  +  L  L LS N  +G IP+ L  +  L  L L+ N + G+IP+
Sbjct: 81  LTNRGLVGQISPSLGNLTFLKVLVLSANSFSGEIPIFLSHLNRLQILSLENNMLQGRIPA 140

Query: 297 TLLSNTGMGILNLSRNGFEGTI-PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHL 473
            L + + +  L L+ N   G I  D+  S   F   DL+ N LTG +P+S+A    +   
Sbjct: 141 -LANCSKLTELWLTNNKLTGQIHADLPQSLESF---DLTTNNLTGTIPDSVANLTRLQFF 196

Query: 474 DISNNHLCGNIP 509
             + N + GNIP
Sbjct: 197 SCAINEIEGNIP 208

[77][TOP]
>UniRef100_A7P9S8 Chromosome chr14 scaffold_9, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7P9S8_VITVI
          Length = 540

 Score =  127 bits (320), Expect = 5e-28
 Identities = 76/209 (36%), Positives = 113/209 (54%), Gaps = 17/209 (8%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+SI  +  L+ L +S N + GE+P  + ++  L  A +S N L G IP S++ +  L  
Sbjct: 244 PLSIGNLQALITLVISKNNLCGEIPQIWNEMPSLYIAGMSNNSLSGIIPRSMVSLTALRF 303

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKL----------------DGNSMTGQIPSTLLSNT 314
           L LS N  +G +P +L     L +L L                  NS++G+IP  L S  
Sbjct: 304 LALSNNSHSGELPSQLQNCSALESLDLALEYYNILYPVNSLVLSNNSLSGEIPIELTSLL 363

Query: 315 GMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHL 494
            +G LNLS N F G IP+  G+  +  +LDLS NKL+G +P S+A   F+ HL++S+N+L
Sbjct: 364 KLGTLNLSSNNFGGNIPEKIGNLQWLEILDLSRNKLSGSIPMSMASITFLVHLNLSHNNL 423

Query: 495 CGNIPIGSPFDHL-DAASFSNNDCLCGNP 578
            G IP G+ F  L + + +  N  LCG P
Sbjct: 424 SGKIPTGNQFQTLINLSIYQGNPALCGFP 452

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 58/187 (31%), Positives = 87/187 (46%), Gaps = 17/187 (9%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNR-LA 179
           P S+V  + + ++DLS+N   G LP  +  L       L  N   G IP ++ ++   L 
Sbjct: 178 PNSLV-FNYISNVDLSSNLFDGPLPLWYFTL------YLRSNLFSGPIPRNIGEVIPILT 230

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           DLD+S N + GSIP+ +G ++ L TL +  N++ G+IP        + I  +S N   G 
Sbjct: 231 DLDISWNSLNGSIPLSIGNLQALITLVISKNNLCGEIPQIWNEMPSLYIAGMSNNSLSGI 290

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLD----------------ISNNH 491
           IP    S +    L LS N  +G +P+ L     +  LD                +SNN 
Sbjct: 291 IPRSMVSLTALRFLALSNNSHSGELPSQLQNCSALESLDLALEYYNILYPVNSLVLSNNS 350

Query: 492 LCGNIPI 512
           L G IPI
Sbjct: 351 LSGEIPI 357

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 51/174 (29%), Positives = 86/174 (49%), Gaps = 6/174 (3%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S+  +  L +L L +N   G +P   G L  L    LS NQ+ G IPDS+ +++ L  L+
Sbjct: 30  SLGHLKNLRYLQLLSNSFCGSIPESIGSLSSLQVLYLSHNQMGGIIPDSIGQLSSLVMLE 89

Query: 189 LSMNRITGSIP----VRLGKMRVLSTLKLDGN-SMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L+ N   G I       L  ++ LS  K   N S+   I S       +  +NL      
Sbjct: 90  LNENSWEGVITKAHFANLSNLKQLSITKSSPNVSLVFNISSDWAPPFKLTYINLRSCQLG 149

Query: 354 GTIPDVFGSKSYFM-VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
              P    +++ F+  L++++N+L G+VPNSL    ++ ++D+S+N   G +P+
Sbjct: 150 PKFPSWLRTQNEFLNELNIAYNQLRGKVPNSLV-FNYISNVDLSSNLFDGPLPL 202

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 32/85 (37%), Positives = 49/85 (57%)
 Frame = +3

Query: 174 LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L +LDL  N++TG++   LG ++ L  L+L  NS  G IP ++ S + + +L LS N   
Sbjct: 13  LFNLDLGYNKLTGNLQDSLGHLKNLRYLQLLSNSFCGSIPESIGSLSSLQVLYLSHNQMG 72

Query: 354 GTIPDVFGSKSYFMVLDLSFNKLTG 428
           G IPD  G  S  ++L+L+ N   G
Sbjct: 73  GIIPDSIGQLSSLVMLELNENSWEG 97

[78][TOP]
>UniRef100_Q8W0U9 Putative receptor protein kinase n=1 Tax=Sorghum bicolor
           RepID=Q8W0U9_SORBI
          Length = 921

 Score =  127 bits (319), Expect = 6e-28
 Identities = 74/190 (38%), Positives = 107/190 (56%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + R++GL  L+L+NN + G +P +      L+      N+L GTIP S+ K+  +  
Sbjct: 317 PPELGRLTGLFDLNLANNHLEGPIPDNLSSCVNLNSFNAYGNKLNGTIPRSLRKLESMTY 376

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LS N I+GSIP+ L ++  L TL L  N MTG IPS++ S   +  LNLS+NG  G I
Sbjct: 377 LNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIGSLEHLLRLNLSKNGLVGFI 436

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P  FG+    M +DLS+N L G +P  L   + +  L++S N+L G +P  + F      
Sbjct: 437 PAEFGNLRSVMEIDLSYNHLGGLIPQELEMLQNLMLLNVSYNNLAGVVPADNNFTRFSPD 496

Query: 543 SFSNNDCLCG 572
           SF  N  LCG
Sbjct: 497 SFLGNPGLCG 506

 Score =  108 bits (270), Expect = 3e-22
 Identities = 68/174 (39%), Positives = 94/174 (54%), Gaps = 1/174 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L  N+  G +PS  G ++ L+   LS NQL G IP  +  +     L +  N++TGSI
Sbjct: 233 LSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYIQGNKLTGSI 292

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  LG M  L  L+L+ N +TG IP  L   TG+  LNL+ N  EG IPD   S      
Sbjct: 293 PPELGNMSTLHYLELNDNQLTGSIPPELGRLTGLFDLNLANNHLEGPIPDNLSSCVNLNS 352

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
            +   NKL G +P SL K + M +L++S+N + G+IPI  S  ++LD    S N
Sbjct: 353 FNAYGNKLNGTIPRSLRKLESMTYLNLSSNFISGSIPIELSRINNLDTLDLSCN 406

 Score =  107 bits (266), Expect = 9e-22
 Identities = 68/192 (35%), Positives = 94/192 (48%), Gaps = 23/192 (11%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I   S L  LD S N + G++P    KL+ L   +L  NQLIG IP ++ ++  L  
Sbjct: 102 PDEIGDCSSLRTLDFSFNNLDGDIPFSISKLKHLENLILKNNQLIGAIPSTLSQLPNLKI 161

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLS-------- 338
           LDL+ N++TG IP  +    VL  L +  NS+TG IP T+ + T   +L+LS        
Sbjct: 162 LDLAQNKLTGEIPRLIYWNEVLQYLDVKNNSLTGVIPDTIGNCTSFQVLDLSYNRFTGPI 221

Query: 339 ---------------RNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHL 473
                           N F G IP V G      VLDLS+N+L+G +P+ L    +   L
Sbjct: 222 PFNIGFLQVATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKL 281

Query: 474 DISNNHLCGNIP 509
            I  N L G+IP
Sbjct: 282 YIQGNKLTGSIP 293

 Score =  100 bits (250), Expect = 6e-20
 Identities = 67/187 (35%), Positives = 95/187 (50%), Gaps = 2/187 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L  LDLS NQ+ G +PS  G L    +  +  N+L G+IP  +  M+ L  
Sbjct: 245 PSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYIQGNKLTGSIPPELGNMSTLHY 304

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L+ N++TGSIP  LG++  L  L L  N + G IP  L S   +   N   N   GTI
Sbjct: 305 LELNDNQLTGSIPPELGRLTGLFDLNLANNHLEGPIPDNLSSCVNLNSFNAYGNKLNGTI 364

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLD 536
           P           L+LS N ++G +P  L++   +  LD+S N + G IP  IGS  +HL 
Sbjct: 365 PRSLRKLESMTYLNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIGS-LEHLL 423

Query: 537 AASFSNN 557
             + S N
Sbjct: 424 RLNLSKN 430

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 55/163 (33%), Positives = 87/163 (53%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +  L+ +DL +N + G++P + G    L     S N L G IP S+ K+  L +L L  N
Sbjct: 84  LKSLVSIDLKSNGLSGQIPDEIGDCSSLRTLDFSFNNLDGDIPFSISKLKHLENLILKNN 143

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           ++ G+IP  L ++  L  L L  N +TG+IP  +  N  +  L++  N   G IPD  G+
Sbjct: 144 QLIGAIPSTLSQLPNLKILDLAQNKLTGEIPRLIYWNEVLQYLDVKNNSLTGVIPDTIGN 203

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            + F VLDLS+N+ TG +P ++   + +  L +  N   G IP
Sbjct: 204 CTSFQVLDLSYNRFTGPIPFNIGFLQ-VATLSLQGNKFTGPIP 245

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 63/193 (32%), Positives = 94/193 (48%), Gaps = 24/193 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++ ++  L  LDL+ N++ GE+P        L    +  N L G IPD++        
Sbjct: 150 PSTLSQLPNLKILDLAQNKLTGEIPRLIYWNEVLQYLDVKNNSLTGVIPDTIGNCTSFQV 209

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS NR TG IP  +G ++V +TL L GN  TG IPS +     + +L+LS N   G I
Sbjct: 210 LDLSYNRFTGPIPFNIGFLQV-ATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPI 268

Query: 363 PDVFGSKSY------------------------FMVLDLSFNKLTGRVPNSLAKAKFMGH 470
           P + G+ +Y                           L+L+ N+LTG +P  L +   +  
Sbjct: 269 PSILGNLTYTEKLYIQGNKLTGSIPPELGNMSTLHYLELNDNQLTGSIPPELGRLTGLFD 328

Query: 471 LDISNNHLCGNIP 509
           L+++NNHL G IP
Sbjct: 329 LNLANNHLEGPIP 341

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 58/173 (33%), Positives = 81/173 (46%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+LS   + GE+    G L+ L    L  N L G IPD +   + L  LD S N + G I
Sbjct: 66  LNLSGLNLEGEISPAVGSLKSLVSIDLKSNGLSGQIPDEIGDCSSLRTLDFSFNNLDGDI 125

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  + K++ L  L L  N + G IPSTL     + IL+L++N   G IP +         
Sbjct: 126 PFSISKLKHLENLILKNNQLIGAIPSTLSQLPNLKILDLAQNKLTGEIPRLIYWNEVLQY 185

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNN 557
           LD+  N LTG +P+++        LD+S N   G IP    F  +   S   N
Sbjct: 186 LDVKNNSLTGVIPDTIGNCTSFQVLDLSYNRFTGPIPFNIGFLQVATLSLQGN 238

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 33/88 (37%), Positives = 48/88 (54%)
 Frame = +3

Query: 246 LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLT 425
           ++ L L G ++ G+I   + S   +  ++L  NG  G IPD  G  S    LD SFN L 
Sbjct: 63  VAALNLSGLNLEGEISPAVGSLKSLVSIDLKSNGLSGQIPDEIGDCSSLRTLDFSFNNLD 122

Query: 426 GRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G +P S++K K + +L + NN L G IP
Sbjct: 123 GDIPFSISKLKHLENLILKNNQLIGAIP 150

[79][TOP]
>UniRef100_A9SUR2 ERL1c AtERECTA-like receptor S/T protein kinase protein n=1
           Tax=Physcomitrella patens subsp. patens
           RepID=A9SUR2_PHYPA
          Length = 948

 Score =  127 bits (319), Expect = 6e-28
 Identities = 66/170 (38%), Positives = 99/170 (58%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ L  L L NN I G +P +FG + +L+   LS N LIG IP  +  +  L +
Sbjct: 282 PRSLGNLTSLTKLYLYNNNISGPIPKEFGNMSRLNYLELSANSLIGEIPSEICYLTGLFE 341

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N++ GSIP  +  +  L+ L L GN +TG I   L   T + +LNL+ N F G++
Sbjct: 342 LDLSNNQLKGSIPENISSLAALNLLNLHGNQLTGSISPALQQLTNLTLLNLAFNNFTGSV 401

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           P+  G      +L+LS N LTG++P S++  + +  +D+ NN L G IPI
Sbjct: 402 PEEIGMIVNLDILNLSKNSLTGQIPPSISNLEHLLEIDLQNNKLSGTIPI 451

 Score =  117 bits (293), Expect = 6e-25
 Identities = 72/207 (34%), Positives = 106/207 (51%), Gaps = 16/207 (7%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++GL  LDLSNNQ+ G +P +   L  L+   L  NQL G+I  ++ ++  L  
Sbjct: 330 PSEICYLTGLFELDLSNNQLKGSIPENISSLAALNLLNLHGNQLTGSISPALQQLTNLTL 389

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L+ N  TGS+P  +G +  L  L L  NS+TGQIP ++ +   +  ++L  N   GTI
Sbjct: 390 LNLAFNNFTGSVPEEIGMIVNLDILNLSKNSLTGQIPPSISNLEHLLEIDLQNNKLSGTI 449

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVP----------------NSLAKAKFMGHLDISNNHL 494
           P   G+      LDLS N+L G +P                +SL+ ++ M   ++SNNHL
Sbjct: 450 PIALGNLKSLGSLDLSQNQLQGPIPPELGKLLELSYFVWSFSSLSPSQNMFCRNLSNNHL 509

Query: 495 CGNIPIGSPFDHLDAASFSNNDCLCGN 575
            G IP    F     +S+  N  LC N
Sbjct: 510 SGTIPRDQVFSRFPTSSYFGNPLLCLN 536

 Score =  113 bits (283), Expect = 9e-24
 Identities = 65/169 (38%), Positives = 96/169 (56%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P     +S L +L+LS N +IGE+PS+   L  L    LS NQL G+IP+++  +  L  
Sbjct: 306 PKEFGNMSRLNYLELSANSLIGEIPSEICYLTGLFELDLSNNQLKGSIPENISSLAALNL 365

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L  N++TGSI   L ++  L+ L L  N+ TG +P  +     + ILNLS+N   G I
Sbjct: 366 LNLHGNQLTGSISPALQQLTNLTLLNLAFNNFTGSVPEEIGMIVNLDILNLSKNSLTGQI 425

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P    +  + + +DL  NKL+G +P +L   K +G LD+S N L G IP
Sbjct: 426 PPSISNLEHLLEIDLQNNKLSGTIPIALGNLKSLGSLDLSQNQLQGPIP 474

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 55/169 (32%), Positives = 90/169 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ I   + L+HLDLS+N+++GE+P    +L+ L    L  N+L G+IP S   +  L  
Sbjct: 91  PVGICNCTNLIHLDLSSNKLVGEIPYLLSQLQLLEFLNLRSNKLSGSIPSSFAGLPNLRH 150

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LD+  N ++G IP  L     L  L L  N +TG +   +   T +   N+  N   G +
Sbjct: 151 LDMQFNILSGPIPPLLFWSETLQYLMLKSNQLTGGLSDDMCKLTQLAYFNVRENKLSGPL 210

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+ + F +LDLS+N  +G +P ++   + +  L + +N+L G IP
Sbjct: 211 PAGIGNCTSFQILDLSYNNFSGEIPYNIGYLQ-VSTLSLESNNLTGVIP 258

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 57/164 (34%), Positives = 86/164 (52%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           +++ L + ++  N++ G LP+  G         LS N   G IP ++  + +++ L L  
Sbjct: 192 KLTQLAYFNVRENKLSGPLPAGIGNCTSFQILDLSYNNFSGEIPYNIGYL-QVSTLSLES 250

Query: 198 NRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
           N +TG IP  LG M+ L  L L  N + GQIP +L + T +  L L  N   G IP  FG
Sbjct: 251 NNLTGVIPDVLGLMQALVILDLSNNKLEGQIPRSLGNLTSLTKLYLYNNNISGPIPKEFG 310

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           + S    L+LS N L G +P+ +     +  LD+SNN L G+IP
Sbjct: 311 NMSRLNYLELSANSLIGEIPSEICYLTGLFELDLSNNQLKGSIP 354

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 59/168 (35%), Positives = 85/168 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I   +    LDLS N   GE+P + G L+ +S   L  N L G IPD +  M  L  
Sbjct: 211 PAGIGNCTSFQILDLSYNNFSGEIPYNIGYLQ-VSTLSLESNNLTGVIPDVLGLMQALVI 269

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N++ G IP  LG +  L+ L L  N+++G IP    + + +  L LS N   G I
Sbjct: 270 LDLSNNKLEGQIPRSLGNLTSLTKLYLYNNNISGPIPKEFGNMSRLNYLELSANSLIGEI 329

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P      +    LDLS N+L G +P +++    +  L++  N L G+I
Sbjct: 330 PSEICYLTGLFELDLSNNQLKGSIPENISSLAALNLLNLHGNQLTGSI 377

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 61/175 (34%), Positives = 96/175 (54%), Gaps = 2/175 (1%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L +N + G +P   G ++ L    LS N+L G IP S+  +  L  L L  N I+G I
Sbjct: 246 LSLESNNLTGVIPDVLGLMQALVILDLSNNKLEGQIPRSLGNLTSLTKLYLYNNNISGPI 305

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P   G M  L+ L+L  NS+ G+IPS +   TG+  L+LS N  +G+IP+   S +   +
Sbjct: 306 PKEFGNMSRLNYLELSANSLIGEIPSEICYLTGLFELDLSNNQLKGSIPENISSLAALNL 365

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAASFSNN 557
           L+L  N+LTG +  +L +   +  L+++ N+  G++P  IG    +LD  + S N
Sbjct: 366 LNLHGNQLTGSISPALQQLTNLTLLNLAFNNFTGSVPEEIGM-IVNLDILNLSKN 419

 Score = 80.5 bits (197), Expect = 9e-14
 Identities = 49/159 (30%), Positives = 76/159 (47%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+LS   + GE+    G L  L    LS N + G IP  +     L  LDLS N++ G I
Sbjct: 55  LNLSALALGGEISPLIGLLESLQVLDLSGNNISGQIPVGICNCTNLIHLDLSSNKLVGEI 114

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  L ++++L  L L  N ++G IPS+      +  L++  N   G IP +         
Sbjct: 115 PYLLSQLQLLEFLNLRSNKLSGSIPSSFAGLPNLRHLDMQFNILSGPIPPLLFWSETLQY 174

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           L L  N+LTG + + + K   + + ++  N L G +P G
Sbjct: 175 LMLKSNQLTGGLSDDMCKLTQLAYFNVRENKLSGPLPAG 213

 Score = 77.8 bits (190), Expect = 6e-13
 Identities = 51/180 (28%), Positives = 82/180 (45%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +  L  LDLS N I G++P        L    LS N+L+G IP  + ++  L  L+L  N
Sbjct: 73  LESLQVLDLSGNNISGQIPVGICNCTNLIHLDLSSNKLVGEIPYLLSQLQLLEFLNLRSN 132

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           +++GSIP     +  L  L +  N ++G IP  L  +  +  L L  N   G + D    
Sbjct: 133 KLSGSIPSSFAGLPNLRHLDMQFNILSGPIPPLLFWSETLQYLMLKSNQLTGGLSDDMCK 192

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNND 560
            +     ++  NKL+G +P  +        LD+S N+  G IP    +  +   S  +N+
Sbjct: 193 LTQLAYFNVRENKLSGPLPAGIGNCTSFQILDLSYNNFSGEIPYNIGYLQVSTLSLESNN 252

[80][TOP]
>UniRef100_B9IBE4 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IBE4_POPTR
          Length = 1199

 Score =  127 bits (318), Expect = 8e-28
 Identities = 75/186 (40%), Positives = 104/186 (55%), Gaps = 4/186 (2%)
 Frame = +3

Query: 30   LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLK----MNRLADLDLSM 197
            L +L +  N+I GE+P++ GKL +L    L  N L G IP  + +    + RL  LDLS 
Sbjct: 631  LTNLQMGRNRISGEIPAELGKLPRLGLLSLDSNDLTGRIPGEIPQGLGSLTRLESLDLSD 690

Query: 198  NRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
            N++TG+I   LG    LS+L L  N+++G+IP  L +     +L+LS N   GTIP   G
Sbjct: 691  NKLTGNISKELGGYEKLSSLDLSHNNLSGEIPFELGNLNLRYLLDLSSNSLSGTIPSNLG 750

Query: 378  SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNN 557
              S    L++S N L+GR+P+SL+    +   D S N L G IP GS F +  A SF  N
Sbjct: 751  KLSMLENLNVSHNHLSGRIPDSLSTMISLHSFDFSYNDLTGPIPTGSVFQNASARSFIGN 810

Query: 558  DCLCGN 575
              LCGN
Sbjct: 811  SGLCGN 816

 Score =  107 bits (268), Expect = 5e-22
 Identities = 64/188 (34%), Positives = 100/188 (53%), Gaps = 3/188 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGEL-PSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P+S+  +S +  L LS N   GE+ P+      +L+   +  N   G IP  + ++  L 
Sbjct: 356 PLSLSNLSKIADLGLSENFFSGEISPALISNWTELTSFQVQNNNFSGNIPPEIGQLTMLQ 415

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N  +GSIP  +G +  L++L L GN ++G IP TL + T +  LNL  N   GT
Sbjct: 416 FLFLYNNSFSGSIPHEIGNLEELTSLDLSGNQLSGPIPPTLWNLTNLETLNLFFNNINGT 475

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHL 533
           IP   G+ +   +LDL+ N+L G +P +++   F+  +++  N+  G+IP   G     L
Sbjct: 476 IPPEVGNMTALQILDLNTNQLHGELPETISNLTFLTSINLFGNNFSGSIPSNFGKNIPSL 535

Query: 534 DAASFSNN 557
             ASFSNN
Sbjct: 536 VYASFSNN 543

 Score = 87.0 bits (214), Expect = 9e-16
 Identities = 58/185 (31%), Positives = 90/185 (48%), Gaps = 3/185 (1%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  +S L  L L  N + G++P   G +  L  A L  N   GTIP S+ K+  L  LDL
Sbjct: 263 ISMLSNLKSLSLQTNLLGGQIPESIGSISGLRTAELFSNSFQGTIPSSLGKLKHLEKLDL 322

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI-PD 368
            MN +  +IP  LG    L+ L L  N ++G++P +L + + +  L LS N F G I P 
Sbjct: 323 RMNALNSTIPPELGLCTNLTYLALADNQLSGELPLSLSNLSKIADLGLSENFFSGEISPA 382

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAA 542
           +  + +      +  N  +G +P  + +   +  L + NN   G+IP  IG+  + L + 
Sbjct: 383 LISNWTELTSFQVQNNNFSGNIPPEIGQLTMLQFLFLYNNSFSGSIPHEIGN-LEELTSL 441

Query: 543 SFSNN 557
             S N
Sbjct: 442 DLSGN 446

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 58/198 (29%), Positives = 93/198 (46%), Gaps = 7/198 (3%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
            P +I  ++ L  ++L  N   G +PS+FGK +  L  A  S N   G +P  +     L 
Sbjct: 501  PETISNLTFLTSINLFGNNFSGSIPSNFGKNIPSLVYASFSNNSFSGELPPELCSGLSLQ 560

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
             L ++ N  TG++P  L     L+ ++L+GN  TG I         +  + L+ N F G 
Sbjct: 561  QLTVNSNNFTGALPTCLRNCLGLTRVRLEGNQFTGNITHAFGVLPNLVFVALNDNQFIGE 620

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP------IGSP 521
            I   +G+      L +  N+++G +P  L K   +G L + +N L G IP      +GS 
Sbjct: 621  ISPDWGACENLTNLQMGRNRISGEIPAELGKLPRLGLLSLDSNDLTGRIPGEIPQGLGS- 679

Query: 522  FDHLDAASFSNNDCLCGN 575
               L++   S+N  L GN
Sbjct: 680  LTRLESLDLSDNK-LTGN 696

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 64/242 (26%), Positives = 92/242 (38%), Gaps = 72/242 (29%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTI------------ 146
           P +I  +S L++LDLS N   G +P +  +L +L    L  N L GTI            
Sbjct: 116 PSAIGGLSKLIYLDLSVNFFEGSIPVEISELTELQYLSLFNNNLNGTIPSQLSNLLKVRH 175

Query: 147 -----------------------------------PDSVLKMNRLADLDLSMNRITGSIP 221
                                              PD +     L  LDLS+N  TG IP
Sbjct: 176 LDLGANYLETPDWSKFSMPSLEYLSLFFNELTSEFPDFITSCRNLTFLDLSLNNFTGQIP 235

Query: 222 ----VRLGKMRVLS---------------------TLKLDGNSMTGQIPSTLLSNTGMGI 326
                 LGK+  L+                     +L L  N + GQIP ++ S +G+  
Sbjct: 236 ELAYTNLGKLETLNLYNNLFQGPLSPKISMLSNLKSLSLQTNLLGGQIPESIGSISGLRT 295

Query: 327 LNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
             L  N F+GTIP   G   +   LDL  N L   +P  L     + +L +++N L G +
Sbjct: 296 AELFSNSFQGTIPSSLGKLKHLEKLDLRMNALNSTIPPELGLCTNLTYLALADNQLSGEL 355

Query: 507 PI 512
           P+
Sbjct: 356 PL 357

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 59/193 (30%), Positives = 84/193 (43%), Gaps = 2/193 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPS-DFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I     L  LDLS N   G++P   +  L KL    L  N   G +   +  ++ L 
Sbjct: 211 PDFITSCRNLTFLDLSLNNFTGQIPELAYTNLGKLETLNLYNNLFQGPLSPKISMLSNLK 270

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N + G IP  +G +  L T +L  NS  G IPS+L     +  L+L  N    T
Sbjct: 271 SLSLQTNLLGGQIPESIGSISGLRTAELFSNSFQGTIPSSLGKLKHLEKLDLRMNALNST 330

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
           IP   G  +    L L+ N+L+G +P SL+    +  L +S N   G I      +  + 
Sbjct: 331 IPPELGLCTNLTYLALADNQLSGELPLSLSNLSKIADLGLSENFFSGEISPALISNWTEL 390

Query: 540 ASFS-NNDCLCGN 575
            SF   N+   GN
Sbjct: 391 TSFQVQNNNFSGN 403

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 51/158 (32%), Positives = 80/158 (50%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPS-DFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGS 215
           ++L + +I G L   +F     L+R  +  N + G IP ++  +++L  LDLS+N   GS
Sbjct: 79  INLPSLEINGTLAHFNFTPFTDLTRFDIQNNTVSGAIPSAIGGLSKLIYLDLSVNFFEGS 138

Query: 216 IPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFM 395
           IPV + ++  L  L L  N++ G IPS L +   +  L+L  N  E      F   S   
Sbjct: 139 IPVEISELTELQYLSLFNNNLNGTIPSQLSNLLKVRHLDLGANYLETPDWSKFSMPS-LE 197

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L L FN+LT   P+ +   + +  LD+S N+  G IP
Sbjct: 198 YLSLFFNELTSEFPDFITSCRNLTFLDLSLNNFTGQIP 235

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 58/202 (28%), Positives = 84/202 (41%), Gaps = 26/202 (12%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L   D+ NN + G +PS  G L KL    LS N   G+IP  + ++  L  L L  N + 
Sbjct: 101 LTRFDIQNNTVSGAIPSAIGGLSKLIYLDLSVNFFEGSIPVEISELTELQYLSLFNNNLN 160

Query: 210 GSIPVRLG-----------------------KMRVLSTLKLDGNSMTGQIPSTLLSNTGM 320
           G+IP +L                         M  L  L L  N +T + P  + S   +
Sbjct: 161 GTIPSQLSNLLKVRHLDLGANYLETPDWSKFSMPSLEYLSLFFNELTSEFPDFITSCRNL 220

Query: 321 GILNLSRNGFEGTIPDV-FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLC 497
             L+LS N F G IP++ + +      L+L  N   G +   ++    +  L +  N L 
Sbjct: 221 TFLDLSLNNFTGQIPELAYTNLGKLETLNLYNNLFQGPLSPKISMLSNLKSLSLQTNLLG 280

Query: 498 GNIP--IGSPFDHLDAASFSNN 557
           G IP  IGS      A  FSN+
Sbjct: 281 GQIPESIGSISGLRTAELFSNS 302

[81][TOP]
>UniRef100_A7P0A1 Chromosome chr6 scaffold_3, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7P0A1_VITVI
          Length = 611

 Score =  127 bits (318), Expect = 8e-28
 Identities = 71/194 (36%), Positives = 108/194 (55%), Gaps = 4/194 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++  +S L  L+L +N++ GELP+   ++  L    L  N   G IP+S++ ++ L  
Sbjct: 340 PWNLTNLSKLERLELQDNKLTGELPNFLSQISTLQVLNLRNNSFQGLIPESIVNLSNLRI 399

Query: 183 LDLSMNRITGSIP--VRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEG 356
           LD+S N +TG IP  +    + + + L L  N ++GQIP++L +   + +LN+S N   G
Sbjct: 400 LDVSNNNLTGEIPRDISSDNLNMYTLLDLSNNQLSGQIPASLGTLRALKLLNISHNKLSG 459

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDH-- 530
            IP  FG       LDLS NKL+G +P +L K + +  LD+SNN L G IP G       
Sbjct: 460 KIPTSFGDLENIETLDLSHNKLSGSIPPTLTKLQQLTILDVSNNQLTGRIPDGGQMGTMV 519

Query: 531 LDAASFSNNDCLCG 572
           LD   ++NN  LCG
Sbjct: 520 LDPNYYANNSGLCG 533

 Score =  100 bits (250), Expect = 6e-20
 Identities = 61/193 (31%), Positives = 97/193 (50%), Gaps = 25/193 (12%)
 Frame = +3

Query: 6   MSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           +S++ + GL  LDLS+N +  ++P + G L  +S   LS N+L G IP S+ K+++L  L
Sbjct: 174 LSVLSLKGLQELDLSDNDLSMKIPREIGNLLNISTLALSNNRLTGGIPSSMQKLSKLKKL 233

Query: 186 DLSMNRITGSIP-------------------------VRLGKMRVLSTLKLDGNSMTGQI 290
            L  N +TG IP                         + +G    L  L L GN+ +G I
Sbjct: 234 YLQNNLLTGEIPSWFLFSGASLGVLALSRNNFSGELPINIGDAAFLRILMLSGNNFSGPI 293

Query: 291 PSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGH 470
           P +L+    + +L+LSRN F G +P  F  ++ F  L L  NK +G +P +L     +  
Sbjct: 294 PQSLIHVPYLRLLDLSRNRFSGEVPTTFPKETKF--LALGGNKFSGGLPWNLTNLSKLER 351

Query: 471 LDISNNHLCGNIP 509
           L++ +N L G +P
Sbjct: 352 LELQDNKLTGELP 364

 Score =  100 bits (248), Expect = 1e-19
 Identities = 62/174 (35%), Positives = 88/174 (50%), Gaps = 1/174 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +  L +L L  N + G L S    L+ L    LS N L   IP  +  +  ++ 
Sbjct: 150 PPQLFHLPFLQYLSLDGNSLNGMLLSVLS-LKGLQELDLSDNDLSMKIPREIGNLLNIST 208

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLL-SNTGMGILNLSRNGFEGT 359
           L LS NR+TG IP  + K+  L  L L  N +TG+IPS  L S   +G+L LSRN F G 
Sbjct: 209 LALSNNRLTGGIPSSMQKLSKLKKLYLQNNLLTGEIPSWFLFSGASLGVLALSRNNFSGE 268

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSP 521
           +P   G  ++  +L LS N  +G +P SL    ++  LD+S N   G +P   P
Sbjct: 269 LPINIGDAAFLRILMLSGNNFSGPIPQSLIHVPYLRLLDLSRNRFSGEVPTTFP 322

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 61/181 (33%), Positives = 87/181 (48%), Gaps = 24/181 (13%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L LS N   GELP + G    L   +LS N   G IP S++ +  L  LDLS NR +G +
Sbjct: 258 LALSRNNFSGELPINIGDAAFLRILMLSGNNFSGPIPQSLIHVPYLRLLDLSRNRFSGEV 317

Query: 219 PVRLGK----------------------MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILN 332
           P    K                      +  L  L+L  N +TG++P+ L   + + +LN
Sbjct: 318 PTTFPKETKFLALGGNKFSGGLPWNLTNLSKLERLELQDNKLTGELPNFLSQISTLQVLN 377

Query: 333 LSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGH--LDISNNHLCGNI 506
           L  N F+G IP+   + S   +LD+S N LTG +P  ++      +  LD+SNN L G I
Sbjct: 378 LRNNSFQGLIPESIVNLSNLRILDVSNNNLTGEIPRDISSDNLNMYTLLDLSNNQLSGQI 437

Query: 507 P 509
           P
Sbjct: 438 P 438

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 51/140 (36%), Positives = 72/140 (51%), Gaps = 1/140 (0%)
 Frame = +3

Query: 93  LRKLSRALLSRNQLIGTIPD-SVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDG 269
           +R L    +S N + G IP      ++ L  L +  N  +GSIP +L  +  L  L LDG
Sbjct: 107 IRSLEWLHISDNNIQGEIPAVGFANLSNLVGLYMLGNNFSGSIPPQLFHLPFLQYLSLDG 166

Query: 270 NSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLA 449
           NS+ G + S +LS  G+  L+LS N     IP   G+      L LS N+LTG +P+S+ 
Sbjct: 167 NSLNGMLLS-VLSLKGLQELDLSDNDLSMKIPREIGNLLNISTLALSNNRLTGGIPSSMQ 225

Query: 450 KAKFMGHLDISNNHLCGNIP 509
           K   +  L + NN L G IP
Sbjct: 226 KLSKLKKLYLQNNLLTGEIP 245

[82][TOP]
>UniRef100_Q0JQL4 Os01g0153000 protein n=2 Tax=Oryza sativa Japonica Group
            RepID=Q0JQL4_ORYSJ
          Length = 1042

 Score =  126 bits (317), Expect = 1e-27
 Identities = 75/191 (39%), Positives = 105/191 (54%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLA 179
            P ++ ++  L  LDLS N + G +P +  +L  LS  L LS N L G IP  V  +  L 
Sbjct: 446  PATLGKLKKLFALDLSINHLNGSVPKEIFELPSLSWFLILSDNTLSGPIPSEVGTLVNLN 505

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
             ++LS N+++  IP  +G   VL  L LD NS  G IP +L    G+ ILNL+ N F G+
Sbjct: 506  SIELSGNQLSDQIPDSIGNCEVLEYLLLDSNSFEGSIPQSLTKLKGIAILNLTMNKFSGS 565

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
            IP+  GS      L L+ N L+G +P +L     + HLD+S N+L G +P    F +L  
Sbjct: 566  IPNAIGSMGNLQQLCLAHNNLSGSIPETLQNLTQLWHLDVSFNNLQGKVPDEGAFRNLTY 625

Query: 540  ASFSNNDCLCG 572
            AS + ND LCG
Sbjct: 626  ASVAGNDKLCG 636

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 56/170 (32%), Positives = 85/170 (50%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  ++ L   +LS+N + GE+P   G L+ L    L  N   G  PD++     L +
Sbjct: 77  PPAIGNLTFLRWFNLSSNGLHGEIPPSLGHLQHLRILDLGSNSFSGAFPDNLSSCISLIN 136

Query: 183 LDLSMNRITGSIPVRLGK-MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           L L  N+++G IPV+LG  +  L  L L  NS TG IP++L + + +  L L  N  +G 
Sbjct: 137 LTLGYNQLSGHIPVKLGNTLTWLQKLHLGNNSFTGPIPASLANLSSLEFLKLDFNHLKGL 196

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G+      + L  N L+G  P S+     +  L +  N L G+IP
Sbjct: 197 IPSSLGNIPNLQKIGLDGNSLSGEFPPSIWNLSKLTVLQVYENKLKGSIP 246

 Score = 84.3 bits (207), Expect = 6e-15
 Identities = 55/177 (31%), Positives = 83/177 (46%), Gaps = 7/177 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +S L  L L  N + G +PS  G +  L +  L  N L G  P S+  +++L  
Sbjct: 174 PASLANLSSLEFLKLDFNHLKGLIPSSLGNIPNLQKIGLDGNSLSGEFPPSIWNLSKLTV 233

Query: 183 LDLSMNRITGSIPVRLG-KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           L +  N++ GSIP  +G K+  +    L  N  +G IPS+L + + +  + L  N F G 
Sbjct: 234 LQVYENKLKGSIPANIGDKLPNMQHFVLSVNQFSGVIPSSLFNLSSLTDVYLDGNKFSGF 293

Query: 360 IPDVFGSKSYFMVLDLSFNKLTG------RVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           +P   G     + L LS N+L            SLA    +  LDI+ N   G +PI
Sbjct: 294 VPPTVGRLKSLVRLSLSSNRLEANNMKGWEFITSLANCSQLQQLDIAENSFIGQLPI 350

 Score = 84.3 bits (207), Expect = 6e-15
 Identities = 56/169 (33%), Positives = 81/169 (47%), Gaps = 2/169 (1%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRK-LSRALLSRNQLIGTIPDSVLKMNRLADL 185
           S+   S L  LD++ N  IG+LP     L   L +  L  N + G+IP  +  +  L  L
Sbjct: 327 SLANCSQLQQLDIAENSFIGQLPISIVNLSTTLQKFFLRGNSVSGSIPTDIGNLIGLDTL 386

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           DL    ++G IP  +GK+  L+ + L    ++G IPS + + T + IL       EG IP
Sbjct: 387 DLGSTSLSGVIPESIGKLADLAIITLYSTRLSGLIPSVIGNLTNLNILAAYDAHLEGPIP 446

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG-HLDISNNHLCGNIP 509
              G       LDLS N L G VP  + +   +   L +S+N L G IP
Sbjct: 447 ATLGKLKKLFALDLSINHLNGSVPKEIFELPSLSWFLILSDNTLSGPIP 495

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 52/176 (29%), Positives = 88/176 (50%), Gaps = 7/176 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIG------ELPSDFGKLRKLSRALLSRNQLIGTIPDSVLK 164
           P ++ R+  L+ L LS+N++        E  +      +L +  ++ N  IG +P S++ 
Sbjct: 295 PPTVGRLKSLVRLSLSSNRLEANNMKGWEFITSLANCSQLQQLDIAENSFIGQLPISIVN 354

Query: 165 MNR-LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
           ++  L    L  N ++GSIP  +G +  L TL L   S++G IP ++     + I+ L  
Sbjct: 355 LSTTLQKFFLRGNSVSGSIPTDIGNLIGLDTLDLGSTSLSGVIPESIGKLADLAIITLYS 414

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
               G IP V G+ +   +L      L G +P +L K K +  LD+S NHL G++P
Sbjct: 415 TRLSGLIPSVIGNLTNLNILAAYDAHLEGPIPATLGKLKKLFALDLSINHLNGSVP 470

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 52/171 (30%), Positives = 85/171 (49%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P ++     L++L L  NQ+ G +P   G  L  L +  L  N   G IP S+  ++ L 
Sbjct: 125 PDNLSSCISLINLTLGYNQLSGHIPVKLGNTLTWLQKLHLGNNSFTGPIPASLANLSSLE 184

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N + G IP  LG +  L  + LDGNS++G+ P ++ + + + +L +  N  +G+
Sbjct: 185 FLKLDFNHLKGLIPSSLGNIPNLQKIGLDGNSLSGEFPPSIWNLSKLTVLQVYENKLKGS 244

Query: 360 IPDVFGSKSYFMV-LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G K   M    LS N+ +G +P+SL     +  + +  N   G +P
Sbjct: 245 IPANIGDKLPNMQHFVLSVNQFSGVIPSSLFNLSSLTDVYLDGNKFSGFVP 295

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 51/170 (30%), Positives = 81/170 (47%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  + GL  LDL +  + G +P   GKL  L+   L   +L G IP  +  +  L  
Sbjct: 374 PTDIGNLIGLDTLDLGSTSLSGVIPESIGKLADLAIITLYSTRLSGLIPSVIGNLTNLNI 433

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMG-ILNLSRNGFEGT 359
           L      + G IP  LGK++ L  L L  N + G +P  +     +   L LS N   G 
Sbjct: 434 LAAYDAHLEGPIPATLGKLKKLFALDLSINHLNGSVPKEIFELPSLSWFLILSDNTLSGP 493

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G+      ++LS N+L+ ++P+S+   + + +L + +N   G+IP
Sbjct: 494 IPSEVGTLVNLNSIELSGNQLSDQIPDSIGNCEVLEYLLLDSNSFEGSIP 543

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 35/114 (30%), Positives = 55/114 (48%), Gaps = 1/114 (0%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  L L  + + G++P  +G +  L    L  N + G+IP +L     + IL+L  N F
Sbjct: 61  RVVGLSLPSSNLAGTLPPAIGNLTFLRWFNLSSNGLHGEIPPSLGHLQHLRILDLGSNSF 120

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA-KFMGHLDISNNHLCGNIP 509
            G  PD   S    + L L +N+L+G +P  L     ++  L + NN   G IP
Sbjct: 121 SGAFPDNLSSCISLINLTLGYNQLSGHIPVKLGNTLTWLQKLHLGNNSFTGPIP 174

 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 31/103 (30%), Positives = 50/103 (48%), Gaps = 2/103 (1%)
 Frame = +3

Query: 255 LKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRV 434
           L L  +++ G +P  + + T +   NLS NG  G IP   G   +  +LDL  N  +G  
Sbjct: 65  LSLPSSNLAGTLPPAIGNLTFLRWFNLSSNGLHGEIPPSLGHLQHLRILDLGSNSFSGAF 124

Query: 435 PNSLAKAKFMGHLDISNNHLCGNIPI--GSPFDHLDAASFSNN 557
           P++L+    + +L +  N L G+IP+  G+    L      NN
Sbjct: 125 PDNLSSCISLINLTLGYNQLSGHIPVKLGNTLTWLQKLHLGNN 167

[83][TOP]
>UniRef100_Q53K08 Leucine Rich Repeat family protein, expressed n=1 Tax=Oryza sativa
            Japonica Group RepID=Q53K08_ORYSJ
          Length = 1086

 Score =  126 bits (317), Expect = 1e-27
 Identities = 67/178 (37%), Positives = 99/178 (55%)
 Frame = +3

Query: 39   LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
            L L +N++ G +P D G L KL   +LS NQL  T+P S+  ++ L  LDLS N  +  +
Sbjct: 545  LFLQSNKLSGSIPKDMGNLTKLEHLVLSNNQLSSTVPPSIFHLSSLIQLDLSHNFFSDVL 604

Query: 219  PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
            PV +G M+ ++ + L  N  TG IP+++     +  LNLS N F+ +IPD FG  +    
Sbjct: 605  PVDIGNMKQINNIDLSTNRFTGSIPNSIGQLQMISYLNLSVNSFDDSIPDSFGELTSLQT 664

Query: 399  LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
            LDL  N ++G +P  LA    +  L++S N+L G IP G  F ++   S   N  LCG
Sbjct: 665  LDLFHNNISGTIPKYLANFTILISLNLSFNNLHGQIPKGGVFSNITLQSLVGNSGLCG 722

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 64/183 (34%), Positives = 92/183 (50%), Gaps = 3/183 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  L+L+N  + G LP D G+L +L    L  N L G IP ++  + RL  LDL  N
Sbjct: 101 LSFLSILNLTNTGLTGSLPDDIGRLHRLEILELGYNTLSGRIPATIGNLTRLQVLDLQFN 160

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFG 377
            ++G IP  L  ++ LS++ L  N + G IP+ L +NT  +  LN+  N   G IP   G
Sbjct: 161 SLSGPIPADLQNLQNLSSINLRRNYLIGLIPNNLFNNTHLLTYLNIGNNSLSGPIPGCIG 220

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFD--HLDAASFS 551
           S      L L  N LTG VP ++     +  L +  N L G +P  + F+   L   S +
Sbjct: 221 SLPILQTLVLQVNNLTGPVPPAIFNMSTLRALALGLNGLTGPLPGNASFNLPALQWFSIT 280

Query: 552 NND 560
            ND
Sbjct: 281 RND 283

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 52/169 (30%), Positives = 89/169 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  ++GLM L LS+NQ    +P    ++  L    LS N L G++P +   +     
Sbjct: 485 PSTISNLTGLMVLALSDNQFHSTIPESIMEMVNLRWLDLSGNSLAGSVPSNAGMLKNAEK 544

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+++GSIP  +G +  L  L L  N ++  +P ++   + +  L+LS N F   +
Sbjct: 545 LFLQSNKLSGSIPKDMGNLTKLEHLVLSNNQLSSTVPPSIFHLSSLIQLDLSHNFFSDVL 604

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+      +DLS N+ TG +PNS+ + + + +L++S N    +IP
Sbjct: 605 PVDIGNMKQINNIDLSTNRFTGSIPNSIGQLQMISYLNLSVNSFDDSIP 653

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 55/162 (33%), Positives = 83/162 (51%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L    ++ N++ GE+PS    L  L    LS NQ   TIP+S+++M  L  LDLS N 
Sbjct: 468 STLQSFVVAGNKLGGEIPSTISNLTGLMVLALSDNQFHSTIPESIMEMVNLRWLDLSGNS 527

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           + GS+P   G ++    L L  N ++G IP  + + T +  L LS N    T+P      
Sbjct: 528 LAGSVPSNAGMLKNAEKLFLQSNKLSGSIPKDMGNLTKLEHLVLSNNQLSSTVPPSIFHL 587

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           S  + LDLS N  +  +P  +   K + ++D+S N   G+IP
Sbjct: 588 SSLIQLDLSHNFFSDVLPVDIGNMKQINNIDLSTNRFTGSIP 629

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 51/158 (32%), Positives = 84/158 (53%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           LDL +  ++GEL    G L  LS   L+   L G++PD + +++RL  L+L  N ++G I
Sbjct: 83  LDLRDTPLLGELSPQLGNLSFLSILNLTNTGLTGSLPDDIGRLHRLEILELGYNTLSGRI 142

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFM 395
           P  +G +  L  L L  NS++G IP+ L +   +  +NL RN   G IP ++F +     
Sbjct: 143 PATIGNLTRLQVLDLQFNSLSGPIPADLQNLQNLSSINLRRNYLIGLIPNNLFNNTHLLT 202

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L++  N L+G +P  +     +  L +  N+L G +P
Sbjct: 203 YLNIGNNSLSGPIPGCIGSLPILQTLVLQVNNLTGPVP 240

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 55/174 (31%), Positives = 89/174 (51%), Gaps = 5/174 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  ++ L  LDL  N + G +P+D   L+ LS   L RN LIG IP+++     L  
Sbjct: 143 PATIGNLTRLQVLDLQFNSLSGPIPADLQNLQNLSSINLRRNYLIGLIPNNLFNNTHLLT 202

Query: 183 -LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L++  N ++G IP  +G + +L TL L  N++TG +P  + + + +  L L  NG  G 
Sbjct: 203 YLNIGNNSLSGPIPGCIGSLPILQTLVLQVNNLTGPVPPAIFNMSTLRALALGLNGLTGP 262

Query: 360 IPDVFGSKSY----FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+ S+         ++ N  TG +P  LA  +++  L + NN   G  P
Sbjct: 263 LP---GNASFNLPALQWFSITRNDFTGPIPVGLAACQYLQVLGLPNNLFQGAFP 313

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 47/121 (38%), Positives = 72/121 (59%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +S L+ LDLS+N     LP D G +++++   LS N+  G+IP+S+ ++  ++ 
Sbjct: 581 PPSIFHLSSLIQLDLSHNFFSDVLPVDIGNMKQINNIDLSTNRFTGSIPNSIGQLQMISY 640

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LS+N    SIP   G++  L TL L  N+++G IP  L + T +  LNLS N   G I
Sbjct: 641 LNLSVNSFDDSIPDSFGELTSLQTLDLFHNNISGTIPKYLANFTILISLNLSFNNLHGQI 700

Query: 363 P 365
           P
Sbjct: 701 P 701

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 49/163 (30%), Positives = 79/163 (48%), Gaps = 2/163 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L +L++ NN + G +P   G L  L   +L  N L G +P ++  M+ L  L L +N +T
Sbjct: 201 LTYLNIGNNSLSGPIPGCIGSLPILQTLVLQVNNLTGPVPPAIFNMSTLRALALGLNGLT 260

Query: 210 GSIPVRLG-KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           G +P      +  L    +  N  TG IP  L +   + +L L  N F+G  P   G  +
Sbjct: 261 GPLPGNASFNLPALQWFSITRNDFTGPIPVGLAACQYLQVLGLPNNLFQGAFPPWLGKLT 320

Query: 387 YFMVLDLSFNKL-TGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
              ++ L  NKL  G +P +L     +  LD+++ +L G IP+
Sbjct: 321 NLNIVSLGGNKLDAGPIPAALGNLTMLSVLDLASCNLTGPIPL 363

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 59/221 (26%), Positives = 96/221 (43%), Gaps = 52/221 (23%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQI-IGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  + +++ L  + L  N++  G +P+  G L  LS   L+   L G IP  +  + +L+
Sbjct: 313 PPWLGKLTNLNIVSLGGNKLDAGPIPAALGNLTMLSVLDLASCNLTGPIPLDIRHLGQLS 372

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNG---- 347
           +L LSMN++TG IP  +G +  LS L L GN + G +P+T+ +   +  LN++ N     
Sbjct: 373 ELHLSMNQLTGPIPASIGNLSALSYLLLMGNMLDGLVPATVGNMNSLRGLNIAENHLQGD 432

Query: 348 ----------------------FEGTIPDVFGSKSY------------------------ 389
                                 F G +PD  G+ S                         
Sbjct: 433 LEFLSTVSNCRKLSFLRVDSNYFTGNLPDYVGNLSSTLQSFVVAGNKLGGEIPSTISNLT 492

Query: 390 -FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             MVL LS N+    +P S+ +   +  LD+S N L G++P
Sbjct: 493 GLMVLALSDNQFHSTIPESIMEMVNLRWLDLSGNSLAGSVP 533

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 54/171 (31%), Positives = 79/171 (46%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  +S L  L L  N + G LP +    L  L    ++RN   G IP  +     L 
Sbjct: 240 PPAIFNMSTLRALALGLNGLTGPLPGNASFNLPALQWFSITRNDFTGPIPVGLAACQYLQ 299

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSM-TGQIPSTLLSNTGMGILNLSRNGFEG 356
            L L  N   G+ P  LGK+  L+ + L GN +  G IP+ L + T + +L+L+     G
Sbjct: 300 VLGLPNNLFQGAFPPWLGKLTNLNIVSLGGNKLDAGPIPAALGNLTMLSVLDLASCNLTG 359

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            IP           L LS N+LTG +P S+     + +L +  N L G +P
Sbjct: 360 PIPLDIRHLGQLSELHLSMNQLTGPIPASIGNLSALSYLLLMGNMLDGLVP 410

[84][TOP]
>UniRef100_Q2QZC3 Leucine Rich Repeat family protein n=1 Tax=Oryza sativa Japonica
            Group RepID=Q2QZC3_ORYSJ
          Length = 1172

 Score =  126 bits (317), Expect = 1e-27
 Identities = 70/214 (32%), Positives = 115/214 (53%), Gaps = 24/214 (11%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLR------------------------KLSR 110
            P SI+ +  L+ LDLS N ++G +PS+ G L+                        KL  
Sbjct: 509  PESIMEMENLLELDLSGNSLVGSIPSNAGMLKNAEHLFLQGNKFSGSIPKGIGNLTKLEI 568

Query: 111  ALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQI 290
              LS NQL  T+P S+ ++  L  L+LS N ++G++P+ +G+++ ++++ L  N   G +
Sbjct: 569  LRLSNNQLSSTLPPSLFRLESLIQLNLSQNFLSGALPIDIGQLKRINSMDLSRNRFLGSL 628

Query: 291  PSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGH 470
            P ++     + ILNLS N  +G+IP+ FG+ +    LDLS N+++G +P  LA    +  
Sbjct: 629  PDSIGELQMITILNLSTNSIDGSIPNSFGNLTGLQTLDLSHNRISGTIPEYLANFTILTS 688

Query: 471  LDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
            L++S N+L G IP G  F ++   S   N  LCG
Sbjct: 689  LNLSFNNLHGQIPEGGVFTNITLQSLVGNPGLCG 722

 Score =  102 bits (254), Expect = 2e-20
 Identities = 66/213 (30%), Positives = 100/213 (46%), Gaps = 28/213 (13%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P+ I ++  L  L L  NQ+ G +P+  G L  L+R +L+ NQL G++P S+  +N L D
Sbjct: 362  PVDIGQLDQLWELQLLGNQLTGPIPASLGNLSSLARLVLNENQLDGSVPASIGNINYLTD 421

Query: 183  LDLSMNRI--------------------------TGSIPVRLGKMR-VLSTLKLDGNSMT 281
              +S NR+                          TGSIP  +G +   L   +   N +T
Sbjct: 422  FIVSENRLHGDLNFLSTFSNCRNLSWIYIGMNYFTGSIPDYIGNLSGTLQEFRSHRNKLT 481

Query: 282  GQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF 461
            GQ+P +  + TG+ ++ LS N  +G IP+        + LDLS N L G +P++    K 
Sbjct: 482  GQLPPSFSNLTGLRVIELSDNQLQGAIPESIMEMENLLELDLSGNSLVGSIPSNAGMLKN 541

Query: 462  MGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
              HL +  N   G+IP G      L+    SNN
Sbjct: 542  AEHLFLQGNKFSGSIPKGIGNLTKLEILRLSNN 574

 Score =  101 bits (252), Expect = 4e-20
 Identities = 61/170 (35%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISG-LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  +SG L       N++ G+LP  F  L  L    LS NQL G IP+S+++M  L 
Sbjct: 460 PDYIGNLSGTLQEFRSHRNKLTGQLPPSFSNLTGLRVIELSDNQLQGAIPESIMEMENLL 519

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           +LDLS N + GSIP   G ++    L L GN  +G IP  + + T + IL LS N    T
Sbjct: 520 ELDLSGNSLVGSIPSNAGMLKNAEHLFLQGNKFSGSIPKGIGNLTKLEILRLSNNQLSST 579

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P         + L+LS N L+G +P  + + K +  +D+S N   G++P
Sbjct: 580 LPPSLFRLESLIQLNLSQNFLSGALPIDIGQLKRINSMDLSRNRFLGSLP 629

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 56/169 (33%), Positives = 89/169 (52%), Gaps = 1/169 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  L+L+N  + G LP D G+L +L    L  N ++G IP ++  ++RL  L+L  N
Sbjct: 101 LSFLSVLNLTNTGLTGLLPDDIGRLHRLELLDLGHNAMLGGIPATIGNLSRLQLLNLQFN 160

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT-GMGILNLSRNGFEGTIPDVFG 377
           +++G IP  L  +R L  + +  N +TG +P+ L ++T  +  L +  N   G IP   G
Sbjct: 161 QLSGRIPTELQGLRSLININIQTNYLTGLVPNDLFNHTPSLRRLIMGNNSLSGPIPGCIG 220

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF 524
           S      L L  N LTG VP S+     +  + +++N L G IP  + F
Sbjct: 221 SLHMLEWLVLQHNNLTGPVPPSIFNMSRLTVIALASNGLTGPIPGNTSF 269

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 50/158 (31%), Positives = 79/158 (50%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+L N  + GEL S  G L  LS   L+   L G +PD + +++RL  LDL  N + G I
Sbjct: 83  LELPNVPLQGELSSHLGNLSFLSVLNLTNTGLTGLLPDDIGRLHRLELLDLGHNAMLGGI 142

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFM 395
           P  +G +  L  L L  N ++G+IP+ L     +  +N+  N   G +P D+F       
Sbjct: 143 PATIGNLSRLQLLNLQFNQLSGRIPTELQGLRSLININIQTNYLTGLVPNDLFNHTPSLR 202

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L +  N L+G +P  +     +  L + +N+L G +P
Sbjct: 203 RLIMGNNSLSGPIPGCIGSLHMLEWLVLQHNNLTGPVP 240

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 54/172 (31%), Positives = 91/172 (52%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQL-IGTIPDSVLKMNRLA 179
           PM +     L  + + +N   G LPS   KLR L+   LS N    G IP  +  +  L 
Sbjct: 289 PMGLAACPYLQTISMHDNLFEGVLPSWLSKLRNLTGLTLSWNNFDAGPIPAGLSNLTMLT 348

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            LDL+   +TG+IPV +G++  L  L+L GN +TG IP++L + + +  L L+ N  +G+
Sbjct: 349 ALDLNGCNLTGAIPVDIGQLDQLWELQLLGNQLTGPIPASLGNLSSLARLVLNENQLDGS 408

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+ +Y     +S N+L G +   ++ +  + +  + I  N+  G+IP
Sbjct: 409 VPASIGNINYLTDFIVSENRLHGDLNFLSTFSNCRNLSWIYIGMNYFTGSIP 460

 Score = 80.5 bits (197), Expect = 9e-14
 Identities = 50/163 (30%), Positives = 78/163 (47%), Gaps = 2/163 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L + NN + G +P   G L  L   +L  N L G +P S+  M+RL  + L+ N +T
Sbjct: 201 LRRLIMGNNSLSGPIPGCIGSLHMLEWLVLQHNNLTGPVPPSIFNMSRLTVIALASNGLT 260

Query: 210 GSIPVRLG-KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           G IP      +  L  + +  N+ TGQIP  L +   +  +++  N FEG +P       
Sbjct: 261 GPIPGNTSFSLPALQRIYISINNFTGQIPMGLAACPYLQTISMHDNLFEGVLPSWLSKLR 320

Query: 387 YFMVLDLSFNKL-TGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               L LS+N    G +P  L+    +  LD++  +L G IP+
Sbjct: 321 NLTGLTLSWNNFDAGPIPAGLSNLTMLTALDLNGCNLTGAIPV 363

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 55/173 (31%), Positives = 85/173 (49%), Gaps = 2/173 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I R+  L  LDL +N ++G +P+  G L +L    L  NQL G IP  +  +  L +
Sbjct: 119 PDDIGRLHRLELLDLGHNAMLGGIPATIGNLSRLQLLNLQFNQLSGRIPTELQGLRSLIN 178

Query: 183 LDLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           +++  N +TG +P  L      L  L +  NS++G IP  + S   +  L L  N   G 
Sbjct: 179 INIQTNYLTGLVPNDLFNHTPSLRRLIMGNNSLSGPIPGCIGSLHMLEWLVLQHNNLTGP 238

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP-NSLAKAKFMGHLDISNNHLCGNIPIG 515
           +P    + S   V+ L+ N LTG +P N+      +  + IS N+  G IP+G
Sbjct: 239 VPPSIFNMSRLTVIALASNGLTGPIPGNTSFSLPALQRIYISINNFTGQIPMG 291

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 35/113 (30%), Positives = 59/113 (52%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  L+L    + G +   LG +  LS L L    +TG +P  +     + +L+L  N  
Sbjct: 79  RVVALELPNVPLQGELSSHLGNLSFLSVLNLTNTGLTGLLPDDIGRLHRLELLDLGHNAM 138

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G IP   G+ S   +L+L FN+L+GR+P  L   + + +++I  N+L G +P
Sbjct: 139 LGGIPATIGNLSRLQLLNLQFNQLSGRIPTELQGLRSLININIQTNYLTGLVP 191

[85][TOP]
>UniRef100_Q2EZ11 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
            RepID=Q2EZ11_ORYSI
          Length = 1097

 Score =  126 bits (317), Expect = 1e-27
 Identities = 70/214 (32%), Positives = 115/214 (53%), Gaps = 24/214 (11%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLR------------------------KLSR 110
            P SI+ +  L+ LDLS N ++G +PS+ G L+                        KL  
Sbjct: 509  PESIMEMENLLELDLSGNSLVGSIPSNAGMLKNAEHLFLQGNKFSGSIPKGIGNLTKLEI 568

Query: 111  ALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQI 290
              LS NQL  T+P S+ ++  L  L+LS N ++G++P+ +G+++ ++++ L  N   G +
Sbjct: 569  LRLSNNQLSSTLPPSLFRLESLIQLNLSQNFLSGALPIDIGQLKRINSMDLSRNRFLGSL 628

Query: 291  PSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGH 470
            P ++     + ILNLS N  +G+IP+ FG+ +    LDLS N+++G +P  LA    +  
Sbjct: 629  PDSIGELQMITILNLSTNSIDGSIPNSFGNLTGLQTLDLSHNRISGTIPEYLANFTILTS 688

Query: 471  LDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
            L++S N+L G IP G  F ++   S   N  LCG
Sbjct: 689  LNLSFNNLHGQIPEGGVFTNITLQSLVGNPGLCG 722

 Score =  102 bits (254), Expect = 2e-20
 Identities = 66/213 (30%), Positives = 100/213 (46%), Gaps = 28/213 (13%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P+ I ++  L  L L  NQ+ G +P+  G L  L+R +L+ NQL G++P S+  +N L D
Sbjct: 362  PVDIGQLDQLWELQLLGNQLTGPIPASLGNLSSLARLVLNENQLDGSVPASIGNINYLTD 421

Query: 183  LDLSMNRI--------------------------TGSIPVRLGKMR-VLSTLKLDGNSMT 281
              +S NR+                          TGSIP  +G +   L   +   N +T
Sbjct: 422  FIVSENRLHGDLNFLSTFSNCRNLSWIYIGMNYFTGSIPDYIGNLSGTLQEFRSHRNKLT 481

Query: 282  GQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF 461
            GQ+P +  + TG+ ++ LS N  +G IP+        + LDLS N L G +P++    K 
Sbjct: 482  GQLPPSFSNLTGLRVIELSDNQLQGAIPESIMEMENLLELDLSGNSLVGSIPSNAGMLKN 541

Query: 462  MGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
              HL +  N   G+IP G      L+    SNN
Sbjct: 542  AEHLFLQGNKFSGSIPKGIGNLTKLEILRLSNN 574

 Score =  101 bits (252), Expect = 4e-20
 Identities = 61/170 (35%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISG-LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  +SG L       N++ G+LP  F  L  L    LS NQL G IP+S+++M  L 
Sbjct: 460 PDYIGNLSGTLQEFRSHRNKLTGQLPPSFSNLTGLRVIELSDNQLQGAIPESIMEMENLL 519

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           +LDLS N + GSIP   G ++    L L GN  +G IP  + + T + IL LS N    T
Sbjct: 520 ELDLSGNSLVGSIPSNAGMLKNAEHLFLQGNKFSGSIPKGIGNLTKLEILRLSNNQLSST 579

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P         + L+LS N L+G +P  + + K +  +D+S N   G++P
Sbjct: 580 LPPSLFRLESLIQLNLSQNFLSGALPIDIGQLKRINSMDLSRNRFLGSLP 629

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 56/169 (33%), Positives = 89/169 (52%), Gaps = 1/169 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  L+L+N  + G LP D G+L +L    L  N ++G IP ++  ++RL  L+L  N
Sbjct: 101 LSFLSVLNLTNTGLTGLLPDDIGRLHRLELLDLGHNAMLGGIPATIGNLSRLQLLNLQFN 160

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT-GMGILNLSRNGFEGTIPDVFG 377
           +++G IP  L  +R L  + +  N +TG +P+ L ++T  +  L +  N   G IP   G
Sbjct: 161 QLSGRIPTELQGLRSLININIQTNYLTGLVPNDLFNHTPSLRRLIMGNNSLSGPIPGCIG 220

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF 524
           S      L L  N LTG VP S+     +  + +++N L G IP  + F
Sbjct: 221 SLHMLEWLVLQHNNLTGPVPPSIFNMSRLTVIALASNGLTGPIPGNTSF 269

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 50/158 (31%), Positives = 79/158 (50%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+L N  + GEL S  G L  LS   L+   L G +PD + +++RL  LDL  N + G I
Sbjct: 83  LELPNVPLQGELSSHLGNLSFLSVLNLTNTGLTGLLPDDIGRLHRLELLDLGHNAMLGGI 142

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFM 395
           P  +G +  L  L L  N ++G+IP+ L     +  +N+  N   G +P D+F       
Sbjct: 143 PATIGNLSRLQLLNLQFNQLSGRIPTELQGLRSLININIQTNYLTGLVPNDLFNHTPSLR 202

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L +  N L+G +P  +     +  L + +N+L G +P
Sbjct: 203 RLIMGNNSLSGPIPGCIGSLHMLEWLVLQHNNLTGPVP 240

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 54/172 (31%), Positives = 91/172 (52%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQL-IGTIPDSVLKMNRLA 179
           PM +     L  + + +N   G LPS   KLR L+   LS N    G IP  +  +  L 
Sbjct: 289 PMGLAACPYLQTISMHDNLFEGVLPSWLSKLRNLTGLTLSWNNFDAGPIPAGLSNLTMLT 348

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            LDL+   +TG+IPV +G++  L  L+L GN +TG IP++L + + +  L L+ N  +G+
Sbjct: 349 ALDLNGCNLTGAIPVDIGQLDQLWELQLLGNQLTGPIPASLGNLSSLARLVLNENQLDGS 408

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+ +Y     +S N+L G +   ++ +  + +  + I  N+  G+IP
Sbjct: 409 VPASIGNINYLTDFIVSENRLHGDLNFLSTFSNCRNLSWIYIGMNYFTGSIP 460

 Score = 80.5 bits (197), Expect = 9e-14
 Identities = 50/163 (30%), Positives = 78/163 (47%), Gaps = 2/163 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L + NN + G +P   G L  L   +L  N L G +P S+  M+RL  + L+ N +T
Sbjct: 201 LRRLIMGNNSLSGPIPGCIGSLHMLEWLVLQHNNLTGPVPPSIFNMSRLTVIALASNGLT 260

Query: 210 GSIPVRLG-KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           G IP      +  L  + +  N+ TGQIP  L +   +  +++  N FEG +P       
Sbjct: 261 GPIPGNTSFSLPALQRIYISINNFTGQIPMGLAACPYLQTISMHDNLFEGVLPSWLSKLR 320

Query: 387 YFMVLDLSFNKL-TGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               L LS+N    G +P  L+    +  LD++  +L G IP+
Sbjct: 321 NLTGLTLSWNNFDAGPIPAGLSNLTMLTALDLNGCNLTGAIPV 363

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 55/173 (31%), Positives = 85/173 (49%), Gaps = 2/173 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I R+  L  LDL +N ++G +P+  G L +L    L  NQL G IP  +  +  L +
Sbjct: 119 PDDIGRLHRLELLDLGHNAMLGGIPATIGNLSRLQLLNLQFNQLSGRIPTELQGLRSLIN 178

Query: 183 LDLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           +++  N +TG +P  L      L  L +  NS++G IP  + S   +  L L  N   G 
Sbjct: 179 INIQTNYLTGLVPNDLFNHTPSLRRLIMGNNSLSGPIPGCIGSLHMLEWLVLQHNNLTGP 238

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP-NSLAKAKFMGHLDISNNHLCGNIPIG 515
           +P    + S   V+ L+ N LTG +P N+      +  + IS N+  G IP+G
Sbjct: 239 VPPSIFNMSRLTVIALASNGLTGPIPGNTSFSLPALQRIYISINNFTGQIPMG 291

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 35/113 (30%), Positives = 59/113 (52%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  L+L    + G +   LG +  LS L L    +TG +P  +     + +L+L  N  
Sbjct: 79  RVVALELPNVPLQGELSSHLGNLSFLSVLNLTNTGLTGLLPDDIGRLHRLELLDLGHNAM 138

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G IP   G+ S   +L+L FN+L+GR+P  L   + + +++I  N+L G +P
Sbjct: 139 LGGIPATIGNLSRLQLLNLQFNQLSGRIPTELQGLRSLININIQTNYLTGLVP 191

[86][TOP]
>UniRef100_Q0IR06 Os11g0692100 protein n=1 Tax=Oryza sativa Japonica Group
            RepID=Q0IR06_ORYSJ
          Length = 1164

 Score =  126 bits (317), Expect = 1e-27
 Identities = 70/214 (32%), Positives = 115/214 (53%), Gaps = 24/214 (11%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLR------------------------KLSR 110
            P SI+ +  L+ LDLS N ++G +PS+ G L+                        KL  
Sbjct: 509  PESIMEMENLLELDLSGNSLVGSIPSNAGMLKNAEHLFLQGNKFSGSIPKGIGNLTKLEI 568

Query: 111  ALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQI 290
              LS NQL  T+P S+ ++  L  L+LS N ++G++P+ +G+++ ++++ L  N   G +
Sbjct: 569  LRLSNNQLSSTLPPSLFRLESLIQLNLSQNFLSGALPIDIGQLKRINSMDLSRNRFLGSL 628

Query: 291  PSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGH 470
            P ++     + ILNLS N  +G+IP+ FG+ +    LDLS N+++G +P  LA    +  
Sbjct: 629  PDSIGELQMITILNLSTNSIDGSIPNSFGNLTGLQTLDLSHNRISGTIPEYLANFTILTS 688

Query: 471  LDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
            L++S N+L G IP G  F ++   S   N  LCG
Sbjct: 689  LNLSFNNLHGQIPEGGVFTNITLQSLVGNPGLCG 722

 Score =  102 bits (254), Expect = 2e-20
 Identities = 66/213 (30%), Positives = 100/213 (46%), Gaps = 28/213 (13%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P+ I ++  L  L L  NQ+ G +P+  G L  L+R +L+ NQL G++P S+  +N L D
Sbjct: 362  PVDIGQLDQLWELQLLGNQLTGPIPASLGNLSSLARLVLNENQLDGSVPASIGNINYLTD 421

Query: 183  LDLSMNRI--------------------------TGSIPVRLGKMR-VLSTLKLDGNSMT 281
              +S NR+                          TGSIP  +G +   L   +   N +T
Sbjct: 422  FIVSENRLHGDLNFLSTFSNCRNLSWIYIGMNYFTGSIPDYIGNLSGTLQEFRSHRNKLT 481

Query: 282  GQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF 461
            GQ+P +  + TG+ ++ LS N  +G IP+        + LDLS N L G +P++    K 
Sbjct: 482  GQLPPSFSNLTGLRVIELSDNQLQGAIPESIMEMENLLELDLSGNSLVGSIPSNAGMLKN 541

Query: 462  MGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
              HL +  N   G+IP G      L+    SNN
Sbjct: 542  AEHLFLQGNKFSGSIPKGIGNLTKLEILRLSNN 574

 Score =  101 bits (252), Expect = 4e-20
 Identities = 61/170 (35%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISG-LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  +SG L       N++ G+LP  F  L  L    LS NQL G IP+S+++M  L 
Sbjct: 460 PDYIGNLSGTLQEFRSHRNKLTGQLPPSFSNLTGLRVIELSDNQLQGAIPESIMEMENLL 519

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           +LDLS N + GSIP   G ++    L L GN  +G IP  + + T + IL LS N    T
Sbjct: 520 ELDLSGNSLVGSIPSNAGMLKNAEHLFLQGNKFSGSIPKGIGNLTKLEILRLSNNQLSST 579

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P         + L+LS N L+G +P  + + K +  +D+S N   G++P
Sbjct: 580 LPPSLFRLESLIQLNLSQNFLSGALPIDIGQLKRINSMDLSRNRFLGSLP 629

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 56/169 (33%), Positives = 89/169 (52%), Gaps = 1/169 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  L+L+N  + G LP D G+L +L    L  N ++G IP ++  ++RL  L+L  N
Sbjct: 101 LSFLSVLNLTNTGLTGLLPDDIGRLHRLELLDLGHNAMLGGIPATIGNLSRLQLLNLQFN 160

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT-GMGILNLSRNGFEGTIPDVFG 377
           +++G IP  L  +R L  + +  N +TG +P+ L ++T  +  L +  N   G IP   G
Sbjct: 161 QLSGRIPTELQGLRSLININIQTNYLTGLVPNDLFNHTPSLRRLIMGNNSLSGPIPGCIG 220

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF 524
           S      L L  N LTG VP S+     +  + +++N L G IP  + F
Sbjct: 221 SLHMLEWLVLQHNNLTGPVPPSIFNMSRLTVIALASNGLTGPIPGNTSF 269

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 50/158 (31%), Positives = 79/158 (50%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+L N  + GEL S  G L  LS   L+   L G +PD + +++RL  LDL  N + G I
Sbjct: 83  LELPNVPLQGELSSHLGNLSFLSVLNLTNTGLTGLLPDDIGRLHRLELLDLGHNAMLGGI 142

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFM 395
           P  +G +  L  L L  N ++G+IP+ L     +  +N+  N   G +P D+F       
Sbjct: 143 PATIGNLSRLQLLNLQFNQLSGRIPTELQGLRSLININIQTNYLTGLVPNDLFNHTPSLR 202

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L +  N L+G +P  +     +  L + +N+L G +P
Sbjct: 203 RLIMGNNSLSGPIPGCIGSLHMLEWLVLQHNNLTGPVP 240

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 54/172 (31%), Positives = 91/172 (52%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQL-IGTIPDSVLKMNRLA 179
           PM +     L  + + +N   G LPS   KLR L+   LS N    G IP  +  +  L 
Sbjct: 289 PMGLAACPYLQTISMHDNLFEGVLPSWLSKLRNLTGLTLSWNNFDAGPIPAGLSNLTMLT 348

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            LDL+   +TG+IPV +G++  L  L+L GN +TG IP++L + + +  L L+ N  +G+
Sbjct: 349 ALDLNGCNLTGAIPVDIGQLDQLWELQLLGNQLTGPIPASLGNLSSLARLVLNENQLDGS 408

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+ +Y     +S N+L G +   ++ +  + +  + I  N+  G+IP
Sbjct: 409 VPASIGNINYLTDFIVSENRLHGDLNFLSTFSNCRNLSWIYIGMNYFTGSIP 460

 Score = 80.5 bits (197), Expect = 9e-14
 Identities = 50/163 (30%), Positives = 78/163 (47%), Gaps = 2/163 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L + NN + G +P   G L  L   +L  N L G +P S+  M+RL  + L+ N +T
Sbjct: 201 LRRLIMGNNSLSGPIPGCIGSLHMLEWLVLQHNNLTGPVPPSIFNMSRLTVIALASNGLT 260

Query: 210 GSIPVRLG-KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           G IP      +  L  + +  N+ TGQIP  L +   +  +++  N FEG +P       
Sbjct: 261 GPIPGNTSFSLPALQRIYISINNFTGQIPMGLAACPYLQTISMHDNLFEGVLPSWLSKLR 320

Query: 387 YFMVLDLSFNKL-TGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               L LS+N    G +P  L+    +  LD++  +L G IP+
Sbjct: 321 NLTGLTLSWNNFDAGPIPAGLSNLTMLTALDLNGCNLTGAIPV 363

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 55/173 (31%), Positives = 85/173 (49%), Gaps = 2/173 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I R+  L  LDL +N ++G +P+  G L +L    L  NQL G IP  +  +  L +
Sbjct: 119 PDDIGRLHRLELLDLGHNAMLGGIPATIGNLSRLQLLNLQFNQLSGRIPTELQGLRSLIN 178

Query: 183 LDLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           +++  N +TG +P  L      L  L +  NS++G IP  + S   +  L L  N   G 
Sbjct: 179 INIQTNYLTGLVPNDLFNHTPSLRRLIMGNNSLSGPIPGCIGSLHMLEWLVLQHNNLTGP 238

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP-NSLAKAKFMGHLDISNNHLCGNIPIG 515
           +P    + S   V+ L+ N LTG +P N+      +  + IS N+  G IP+G
Sbjct: 239 VPPSIFNMSRLTVIALASNGLTGPIPGNTSFSLPALQRIYISINNFTGQIPMG 291

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 35/113 (30%), Positives = 59/113 (52%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  L+L    + G +   LG +  LS L L    +TG +P  +     + +L+L  N  
Sbjct: 79  RVVALELPNVPLQGELSSHLGNLSFLSVLNLTNTGLTGLLPDDIGRLHRLELLDLGHNAM 138

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G IP   G+ S   +L+L FN+L+GR+P  L   + + +++I  N+L G +P
Sbjct: 139 LGGIPATIGNLSRLQLLNLQFNQLSGRIPTELQGLRSLININIQTNYLTGLVP 191

[87][TOP]
>UniRef100_C5Y2P1 Putative uncharacterized protein Sb05g018020 n=1 Tax=Sorghum bicolor
            RepID=C5Y2P1_SORBI
          Length = 1006

 Score =  126 bits (317), Expect = 1e-27
 Identities = 68/190 (35%), Positives = 104/190 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P SI  +S L+HL L +N+I G LP+  G ++ L R  ++ N L G+IP  V  +  L  
Sbjct: 432  PFSIGNLSQLLHLYLQDNKIEGLLPASLGNMKNLLRLNITNNSLQGSIPAEVFSLPSLIS 491

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
              LS+N++ G +P  +G  + L  L+L  N ++G+IP TL +  G+ I++L++N   G I
Sbjct: 492  CQLSVNKLDGMLPPEVGNAKQLMELELSSNKLSGEIPHTLGNCHGLEIIDLAQNSLVGEI 551

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
                G+      L+LS N L+G +P SL   K +  +DIS NH  G +P    F +  A 
Sbjct: 552  SVSLGNLGSLERLNLSHNNLSGTIPKSLGGLKLLNQIDISYNHFVGEVPTKGVFLNASAV 611

Query: 543  SFSNNDCLCG 572
              + N  LCG
Sbjct: 612  LLNGNSGLCG 621

 Score =  109 bits (272), Expect = 2e-22
 Identities = 63/187 (33%), Positives = 98/187 (52%), Gaps = 1/187 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI ++  L+ L L NNQ IG +P   G+L  L    L  N   G+IP S+  +++L  
Sbjct: 384 PSSIAKLQNLIALSLENNQYIGSIPEWIGELGNLQVLYLEGNSFTGSIPFSIGNLSQLLH 443

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+I G +P  LG M+ L  L +  NS+ G IP+ + S   +    LS N  +G +
Sbjct: 444 LYLQDNKIEGLLPASLGNMKNLLRLNITNNSLQGSIPAEVFSLPSLISCQLSVNKLDGML 503

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDA 539
           P   G+    M L+LS NKL+G +P++L     +  +D++ N L G I +       L+ 
Sbjct: 504 PPEVGNAKQLMELELSSNKLSGEIPHTLGNCHGLEIIDLAQNSLVGEISVSLGNLGSLER 563

Query: 540 ASFSNND 560
            + S+N+
Sbjct: 564 LNLSHNN 570

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 62/170 (36%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISG-LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P SI  +S  L  L L  NQ+ G  PS   KL+ L    L  NQ IG+IP+ + ++  L 
Sbjct: 359 PSSIGNLSSELQILYLGTNQLSGVFPSSIAKLQNLIALSLENNQYIGSIPEWIGELGNLQ 418

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N  TGSIP  +G +  L  L L  N + G +P++L +   +  LN++ N  +G+
Sbjct: 419 VLYLEGNSFTGSIPFSIGNLSQLLHLYLQDNKIEGLLPASLGNMKNLLRLNITNNSLQGS 478

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP    S    +   LS NKL G +P  +  AK +  L++S+N L G IP
Sbjct: 479 IPAEVFSLPSLISCQLSVNKLDGMLPPEVGNAKQLMELELSSNKLSGEIP 528

 Score = 97.4 bits (241), Expect = 7e-19
 Identities = 54/162 (33%), Positives = 84/162 (51%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S+  ++ L  + LSNN   GE+P+  G LR+L    +S N L G IP      + L  L 
Sbjct: 89  SLGNLTHLRAVRLSNNSFSGEIPASLGHLRRLQEISISNNSLQGWIPGEFANCSNLQILS 148

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           LS NR+ G +P  +G +  L  L L  N++TG IP ++ + T + +L+LS N  +G+IP+
Sbjct: 149 LSSNRLKGRVPQNIGSLLKLVILNLSANNLTGSIPRSVGNMTALRVLSLSENNLQGSIPE 208

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHL 494
             G       L L  N  +G V  ++     + +L +  NHL
Sbjct: 209 ELGLLLQVSYLGLGANLFSGSVSQTMFNLSSVIYLGLELNHL 250

 Score = 84.7 bits (208), Expect = 5e-15
 Identities = 57/188 (30%), Positives = 84/188 (44%), Gaps = 15/188 (7%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           LDL++  + G +    G L  L    LS N   G IP S+  + RL ++ +S N + G I
Sbjct: 75  LDLTDQGLTGYISPSLGNLTHLRAVRLSNNSFSGEIPASLGHLRRLQEISISNNSLQGWI 134

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P        L  L L  N + G++P  + S   + ILNLS N   G+IP   G+ +   V
Sbjct: 135 PGEFANCSNLQILSLSSNRLKGRVPQNIGSLLKLVILNLSANNLTGSIPRSVGNMTALRV 194

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP-----------IGSPFDHLDAA- 542
           L LS N L G +P  L     + +L +  N   G++            +G   +HL+ A 
Sbjct: 195 LSLSENNLQGSIPEELGLLLQVSYLGLGANLFSGSVSQTMFNLSSVIYLGLELNHLNKAV 254

Query: 543 ---SFSNN 557
               F NN
Sbjct: 255 LPSDFGNN 262

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 53/171 (30%), Positives = 82/171 (47%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +  L  + +SNN + G +P +F     L    LS N+L G +P ++  + +L  
Sbjct: 111 PASLGHLRRLQEISISNNSLQGWIPGEFANCSNLQILSLSSNRLKGRVPQNIGSLLKLVI 170

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LS N +TGSIP  +G M  L  L L  N++ G IP  L     +  L L  N F G++
Sbjct: 171 LNLSANNLTGSIPRSVGNMTALRVLSLSENNLQGSIPEELGLLLQVSYLGLGANLFSGSV 230

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRV-PNSLA-KAKFMGHLDISNNHLCGNIP 509
                + S  + L L  N L   V P+        + HL + +N+  G +P
Sbjct: 231 SQTMFNLSSVIYLGLELNHLNKAVLPSDFGNNLPNLQHLGLDSNNFEGPVP 281

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 46/138 (33%), Positives = 75/138 (54%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           +++++  L+   L G I  S+  +  L  + LS N  +G IP  LG +R L  + +  NS
Sbjct: 70  QRVTQLDLTDQGLTGYISPSLGNLTHLRAVRLSNNSFSGEIPASLGHLRRLQEISISNNS 129

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA 455
           + G IP    + + + IL+LS N  +G +P   GS    ++L+LS N LTG +P S+   
Sbjct: 130 LQGWIPGEFANCSNLQILSLSSNRLKGRVPQNIGSLLKLVILNLSANNLTGSIPRSVGNM 189

Query: 456 KFMGHLDISNNHLCGNIP 509
             +  L +S N+L G+IP
Sbjct: 190 TALRVLSLSENNLQGSIP 207

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 59/218 (27%), Positives = 84/218 (38%), Gaps = 55/218 (25%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSV-------------- 158
           +  L HL L +N   G +P+      KL    LSRN   G +P S+              
Sbjct: 263 LPNLQHLGLDSNNFEGPVPASIANASKLIDVGLSRNYFSGIVPSSLGSLHDLTFLNLESN 322

Query: 159 --------------------------LKMNRLAD---------------LDLSMNRITGS 215
                                     L MN L                 L L  N+++G 
Sbjct: 323 SIEASDRESWEFIDTLTNCSKLQAIALDMNNLGGYVPSSIGNLSSELQILYLGTNQLSGV 382

Query: 216 IPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFM 395
            P  + K++ L  L L+ N   G IP  +     + +L L  N F G+IP   G+ S  +
Sbjct: 383 FPSSIAKLQNLIALSLENNQYIGSIPEWIGELGNLQVLYLEGNSFTGSIPFSIGNLSQLL 442

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L L  NK+ G +P SL   K +  L+I+NN L G+IP
Sbjct: 443 HLYLQDNKIEGLLPASLGNMKNLLRLNITNNSLQGSIP 480

[88][TOP]
>UniRef100_B9FZ87 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=B9FZ87_ORYSJ
          Length = 1097

 Score =  126 bits (317), Expect = 1e-27
 Identities = 70/214 (32%), Positives = 115/214 (53%), Gaps = 24/214 (11%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLR------------------------KLSR 110
            P SI+ +  L+ LDLS N ++G +PS+ G L+                        KL  
Sbjct: 509  PESIMEMENLLELDLSGNSLVGSIPSNAGMLKNAEHLFLQGNKFSGSIPKGIGNLTKLEI 568

Query: 111  ALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQI 290
              LS NQL  T+P S+ ++  L  L+LS N ++G++P+ +G+++ ++++ L  N   G +
Sbjct: 569  LRLSNNQLSSTLPPSLFRLESLIQLNLSQNFLSGALPIDIGQLKRINSMDLSRNRFLGSL 628

Query: 291  PSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGH 470
            P ++     + ILNLS N  +G+IP+ FG+ +    LDLS N+++G +P  LA    +  
Sbjct: 629  PDSIGELQMITILNLSTNSIDGSIPNSFGNLTGLQTLDLSHNRISGTIPEYLANFTILTS 688

Query: 471  LDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
            L++S N+L G IP G  F ++   S   N  LCG
Sbjct: 689  LNLSFNNLHGQIPEGGVFTNITLQSLVGNPGLCG 722

 Score =  102 bits (254), Expect = 2e-20
 Identities = 66/213 (30%), Positives = 100/213 (46%), Gaps = 28/213 (13%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P+ I ++  L  L L  NQ+ G +P+  G L  L+R +L+ NQL G++P S+  +N L D
Sbjct: 362  PVDIGQLDQLWELQLLGNQLTGPIPASLGNLSSLARLVLNENQLDGSVPASIGNINYLTD 421

Query: 183  LDLSMNRI--------------------------TGSIPVRLGKMR-VLSTLKLDGNSMT 281
              +S NR+                          TGSIP  +G +   L   +   N +T
Sbjct: 422  FIVSENRLHGDLNFLSTFSNCRNLSWIYIGMNYFTGSIPDYIGNLSGTLQEFRSHRNKLT 481

Query: 282  GQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF 461
            GQ+P +  + TG+ ++ LS N  +G IP+        + LDLS N L G +P++    K 
Sbjct: 482  GQLPPSFSNLTGLRVIELSDNQLQGAIPESIMEMENLLELDLSGNSLVGSIPSNAGMLKN 541

Query: 462  MGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
              HL +  N   G+IP G      L+    SNN
Sbjct: 542  AEHLFLQGNKFSGSIPKGIGNLTKLEILRLSNN 574

 Score =  101 bits (252), Expect = 4e-20
 Identities = 61/170 (35%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISG-LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  +SG L       N++ G+LP  F  L  L    LS NQL G IP+S+++M  L 
Sbjct: 460 PDYIGNLSGTLQEFRSHRNKLTGQLPPSFSNLTGLRVIELSDNQLQGAIPESIMEMENLL 519

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           +LDLS N + GSIP   G ++    L L GN  +G IP  + + T + IL LS N    T
Sbjct: 520 ELDLSGNSLVGSIPSNAGMLKNAEHLFLQGNKFSGSIPKGIGNLTKLEILRLSNNQLSST 579

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P         + L+LS N L+G +P  + + K +  +D+S N   G++P
Sbjct: 580 LPPSLFRLESLIQLNLSQNFLSGALPIDIGQLKRINSMDLSRNRFLGSLP 629

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 56/169 (33%), Positives = 89/169 (52%), Gaps = 1/169 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  L+L+N  + G LP D G+L +L    L  N ++G IP ++  ++RL  L+L  N
Sbjct: 101 LSFLSVLNLTNTGLTGLLPDDIGRLHRLELLDLGHNAMLGGIPATIGNLSRLQLLNLQFN 160

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT-GMGILNLSRNGFEGTIPDVFG 377
           +++G IP  L  +R L  + +  N +TG +P+ L ++T  +  L +  N   G IP   G
Sbjct: 161 QLSGRIPTELQGLRSLININIQTNYLTGLVPNDLFNHTPSLRRLIMGNNSLSGPIPGCIG 220

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF 524
           S      L L  N LTG VP S+     +  + +++N L G IP  + F
Sbjct: 221 SLHMLEWLVLQHNNLTGPVPPSIFNMSRLTVIALASNGLTGPIPGNTSF 269

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 50/158 (31%), Positives = 79/158 (50%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+L N  + GEL S  G L  LS   L+   L G +PD + +++RL  LDL  N + G I
Sbjct: 83  LELPNVPLQGELSSHLGNLSFLSVLNLTNTGLTGLLPDDIGRLHRLELLDLGHNAMLGGI 142

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFM 395
           P  +G +  L  L L  N ++G+IP+ L     +  +N+  N   G +P D+F       
Sbjct: 143 PATIGNLSRLQLLNLQFNQLSGRIPTELQGLRSLININIQTNYLTGLVPNDLFNHTPSLR 202

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L +  N L+G +P  +     +  L + +N+L G +P
Sbjct: 203 RLIMGNNSLSGPIPGCIGSLHMLEWLVLQHNNLTGPVP 240

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 54/172 (31%), Positives = 91/172 (52%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQL-IGTIPDSVLKMNRLA 179
           PM +     L  + + +N   G LPS   KLR L+   LS N    G IP  +  +  L 
Sbjct: 289 PMGLAACPYLQTISMHDNLFEGVLPSWLSKLRNLTGLTLSWNNFDAGPIPAGLSNLTMLT 348

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            LDL+   +TG+IPV +G++  L  L+L GN +TG IP++L + + +  L L+ N  +G+
Sbjct: 349 ALDLNGCNLTGAIPVDIGQLDQLWELQLLGNQLTGPIPASLGNLSSLARLVLNENQLDGS 408

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+ +Y     +S N+L G +   ++ +  + +  + I  N+  G+IP
Sbjct: 409 VPASIGNINYLTDFIVSENRLHGDLNFLSTFSNCRNLSWIYIGMNYFTGSIP 460

 Score = 80.5 bits (197), Expect = 9e-14
 Identities = 50/163 (30%), Positives = 78/163 (47%), Gaps = 2/163 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L + NN + G +P   G L  L   +L  N L G +P S+  M+RL  + L+ N +T
Sbjct: 201 LRRLIMGNNSLSGPIPGCIGSLHMLEWLVLQHNNLTGPVPPSIFNMSRLTVIALASNGLT 260

Query: 210 GSIPVRLG-KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           G IP      +  L  + +  N+ TGQIP  L +   +  +++  N FEG +P       
Sbjct: 261 GPIPGNTSFSLPALQRIYISINNFTGQIPMGLAACPYLQTISMHDNLFEGVLPSWLSKLR 320

Query: 387 YFMVLDLSFNKL-TGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               L LS+N    G +P  L+    +  LD++  +L G IP+
Sbjct: 321 NLTGLTLSWNNFDAGPIPAGLSNLTMLTALDLNGCNLTGAIPV 363

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 55/173 (31%), Positives = 85/173 (49%), Gaps = 2/173 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I R+  L  LDL +N ++G +P+  G L +L    L  NQL G IP  +  +  L +
Sbjct: 119 PDDIGRLHRLELLDLGHNAMLGGIPATIGNLSRLQLLNLQFNQLSGRIPTELQGLRSLIN 178

Query: 183 LDLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           +++  N +TG +P  L      L  L +  NS++G IP  + S   +  L L  N   G 
Sbjct: 179 INIQTNYLTGLVPNDLFNHTPSLRRLIMGNNSLSGPIPGCIGSLHMLEWLVLQHNNLTGP 238

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP-NSLAKAKFMGHLDISNNHLCGNIPIG 515
           +P    + S   V+ L+ N LTG +P N+      +  + IS N+  G IP+G
Sbjct: 239 VPPSIFNMSRLTVIALASNGLTGPIPGNTSFSLPALQRIYISINNFTGQIPMG 291

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 35/113 (30%), Positives = 59/113 (52%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  L+L    + G +   LG +  LS L L    +TG +P  +     + +L+L  N  
Sbjct: 79  RVVALELPNVPLQGELSSHLGNLSFLSVLNLTNTGLTGLLPDDIGRLHRLELLDLGHNAM 138

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G IP   G+ S   +L+L FN+L+GR+P  L   + + +++I  N+L G +P
Sbjct: 139 LGGIPATIGNLSRLQLLNLQFNQLSGRIPTELQGLRSLININIQTNYLTGLVP 191

[89][TOP]
>UniRef100_B8ADC3 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8ADC3_ORYSI
          Length = 987

 Score =  126 bits (316), Expect = 1e-27
 Identities = 75/191 (39%), Positives = 105/191 (54%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLA 179
           P ++ ++  L  LDLS N + G +P +  +L  LS  L LS N L G IP  V  +  L 
Sbjct: 391 PATLGKLKKLFALDLSINHLNGSVPKEIFELPSLSWFLILSDNTLSGPIPSEVGTLVNLN 450

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            ++LS N+++  IP  +G   VL  L LD NS  G IP +L    G+ ILNL+ N F G+
Sbjct: 451 SIELSGNQLSDQIPDSIGNCEVLEYLLLDSNSFEGGIPQSLTKLKGLAILNLTMNKFSGS 510

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
           IP+  GS      L L+ N L+G +P +L     + HLD+S N+L G +P    F +L  
Sbjct: 511 IPNAIGSMGNLQQLCLAHNNLSGSIPETLQNLTQLWHLDVSFNNLQGKVPDEGAFRNLTY 570

Query: 540 ASFSNNDCLCG 572
           AS + ND LCG
Sbjct: 571 ASVAGNDKLCG 581

 Score = 84.3 bits (207), Expect = 6e-15
 Identities = 56/169 (33%), Positives = 81/169 (47%), Gaps = 2/169 (1%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRK-LSRALLSRNQLIGTIPDSVLKMNRLADL 185
           S+   S L  LD++ N  IG+LP     L   L +  L  N + G+IP  +  +  L  L
Sbjct: 272 SLANCSQLQQLDIAENSFIGQLPISIVNLSTTLQKFFLRGNSVSGSIPTDIGNLIGLDTL 331

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           DL    ++G IP  +GK+  L+ + L    ++G IPS + + T + IL       EG IP
Sbjct: 332 DLGSTSLSGVIPESIGKLADLAIITLYSTRLSGLIPSVIGNLTNLNILAAYDAHLEGPIP 391

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG-HLDISNNHLCGNIP 509
              G       LDLS N L G VP  + +   +   L +S+N L G IP
Sbjct: 392 ATLGKLKKLFALDLSINHLNGSVPKEIFELPSLSWFLILSDNTLSGPIP 440

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 59/186 (31%), Positives = 92/186 (49%), Gaps = 19/186 (10%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  ++ L  L+LS+N + GE+P   G+L+ L    L  N   G  PD++     L +
Sbjct: 77  PPAIGNLTFLRWLNLSSNGLHGEIPPSLGRLQHLRILDLGSNSFSGAFPDNLSSCISLIN 136

Query: 183 LDLSMNRITGSIPVRLGK-MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           L L  N+++G IPV+LG  +  L  L L  NS TG IP++L + + +  L L  N  +G 
Sbjct: 137 LTLGYNQLSGHIPVKLGNTLTWLQKLHLGNNSFTGPIPASLANLSSLEFLKLDFNHLKGL 196

Query: 360 IPDVFGS-------------KSYFMVLDLS-----FNKLTGRVPNSLAKAKFMGHLDISN 485
           IP   G+              S F +  L+      NK +G VP ++ + K +  L +S+
Sbjct: 197 IPSSLGNIPNLQKIFSGVIPSSLFNLSSLTDVYLDGNKFSGFVPPTVGRLKSLVRLSLSS 256

Query: 486 NHLCGN 503
           N L  N
Sbjct: 257 NRLEAN 262

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 52/176 (29%), Positives = 88/176 (50%), Gaps = 7/176 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIG------ELPSDFGKLRKLSRALLSRNQLIGTIPDSVLK 164
           P ++ R+  L+ L LS+N++        E  +      +L +  ++ N  IG +P S++ 
Sbjct: 240 PPTVGRLKSLVRLSLSSNRLEANNMKGWEFITSLANCSQLQQLDIAENSFIGQLPISIVN 299

Query: 165 MNR-LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
           ++  L    L  N ++GSIP  +G +  L TL L   S++G IP ++     + I+ L  
Sbjct: 300 LSTTLQKFFLRGNSVSGSIPTDIGNLIGLDTLDLGSTSLSGVIPESIGKLADLAIITLYS 359

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
               G IP V G+ +   +L      L G +P +L K K +  LD+S NHL G++P
Sbjct: 360 TRLSGLIPSVIGNLTNLNILAAYDAHLEGPIPATLGKLKKLFALDLSINHLNGSVP 415

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 51/170 (30%), Positives = 80/170 (47%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  + GL  LDL +  + G +P   GKL  L+   L   +L G IP  +  +  L  
Sbjct: 319 PTDIGNLIGLDTLDLGSTSLSGVIPESIGKLADLAIITLYSTRLSGLIPSVIGNLTNLNI 378

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMG-ILNLSRNGFEGT 359
           L      + G IP  LGK++ L  L L  N + G +P  +     +   L LS N   G 
Sbjct: 379 LAAYDAHLEGPIPATLGKLKKLFALDLSINHLNGSVPKEIFELPSLSWFLILSDNTLSGP 438

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G+      ++LS N+L+ ++P+S+   + + +L + +N   G IP
Sbjct: 439 IPSEVGTLVNLNSIELSGNQLSDQIPDSIGNCEVLEYLLLDSNSFEGGIP 488

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 47/132 (35%), Positives = 65/132 (49%), Gaps = 1/132 (0%)
 Frame = +3

Query: 117 LSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS 296
           L  + L GT+P ++  +  L  L+LS N + G IP  LG+++ L  L L  NS +G  P 
Sbjct: 67  LPSSNLAGTLPPAIGNLTFLRWLNLSSNGLHGEIPPSLGRLQHLRILDLGSNSFSGAFPD 126

Query: 297 TLLSNTGMGILNLSRNGFEGTIPDVFGSK-SYFMVLDLSFNKLTGRVPNSLAKAKFMGHL 473
            L S   +  L L  N   G IP   G+  ++   L L  N  TG +P SLA    +  L
Sbjct: 127 NLSSCISLINLTLGYNQLSGHIPVKLGNTLTWLQKLHLGNNSFTGPIPASLANLSSLEFL 186

Query: 474 DISNNHLCGNIP 509
            +  NHL G IP
Sbjct: 187 KLDFNHLKGLIP 198

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 36/114 (31%), Positives = 56/114 (49%), Gaps = 1/114 (0%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  L L  + + G++P  +G +  L  L L  N + G+IP +L     + IL+L  N F
Sbjct: 61  RVVGLSLPSSNLAGTLPPAIGNLTFLRWLNLSSNGLHGEIPPSLGRLQHLRILDLGSNSF 120

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA-KFMGHLDISNNHLCGNIP 509
            G  PD   S    + L L +N+L+G +P  L     ++  L + NN   G IP
Sbjct: 121 SGAFPDNLSSCISLINLTLGYNQLSGHIPVKLGNTLTWLQKLHLGNNSFTGPIP 174

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 2/103 (1%)
 Frame = +3

Query: 255 LKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRV 434
           L L  +++ G +P  + + T +  LNLS NG  G IP   G   +  +LDL  N  +G  
Sbjct: 65  LSLPSSNLAGTLPPAIGNLTFLRWLNLSSNGLHGEIPPSLGRLQHLRILDLGSNSFSGAF 124

Query: 435 PNSLAKAKFMGHLDISNNHLCGNIPI--GSPFDHLDAASFSNN 557
           P++L+    + +L +  N L G+IP+  G+    L      NN
Sbjct: 125 PDNLSSCISLINLTLGYNQLSGHIPVKLGNTLTWLQKLHLGNN 167

[90][TOP]
>UniRef100_A2ZBZ0 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2ZBZ0_ORYSI
          Length = 1012

 Score =  126 bits (316), Expect = 1e-27
 Identities = 69/189 (36%), Positives = 106/189 (56%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  IS L  L LS N   G++P+  GKL+ L    LS N L+G+IP+S+  +  L  
Sbjct: 433 PSSISNISNLEDLCLSTNLFGGKIPAGLGKLQVLHLMELSDNNLLGSIPESIFSIPTLTR 492

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
             LS N++ G++P  +G  + L +L L  N +TG IPSTL +   +  L+L +N   G+I
Sbjct: 493 CMLSFNKLDGALPTEIGNAKQLGSLHLSANKLTGHIPSTLSNCDSLEELHLDQNFLNGSI 552

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P   G+      ++LS+N L+G +P+SL + + +  LD+S N+L G +P    F +  A 
Sbjct: 553 PTSLGNMQSLTAVNLSYNDLSGSIPDSLGRLQSLEQLDLSFNNLVGEVPSIGVFKNATAI 612

Query: 543 SFSNNDCLC 569
             + N  LC
Sbjct: 613 RLNGNHGLC 621

 Score =  104 bits (260), Expect = 4e-21
 Identities = 63/187 (33%), Positives = 92/187 (49%), Gaps = 1/187 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L+ L L+ N   G +P   G L  L    L  N+  G +P S+  ++ L D
Sbjct: 385 PSGIRNLPNLISLGLNENHFTGIVPEWVGTLANLEGIYLDNNKFTGFLPSSISNISNLED 444

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N   G IP  LGK++VL  ++L  N++ G IP ++ S   +    LS N  +G +
Sbjct: 445 LCLSTNLFGGKIPAGLGKLQVLHLMELSDNNLLGSIPESIFSIPTLTRCMLSFNKLDGAL 504

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDA 539
           P   G+      L LS NKLTG +P++L+    +  L +  N L G+IP        L A
Sbjct: 505 PTEIGNAKQLGSLHLSANKLTGHIPSTLSNCDSLEELHLDQNFLNGSIPTSLGNMQSLTA 564

Query: 540 ASFSNND 560
            + S ND
Sbjct: 565 VNLSYND 571

 Score = 97.1 bits (240), Expect = 9e-19
 Identities = 59/168 (35%), Positives = 92/168 (54%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S    S L  L LS NQI+G +P +      +S+ +++ N L GTIP S+  +  L  L 
Sbjct: 139 SFANCSALKILHLSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIPTSLGDVATLNILI 198

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           +S N I GSIP  +GKM VL+ L + GN+++G+ P  L + + +  L L  N F G +P 
Sbjct: 199 VSYNYIEGSIPDEIGKMPVLTNLYVGGNNLSGRFPLALTNISSLVELGLGFNYFHGGLPP 258

Query: 369 VFG-SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             G S     VL+++ N   G +P S++ A  +  +D S+N+  G +P
Sbjct: 259 NLGTSLPRLQVLEIASNLFEGHLPYSISNATSLYTIDFSSNYFSGVVP 306

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 60/185 (32%), Positives = 92/185 (49%), Gaps = 2/185 (1%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S+  ++ L HL L+ NQ+ G++P   G L  L    L+ N L G IP S    + L  L 
Sbjct: 92  SLGNLTSLEHLFLNTNQLSGQIPPSLGHLHHLRSLYLANNTLQGNIP-SFANCSALKILH 150

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           LS N+I G IP  +     +S L ++ N++TG IP++L     + IL +S N  EG+IPD
Sbjct: 151 LSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIPTSLGDVATLNILIVSYNYIEGSIPD 210

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAA 542
             G       L +  N L+GR P +L     +  L +  N+  G +P  +G+    L   
Sbjct: 211 EIGKMPVLTNLYVGGNNLSGRFPLALTNISSLVELGLGFNYFHGGLPPNLGTSLPRLQVL 270

Query: 543 SFSNN 557
             ++N
Sbjct: 271 EIASN 275

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 49/158 (31%), Positives = 78/158 (49%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           LDLSN  ++G +    G L  L    L+ NQL G IP S+  ++ L  L L+ N + G+I
Sbjct: 78  LDLSNRGLVGLISPSLGNLTSLEHLFLNTNQLSGQIPPSLGHLHHLRSLYLANNTLQGNI 137

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P        L  L L  N + G+IP  +     +  L ++ N   GTIP   G  +   +
Sbjct: 138 P-SFANCSALKILHLSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIPTSLGDVATLNI 196

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           L +S+N + G +P+ + K   + +L +  N+L G  P+
Sbjct: 197 LIVSYNYIEGSIPDEIGKMPVLTNLYVGGNNLSGRFPL 234

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 59/200 (29%), Positives = 93/200 (46%), Gaps = 8/200 (4%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI   + L  +D S+N   G +PS  G L++LS   L  NQ        +  ++ L++
Sbjct: 282 PYSISNATSLYTIDFSSNYFSGVVPSSIGMLKELSLLNLEWNQFESFNNKDLEFLHSLSN 341

Query: 183 ------LDLSMNRITGSIPVRLGKMRV-LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
                 L L  N++ G IP  LG + + L  L L  N ++G  PS + +   +  L L+ 
Sbjct: 342 CTDLQVLALYDNKLKGQIPYSLGNLSIQLQYLFLGSNQLSGGFPSGIRNLPNLISLGLNE 401

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-S 518
           N F G +P+  G+ +    + L  NK TG +P+S++    +  L +S N   G IP G  
Sbjct: 402 NHFTGIVPEWVGTLANLEGIYLDNNKFTGFLPSSISNISNLEDLCLSTNLFGGKIPAGLG 461

Query: 519 PFDHLDAASFSNNDCLCGNP 578
               L     S+N+ L   P
Sbjct: 462 KLQVLHLMELSDNNLLGSIP 481

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 39/113 (34%), Positives = 61/113 (53%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  LDLS   + G I   LG +  L  L L+ N ++GQIP +L     +  L L+ N  
Sbjct: 74  RVTSLDLSNRGLVGLISPSLGNLTSLEHLFLNTNQLSGQIPPSLGHLHHLRSLYLANNTL 133

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +G IP  F + S   +L LS N++ GR+P ++     +  L +++N+L G IP
Sbjct: 134 QGNIPS-FANCSALKILHLSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIP 185

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 55/208 (26%), Positives = 87/208 (41%), Gaps = 37/208 (17%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ L  L +S N I G +P + GK+  L+   +  N L G  P ++  ++ L +
Sbjct: 185 PTSLGDVATLNILIVSYNYIEGSIPDEIGKMPVLTNLYVGGNNLSGRFPLALTNISSLVE 244

Query: 183 LDLSMNRITGSIPVRLG----KMRVLS---------------------TLKLDGNSMTGQ 287
           L L  N   G +P  LG    +++VL                      T+    N  +G 
Sbjct: 245 LGLGFNYFHGGLPPNLGTSLPRLQVLEIASNLFEGHLPYSISNATSLYTIDFSSNYFSGV 304

Query: 288 IPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY-----------FMVLDLSFNKLTGRV 434
           +PS++     + +LNL  N FE      F +K               VL L  NKL G++
Sbjct: 305 VPSSIGMLKELSLLNLEWNQFES-----FNNKDLEFLHSLSNCTDLQVLALYDNKLKGQI 359

Query: 435 PNSLAKAKF-MGHLDISNNHLCGNIPIG 515
           P SL      + +L + +N L G  P G
Sbjct: 360 PYSLGNLSIQLQYLFLGSNQLSGGFPSG 387

[91][TOP]
>UniRef100_UPI0001984128 PREDICTED: hypothetical protein, partial n=1 Tax=Vitis vinifera
            RepID=UPI0001984128
          Length = 1193

 Score =  125 bits (315), Expect = 2e-27
 Identities = 68/191 (35%), Positives = 111/191 (58%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVL-KMNRLA 179
            P S+  +S L +L++SNN + G +P+     + +   LL  N+L G +P++V+   N+L 
Sbjct: 577  PSSLGNLSQLFYLEMSNNNLEGNIPTSLRNCQNMEILLLDHNKLSGGVPENVIGHFNQLR 636

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
             L L  N  TGS+P  +G+++ L+ L +  N ++G+IP+ L S   +  L+++RN F+G 
Sbjct: 637  SLYLQQNTFTGSLPADVGQLKNLNELLVSDNKLSGEIPTELGSCLVLEYLDMARNSFQGN 696

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
            IP  F S      LDLS N L+GR+PN L     +  L++S N+L G +P G  F ++  
Sbjct: 697  IPLSFSSLRGIQFLDLSCNNLSGRIPNELEDLGLLS-LNLSYNYLEGEVPSGGVFKNVSG 755

Query: 540  ASFSNNDCLCG 572
             S + N+ LCG
Sbjct: 756  ISITGNNKLCG 766

 Score =  107 bits (267), Expect = 7e-22
 Identities = 65/165 (39%), Positives = 92/165 (55%), Gaps = 1/165 (0%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  ++ L  L LSNN + G +PSD G LR++    LS N L G IP  +   + L  +DL
Sbjct: 235 IGNLTFLRELVLSNNLLHGTIPSDIGLLRRMRHLNLSTNSLQGEIPIELTNCSNLETVDL 294

Query: 192 SMNRITGSIPVRLGKMRV-LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           + N +TG IP R+G M   L  L+L GN +TG IPSTL + + +  L++S N  EG+IP 
Sbjct: 295 TRNNLTGQIPFRVGNMSTKLLVLRLGGNGLTGVIPSTLGNLSSLQHLSVSFNHLEGSIPH 354

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGN 503
             G      +L LS N L+G +P SL     +    +++N L GN
Sbjct: 355 DLGRLKSLKILYLSVNNLSGTIPPSLYNLSSVIEFAVTDNILSGN 399

 Score =  102 bits (253), Expect = 3e-20
 Identities = 70/193 (36%), Positives = 102/193 (52%), Gaps = 8/193 (4%)
 Frame = +3

Query: 3    PMSIVRISG-LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
            P SIV +S  L  L L  N+I G +P + G L  L+     +N L G +P SV K+ +L 
Sbjct: 504  PNSIVNLSTQLQALHLGENKIFGNIPEEIGNLINLTTFDAGQNYLTGVVPTSVGKLQKLV 563

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
             L LS NR++G +P  LG +  L  L++  N++ G IP++L +   M IL L  N   G 
Sbjct: 564  TLRLSWNRLSGLLPSSLGNLSQLFYLEMSNNNLEGNIPTSLRNCQNMEILLLDHNKLSGG 623

Query: 360  IPD-VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS--PF 524
            +P+ V G  +    L L  N  TG +P  + + K +  L +S+N L G IP  +GS    
Sbjct: 624  VPENVIGHFNQLRSLYLQQNTFTGSLPADVGQLKNLNELLVSDNKLSGEIPTELGSCLVL 683

Query: 525  DHLDAA--SFSNN 557
            ++LD A  SF  N
Sbjct: 684  EYLDMARNSFQGN 696

 Score = 96.3 bits (238), Expect = 2e-18
 Identities = 60/158 (37%), Positives = 84/158 (53%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L    + G LP   G L  L   +LS N L GTIP  +  + R+  L+LS N + G I
Sbjct: 221 LRLEGQSLGGSLPP-IGNLTFLRELVLSNNLLHGTIPSDIGLLRRMRHLNLSTNSLQGEI 279

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLS-NTGMGILNLSRNGFEGTIPDVFGSKSYFM 395
           P+ L     L T+ L  N++TGQIP  + + +T + +L L  NG  G IP   G+ S   
Sbjct: 280 PIELTNCSNLETVDLTRNNLTGQIPFRVGNMSTKLLVLRLGGNGLTGVIPSTLGNLSSLQ 339

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L +SFN L G +P+ L + K +  L +S N+L G IP
Sbjct: 340 HLSVSFNHLEGSIPHDLGRLKSLKILYLSVNNLSGTIP 377

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 55/159 (34%), Positives = 83/159 (52%), Gaps = 7/159 (4%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ +   S L  +DLS N + G++P   G + +L    L  N L G I   +  ++ L  
Sbjct: 6   PVELTNCSNLRTVDLSKNNLTGKIPLHVGHMTRLLVLRLRTNSLTGAISFVLGNLSSLEW 65

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGIL-------NLSR 341
           L L+ N + GSIP  LG+++ L  L L  N+++G IP +L + + +  L        +  
Sbjct: 66  LSLAFNHMEGSIPHDLGRLKSLKYLYLTSNNLSGTIPPSLFNLSSLIELFPQLRKFGIGL 125

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAK 458
           N F G IPD   + S   +LDLS N LTG+VP+SL   K
Sbjct: 126 NQFTGIIPDTLSNISGLELLDLSGNFLTGQVPDSLGMLK 164

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 53/156 (33%), Positives = 83/156 (53%), Gaps = 1/156 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L+ L L  N + G +PS  G L  L    +S N L G+IP  + ++  L  L LS+N ++
Sbjct: 314 LLVLRLGGNGLTGVIPSTLGNLSSLQHLSVSFNHLEGSIPHDLGRLKSLKILYLSVNNLS 373

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           G+IP  L  +  +    +  N ++G   ST+  S   +  L ++ N F G IPD   + S
Sbjct: 374 GTIPPSLYNLSSVIEFAVTDNILSGNFLSTMRFSFPQLRKLGIALNQFTGIIPDTLSNIS 433

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHL 494
              +LDL  N LTG+VP+SL   K +  L++ +N+L
Sbjct: 434 GLELLDLGPNYLTGQVPDSLGVLKDLYWLNVESNNL 469

 Score = 80.9 bits (198), Expect = 7e-14
 Identities = 65/221 (29%), Positives = 98/221 (44%), Gaps = 52/221 (23%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSR---------ALLSRNQLIGTIPDS 155
           P ++  ISGL  LDLS N + G++P   G L+ L+          ALL+    +  +P  
Sbjct: 133 PDTLSNISGLELLDLSGNFLTGQVPDSLGMLKDLTPTFGNETDKLALLTIKHHLVDVPKG 192

Query: 156 VLK------------------------------------------MNRLADLDLSMNRIT 209
           VL                                           +  L +L LS N + 
Sbjct: 193 VLSSWNDSLHFCQWQGVTCSRRRQRVTALRLEGQSLGGSLPPIGNLTFLRELVLSNNLLH 252

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS- 386
           G+IP  +G +R +  L L  NS+ G+IP  L + + +  ++L+RN   G IP   G+ S 
Sbjct: 253 GTIPSDIGLLRRMRHLNLSTNSLQGEIPIELTNCSNLETVDLTRNNLTGQIPFRVGNMST 312

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             +VL L  N LTG +P++L     + HL +S NHL G+IP
Sbjct: 313 KLLVLRLGGNGLTGVIPSTLGNLSSLQHLSVSFNHLEGSIP 353

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 61/195 (31%), Positives = 87/195 (44%), Gaps = 26/195 (13%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMN-RLA 179
           P  I  +  + HL+LS N + GE+P +      L    L+RN L G IP  V  M+ +L 
Sbjct: 256 PSDIGLLRRMRHLNLSTNSLQGEIPIELTNCSNLETVDLTRNNLTGQIPFRVGNMSTKLL 315

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N +TG IP  LG +  L  L +  N + G IP  L     + IL LS N   GT
Sbjct: 316 VLRLGGNGLTGVIPSTLGNLSSLQHLSVSFNHLEGSIPHDLGRLKSLKILYLSVNNLSGT 375

Query: 360 IP---------------DVFGSKSYFMVLDLSF----------NKLTGRVPNSLAKAKFM 464
           IP               D   S ++   +  SF          N+ TG +P++L+    +
Sbjct: 376 IPPSLYNLSSVIEFAVTDNILSGNFLSTMRFSFPQLRKLGIALNQFTGIIPDTLSNISGL 435

Query: 465 GHLDISNNHLCGNIP 509
             LD+  N+L G +P
Sbjct: 436 ELLDLGPNYLTGQVP 450

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 58/225 (25%), Positives = 92/225 (40%), Gaps = 56/225 (24%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMN---- 170
            P ++  +S L HL +S N + G +P D G+L+ L    LS N L GTIP S+  ++    
Sbjct: 329  PSTLGNLSSLQHLSVSFNHLEGSIPHDLGRLKSLKILYLSVNNLSGTIPPSLYNLSSVIE 388

Query: 171  ---------------------RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQ 287
                                 +L  L +++N+ TG IP  L  +  L  L L  N +TGQ
Sbjct: 389  FAVTDNILSGNFLSTMRFSFPQLRKLGIALNQFTGIIPDTLSNISGLELLDLGPNYLTGQ 448

Query: 288  IPSTL------------LSNTGMG------------------ILNLSRNGFEGTIPD-VF 374
            +P +L             +N G G                   ++L +N F G +P+ + 
Sbjct: 449  VPDSLGVLKDLYWLNVESNNLGRGTSGDLNFLNSLTNISSLRTISLYQNNFGGVLPNSIV 508

Query: 375  GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
               +    L L  NK+ G +P  +     +   D   N+L G +P
Sbjct: 509  NLSTQLQALHLGENKIFGNIPEEIGNLINLTTFDAGQNYLTGVVP 553

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 52/155 (33%), Positives = 71/155 (45%), Gaps = 7/155 (4%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRV 245
           G +P +      L    LS+N L G IP  V  M RL  L L  N +TG+I   LG +  
Sbjct: 3   GAIPVELTNCSNLRTVDLSKNNLTGKIPLHVGHMTRLLVLRLRTNSLTGAISFVLGNLSS 62

Query: 246 LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVL-------D 404
           L  L L  N M G IP  L     +  L L+ N   GTIP    + S  + L        
Sbjct: 63  LEWLSLAFNHMEGSIPHDLGRLKSLKYLYLTSNNLSGTIPPSLFNLSSLIELFPQLRKFG 122

Query: 405 LSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +  N+ TG +P++L+    +  LD+S N L G +P
Sbjct: 123 IGLNQFTGIIPDTLSNISGLELLDLSGNFLTGQVP 157

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 40/105 (38%), Positives = 57/105 (54%)
 Frame = +3

Query: 132 LIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN 311
           L G IP  +   + L  +DLS N +TG IP+ +G M  L  L+L  NS+TG I   L + 
Sbjct: 1   LRGAIPVELTNCSNLRTVDLSKNNLTGKIPLHVGHMTRLLVLRLRTNSLTGAISFVLGNL 60

Query: 312 TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSL 446
           + +  L+L+ N  EG+IP   G       L L+ N L+G +P SL
Sbjct: 61  SSLEWLSLAFNHMEGSIPHDLGRLKSLKYLYLTSNNLSGTIPPSL 105

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 36/102 (35%), Positives = 57/102 (55%)
 Frame = +3

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           + G+IPV L     L T+ L  N++TG+IP  +   T + +L L  N   G I  V G+ 
Sbjct: 1   LRGAIPVELTNCSNLRTVDLSKNNLTGKIPLHVGHMTRLLVLRLRTNSLTGAISFVLGNL 60

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           S    L L+FN + G +P+ L + K + +L +++N+L G IP
Sbjct: 61  SSLEWLSLAFNHMEGSIPHDLGRLKSLKYLYLTSNNLSGTIP 102

[92][TOP]
>UniRef100_UPI0001984082 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
            RepID=UPI0001984082
          Length = 1092

 Score =  125 bits (315), Expect = 2e-27
 Identities = 68/190 (35%), Positives = 99/190 (52%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  +  L  L L NN++ G +P   G L +L +  LS N L  +IP  +  +  L  
Sbjct: 532  PEELCGLRDLGELSLYNNKLSGSIPHCIGNLSRLQKLFLSSNSLTSSIPTGLWSLGNLLF 591

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N + GS+P  +G + V+  + L  N + G IP  L +   +  LNLSRN F+  I
Sbjct: 592  LNLSFNSLGGSLPSDMGTLTVIEDIDLSWNKLIGNIPGILGTFESLYSLNLSRNSFQEAI 651

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P+  G       +DLS N L+G +P S      + +L++S N+L G IP G PF +  A 
Sbjct: 652  PETLGKLRALEFMDLSQNNLSGTIPKSFEALSHLKYLNLSFNNLSGEIPNGGPFVNFTAQ 711

Query: 543  SFSNNDCLCG 572
            SF  N  LCG
Sbjct: 712  SFLENKALCG 721

 Score =  104 bits (259), Expect = 6e-21
 Identities = 63/170 (37%), Positives = 90/170 (52%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I R   L+   LS N+  G++P + G LR L    L  N L G IP S+  ++ L  
Sbjct: 235 PSGIHRCRELLFASLSYNRFDGQIPEEIGSLRNLEELYLGGNHLTGPIPSSIGNISSLQI 294

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+I GSIP  LG +  LS L L+ N +TG IP  + + + + IL++ +N   G +
Sbjct: 295 LFLEDNKIQGSIPSTLGNLLNLSYLVLELNELTGAIPQEIFNISSLQILSVVKNNLSGNL 354

Query: 363 PDVFG-SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G      MVL L+ N L+G++P SL+    +  +DI NN   G IP
Sbjct: 355 PSTTGLGLPNLMVLFLAGNGLSGKIPPSLSNYSQLTKIDIGNNLFTGPIP 404

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 58/170 (34%), Positives = 85/170 (50%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  IS L+ + L+ N I G L  D  +    +   L + NQL G +P  + +   L 
Sbjct: 186 PSLIFNISSLLSIILTGNSISGSLSVDICQHSPNIEELLFTDNQLSGQLPSGIHRCRELL 245

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
              LS NR  G IP  +G +R L  L L GN +TG IPS++ + + + IL L  N  +G+
Sbjct: 246 FASLSYNRFDGQIPEEIGSLRNLEELYLGGNHLTGPIPSSIGNISSLQILFLEDNKIQGS 305

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G+      L L  N+LTG +P  +     +  L +  N+L GN+P
Sbjct: 306 IPSTLGNLLNLSYLVLELNELTGAIPQEIFNISSLQILSVVKNNLSGNLP 355

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 55/168 (32%), Positives = 85/168 (50%), Gaps = 1/168 (0%)
 Frame = +3

Query: 57  QIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGK 236
           Q+ G +PS  G L+ L    L  N L G IP ++ ++  L  +++  N + G IP  L  
Sbjct: 478 QLKGHIPSGIGSLKNLGTLELGDNNLNGNIPSTIGRLENLQRMNIFNNELEGPIPEELCG 537

Query: 237 MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFN 416
           +R L  L L  N ++G IP  + + + +  L LS N    +IP    S    + L+LSFN
Sbjct: 538 LRDLGELSLYNNKLSGSIPHCIGNLSRLQKLFLSSNSLTSSIPTGLWSLGNLLFLNLSFN 597

Query: 417 KLTGRVPNSLAKAKFMGHLDISNNHLCGNIP-IGSPFDHLDAASFSNN 557
            L G +P+ +     +  +D+S N L GNIP I   F+ L + + S N
Sbjct: 598 SLGGSLPSDMGTLTVIEDIDLSWNKLIGNIPGILGTFESLYSLNLSRN 645

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 60/187 (32%), Positives = 95/187 (50%), Gaps = 10/187 (5%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  IS L  L L +N+I G +PS  G L  LS  +L  N+L G IP  +  ++ L  
Sbjct: 283 PSSIGNISSLQILFLEDNKIQGSIPSTLGNLLNLSYLVLELNELTGAIPQEIFNISSLQI 342

Query: 183 LDLSMNRITGSIPVRLGK-MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           L +  N ++G++P   G  +  L  L L GN ++G+IP +L + + +  +++  N F G 
Sbjct: 343 LSVVKNNLSGNLPSTTGLGLPNLMVLFLAGNGLSGKIPPSLSNYSQLTKIDIGNNLFTGP 402

Query: 360 IPDVFGSKSYFMVLDLSFNKL---TGRVP----NSLAKAKFMGHLDISNNHLCGNIP--I 512
           IP   G+  +   L L  N+L    GR       +L   + +  + + NN L G IP  I
Sbjct: 403 IPPSLGNLKFLQTLSLGENQLKVEPGRPELSFITALTNCRLLEEITMPNNPLGGIIPNSI 462

Query: 513 GSPFDHL 533
           G+  +H+
Sbjct: 463 GNLSNHV 469

 Score = 80.9 bits (198), Expect = 7e-14
 Identities = 60/194 (30%), Positives = 90/194 (46%), Gaps = 25/194 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI     L  + L++N + G +P + G L KL   LL  N L GTIP S+  ++ L  
Sbjct: 114 PPSISHCRRLEFISLASNWLSGGIPEELGILPKLDSLLLGGNNLRGTIPSSLGNISTLEL 173

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNS-------------------------MTGQ 287
           L L    +TGSIP  +  +  L ++ L GNS                         ++GQ
Sbjct: 174 LGLRETGLTGSIPSLIFNISSLLSIILTGNSISGSLSVDICQHSPNIEELLFTDNQLSGQ 233

Query: 288 IPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
           +PS +     +   +LS N F+G IP+  GS      L L  N LTG +P+S+     + 
Sbjct: 234 LPSGIHRCRELLFASLSYNRFDGQIPEEIGSLRNLEELYLGGNHLTGPIPSSIGNISSLQ 293

Query: 468 HLDISNNHLCGNIP 509
            L + +N + G+IP
Sbjct: 294 ILFLEDNKIQGSIP 307

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 51/169 (30%), Positives = 86/169 (50%), Gaps = 3/169 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S ++ LDLSNN   G++P      R+L    L+ N L G IP+ +  + +L  L L  N
Sbjct: 96  LSFIVLLDLSNNSFEGKIPPSISHCRRLEFISLASNWLSGGIPEELGILPKLDSLLLGGN 155

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFG 377
            + G+IP  LG +  L  L L    +TG IPS + + + +  + L+ N   G++  D+  
Sbjct: 156 NLRGTIPSSLGNISTLELLGLRETGLTGSIPSLIFNISSLLSIILTGNSISGSLSVDICQ 215

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS 518
                  L  + N+L+G++P+ + + + +    +S N   G IP  IGS
Sbjct: 216 HSPNIEELLFTDNQLSGQLPSGIHRCRELLFASLSYNRFDGQIPEEIGS 264

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 48/160 (30%), Positives = 80/160 (50%), Gaps = 1/160 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L    + G L    G L  +    LS N   G IP S+    RL  + L+ N ++G I
Sbjct: 78  LRLQKRGLKGTLSPYLGNLSFIVLLDLSNNSFEGKIPPSISHCRRLEFISLASNWLSGGI 137

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  LG +  L +L L GN++ G IPS+L + + + +L L   G  G+IP +  + S  + 
Sbjct: 138 PEELGILPKLDSLLLGGNNLRGTIPSSLGNISTLELLGLRETGLTGSIPSLIFNISSLLS 197

Query: 399 LDLSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIPIG 515
           + L+ N ++G +   + + +  +  L  ++N L G +P G
Sbjct: 198 IILTGNSISGSLSVDICQHSPNIEELLFTDNQLSGQLPSG 237

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 37/139 (26%), Positives = 65/139 (46%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           ++++   L +  L GT+   +  ++ +  LDLS N   G IP  +   R L  + L  N 
Sbjct: 73  QRVTALRLQKRGLKGTLSPYLGNLSFIVLLDLSNNSFEGKIPPSISHCRRLEFISLASNW 132

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA 455
           ++G IP  L     +  L L  N   GTIP   G+ S   +L L    LTG +P+ +   
Sbjct: 133 LSGGIPEELGILPKLDSLLLGGNNLRGTIPSSLGNISTLELLGLRETGLTGSIPSLIFNI 192

Query: 456 KFMGHLDISNNHLCGNIPI 512
             +  + ++ N + G++ +
Sbjct: 193 SSLLSIILTGNSISGSLSV 211

[93][TOP]
>UniRef100_Q53PD2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=Q53PD2_ORYSJ
          Length = 2207

 Score =  125 bits (315), Expect = 2e-27
 Identities = 69/189 (36%), Positives = 106/189 (56%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P SI  IS L  L LS N   G++P+  GKL+ L    LS N L+G+IP+S+  +  L  
Sbjct: 1717 PSSISNISNLEDLRLSTNLFGGKIPAGLGKLQVLHLMELSDNNLLGSIPESIFSIPTLTR 1776

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
              LS N++ G++P  +G  + L +L L  N +TG IPSTL +   +  L+L +N   G+I
Sbjct: 1777 CMLSFNKLDGALPTEIGNAKQLGSLHLSANKLTGHIPSTLSNCDSLEELHLDQNFLNGSI 1836

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P   G+      ++LS+N L+G +P+SL + + +  LD+S N+L G +P    F +  A 
Sbjct: 1837 PTSLGNMQSLTAVNLSYNDLSGSIPDSLGRLQSLEQLDLSFNNLVGEVPGIGVFKNATAI 1896

Query: 543  SFSNNDCLC 569
              + N  LC
Sbjct: 1897 RLNRNHGLC 1905

 Score =  125 bits (314), Expect = 2e-27
 Identities = 66/190 (34%), Positives = 107/190 (56%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P S+  +S L+ L L +NQ++G +PS FGKL+ L+R  +S N L G++P  + ++  +A+
Sbjct: 432  PSSLSNLSHLVELYLQSNQLLGNIPSSFGKLQFLTRIDISDNSLNGSLPKEIFRIPTIAE 491

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            +  S N ++G +P  +G  + L +L L  N+++G IP+TL +   +  + L +N F G+I
Sbjct: 492  VGFSFNNLSGELPTEVGYAKQLRSLHLSSNNLSGDIPNTLGNCENLQEVVLDQNNFGGSI 551

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P   G       L+LS N L G +P SL   + +  +D+S NHL G +P    F +  A 
Sbjct: 552  PASLGKLISLKSLNLSHNILNGSIPVSLGDLELLEQIDLSFNHLSGQVPTKGIFKNSTAT 611

Query: 543  SFSNNDCLCG 572
                N  LCG
Sbjct: 612  HMDGNLGLCG 621

 Score =  105 bits (261), Expect = 3e-21
 Identities = 63/187 (33%), Positives = 92/187 (49%), Gaps = 1/187 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I  +  L+ L L+ N   G +P   G L  L    L  N+  G +P S+  ++ L D
Sbjct: 1669 PSGIRNLPNLISLGLNENHFTGIVPEWVGTLANLEGIYLDNNKFTGFLPSSISNISNLED 1728

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L LS N   G IP  LGK++VL  ++L  N++ G IP ++ S   +    LS N  +G +
Sbjct: 1729 LRLSTNLFGGKIPAGLGKLQVLHLMELSDNNLLGSIPESIFSIPTLTRCMLSFNKLDGAL 1788

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDA 539
            P   G+      L LS NKLTG +P++L+    +  L +  N L G+IP        L A
Sbjct: 1789 PTEIGNAKQLGSLHLSANKLTGHIPSTLSNCDSLEELHLDQNFLNGSIPTSLGNMQSLTA 1848

Query: 540  ASFSNND 560
             + S ND
Sbjct: 1849 VNLSYND 1855

 Score = 97.4 bits (241), Expect = 7e-19
 Identities = 56/168 (33%), Positives = 84/168 (50%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           S+   + L  L ++ NQ+ G LP+  G    +L R  L +NQL G+ P  +  +  L   
Sbjct: 337 SLTNCTQLQALSMAGNQLEGHLPNSVGNFSVQLQRLYLGQNQLSGSFPSGIENLPNLIVF 396

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
            L  NR TGS+P  LG +  L  L L  N+ TG IPS+L + + +  L L  N   G IP
Sbjct: 397 GLDYNRFTGSVPPWLGGLITLQVLSLTNNNFTGYIPSSLSNLSHLVELYLQSNQLLGNIP 456

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             FG   +   +D+S N L G +P  + +   +  +  S N+L G +P
Sbjct: 457 SSFGKLQFLTRIDISDNSLNGSLPKEIFRIPTIAEVGFSFNNLSGELP 504

 Score = 97.1 bits (240), Expect = 9e-19
 Identities = 59/168 (35%), Positives = 92/168 (54%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9    SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
            S    S L  L LS NQI+G +P +      +S+ +++ N L GTIP S+  +  L  L 
Sbjct: 1423 SFANCSALKILHLSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIPTSLGDVATLNILI 1482

Query: 189  LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
            +S N I GSIP  +GKM VL+ L + GN+++G+ P  L + + +  L L  N F G +P 
Sbjct: 1483 VSYNYIEGSIPDEIGKMPVLTNLYVGGNNLSGRFPLALTNISSLVELGLGFNYFHGGLPP 1542

Query: 369  VFG-SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              G S     VL+++ N   G +P S++ A  +  +D S+N+  G +P
Sbjct: 1543 NLGTSLPRLQVLEIASNLFEGHLPYSISNATSLYTIDFSSNYFSGVVP 1590

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 60/185 (32%), Positives = 92/185 (49%), Gaps = 2/185 (1%)
 Frame = +3

Query: 9    SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
            S+  ++ L HL L+ NQ+ G++P   G L  L    L+ N L G IP S    + L  L 
Sbjct: 1376 SLGNLTSLEHLFLNTNQLSGQIPPSLGHLHHLRSLYLANNTLQGNIP-SFANCSALKILH 1434

Query: 189  LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
            LS N+I G IP  +     +S L ++ N++TG IP++L     + IL +S N  EG+IPD
Sbjct: 1435 LSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIPTSLGDVATLNILIVSYNYIEGSIPD 1494

Query: 369  VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAA 542
              G       L +  N L+GR P +L     +  L +  N+  G +P  +G+    L   
Sbjct: 1495 EIGKMPVLTNLYVGGNNLSGRFPLALTNISSLVELGLGFNYFHGGLPPNLGTSLPRLQVL 1554

Query: 543  SFSNN 557
              ++N
Sbjct: 1555 EIASN 1559

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 48/169 (28%), Positives = 80/169 (47%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L+   L  N+  G +P   G L  L    L+ N   G IP S+  ++ L +
Sbjct: 384 PSGIENLPNLIVFGLDYNRFTGSVPPWLGGLITLQVLSLTNNNFTGYIPSSLSNLSHLVE 443

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N++ G+IP   GK++ L+ + +  NS+ G +P  +     +  +  S N   G +
Sbjct: 444 LYLQSNQLLGNIPSSFGKLQFLTRIDISDNSLNGSLPKEIFRIPTIAEVGFSFNNLSGEL 503

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G       L LS N L+G +PN+L   + +  + +  N+  G+IP
Sbjct: 504 PTEVGYAKQLRSLHLSSNNLSGDIPNTLGNCENLQEVVLDQNNFGGSIP 552

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 49/158 (31%), Positives = 78/158 (49%)
 Frame = +3

Query: 39   LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
            LDLSN  ++G +    G L  L    L+ NQL G IP S+  ++ L  L L+ N + G+I
Sbjct: 1362 LDLSNRGLVGLISPSLGNLTSLEHLFLNTNQLSGQIPPSLGHLHHLRSLYLANNTLQGNI 1421

Query: 219  PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
            P        L  L L  N + G+IP  +     +  L ++ N   GTIP   G  +   +
Sbjct: 1422 P-SFANCSALKILHLSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIPTSLGDVATLNI 1480

Query: 399  LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
            L +S+N + G +P+ + K   + +L +  N+L G  P+
Sbjct: 1481 LIVSYNYIEGSIPDEIGKMPVLTNLYVGGNNLSGRFPL 1518

 Score = 84.3 bits (207), Expect = 6e-15
 Identities = 55/157 (35%), Positives = 75/157 (47%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           +DLSN  + G +    G L  L    L+ N+  G IP+S+  + RL  L LS N + G I
Sbjct: 79  IDLSNQNLAGNISPSLGNLTFLKHLSLATNEFTGRIPESLGHLRRLRSLYLSNNTLQGII 138

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P        L  L LD N +TG +P  L    G+  L +S N   GTIP   G+ +   +
Sbjct: 139 P-SFANCSDLRVLWLDHNELTGGLPDGL--PLGLEELQVSSNTLVGTIPPSLGNVTTLRM 195

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           L  +FN + G +P  LA  + M  L I  N L G  P
Sbjct: 196 LRFAFNGIEGGIPGELAALREMEILTIGGNRLSGGFP 232

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 53/169 (31%), Positives = 81/169 (47%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S+  ++ L HL L+ N+  G +P   G LR+L    LS N L G IP S    + L  L 
Sbjct: 93  SLGNLTFLKHLSLATNEFTGRIPESLGHLRRLRSLYLSNNTLQGIIP-SFANCSDLRVLW 151

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           L  N +TG +P   G    L  L++  N++ G IP +L + T + +L  + NG EG IP 
Sbjct: 152 LDHNELTGGLPD--GLPLGLEELQVSSNTLVGTIPPSLGNVTTLRMLRFAFNGIEGGIPG 209

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
              +     +L +  N+L+G  P  +     +  L +  N   G +P G
Sbjct: 210 ELAALREMEILTIGGNRLSGGFPEPIMNMSVLIRLSLETNRFSGKMPSG 258

 Score = 80.5 bits (197), Expect = 9e-14
 Identities = 56/168 (33%), Positives = 82/168 (48%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S    S L  L L +N++ G LP   G    L    +S N L+GTIP S+  +  L  L 
Sbjct: 140 SFANCSDLRVLWLDHNELTGGLPD--GLPLGLEELQVSSNTLVGTIPPSLGNVTTLRMLR 197

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
            + N I G IP  L  +R +  L + GN ++G  P  +++ + +  L+L  N F G +P 
Sbjct: 198 FAFNGIEGGIPGELAALREMEILTIGGNRLSGGFPEPIMNMSVLIRLSLETNRFSGKMPS 257

Query: 369 VFG-SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             G S      L +  N   G +P+SLA A  +  LDIS N+  G +P
Sbjct: 258 GIGTSLPNLWRLFIGGNFFQGNLPSSLANASNLVDLDISQNNFVGVVP 305

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 59/225 (26%), Positives = 91/225 (40%), Gaps = 56/225 (24%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I+ +S L+ L L  N+  G++PS  G  L  L R  +  N   G +P S+   + L 
Sbjct: 232 PEPIMNMSVLIRLSLETNRFSGKMPSGIGTSLPNLWRLFIGGNFFQGNLPSSLANASNLV 291

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLD------------------------------G 269
           DLD+S N   G +P  +GK+  L+ L L+                              G
Sbjct: 292 DLDISQNNFVGVVPAFIGKLANLTWLNLEMNQLHARSKQDWDFMDSLTNCTQLQALSMAG 351

Query: 270 NSMTGQIPSTL------LSNTGMG-------------------ILNLSRNGFEGTIPDVF 374
           N + G +P+++      L    +G                   +  L  N F G++P   
Sbjct: 352 NQLEGHLPNSVGNFSVQLQRLYLGQNQLSGSFPSGIENLPNLIVFGLDYNRFTGSVPPWL 411

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G      VL L+ N  TG +P+SL+    +  L + +N L GNIP
Sbjct: 412 GGLITLQVLSLTNNNFTGYIPSSLSNLSHLVELYLQSNQLLGNIP 456

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 59/200 (29%), Positives = 93/200 (46%), Gaps = 8/200 (4%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P SI   + L  +D S+N   G +PS  G L++LS   L  NQ        +  ++ L++
Sbjct: 1566 PYSISNATSLYTIDFSSNYFSGVVPSSIGMLKELSLLNLEWNQFESFNNKDLEFLHSLSN 1625

Query: 183  ------LDLSMNRITGSIPVRLGKMRV-LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
                  L L  N++ G IP  LG + + L  L L  N ++G  PS + +   +  L L+ 
Sbjct: 1626 CTDLQVLALYDNKLKGQIPYSLGNLSIQLQYLFLGSNQLSGGFPSGIRNLPNLISLGLNE 1685

Query: 342  NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-S 518
            N F G +P+  G+ +    + L  NK TG +P+S++    +  L +S N   G IP G  
Sbjct: 1686 NHFTGIVPEWVGTLANLEGIYLDNNKFTGFLPSSISNISNLEDLRLSTNLFGGKIPAGLG 1745

Query: 519  PFDHLDAASFSNNDCLCGNP 578
                L     S+N+ L   P
Sbjct: 1746 KLQVLHLMELSDNNLLGSIP 1765

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 39/113 (34%), Positives = 61/113 (53%)
 Frame = +3

Query: 171  RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
            R+  LDLS   + G I   LG +  L  L L+ N ++GQIP +L     +  L L+ N  
Sbjct: 1358 RVTSLDLSNRGLVGLISPSLGNLTSLEHLFLNTNQLSGQIPPSLGHLHHLRSLYLANNTL 1417

Query: 351  EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +G IP  F + S   +L LS N++ GR+P ++     +  L +++N+L G IP
Sbjct: 1418 QGNIPS-FANCSALKILHLSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIP 1469

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 55/208 (26%), Positives = 87/208 (41%), Gaps = 37/208 (17%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P S+  ++ L  L +S N I G +P + GK+  L+   +  N L G  P ++  ++ L +
Sbjct: 1469 PTSLGDVATLNILIVSYNYIEGSIPDEIGKMPVLTNLYVGGNNLSGRFPLALTNISSLVE 1528

Query: 183  LDLSMNRITGSIPVRLG----KMRVLS---------------------TLKLDGNSMTGQ 287
            L L  N   G +P  LG    +++VL                      T+    N  +G 
Sbjct: 1529 LGLGFNYFHGGLPPNLGTSLPRLQVLEIASNLFEGHLPYSISNATSLYTIDFSSNYFSGV 1588

Query: 288  IPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY-----------FMVLDLSFNKLTGRV 434
            +PS++     + +LNL  N FE      F +K               VL L  NKL G++
Sbjct: 1589 VPSSIGMLKELSLLNLEWNQFES-----FNNKDLEFLHSLSNCTDLQVLALYDNKLKGQI 1643

Query: 435  PNSLAKAKF-MGHLDISNNHLCGNIPIG 515
            P SL      + +L + +N L G  P G
Sbjct: 1644 PYSLGNLSIQLQYLFLGSNQLSGGFPSG 1671

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 42/113 (37%), Positives = 58/113 (51%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  +DLS   + G+I   LG +  L  L L  N  TG+IP +L     +  L LS N  
Sbjct: 75  RVTSIDLSNQNLAGNISPSLGNLTFLKHLSLATNEFTGRIPESLGHLRRLRSLYLSNNTL 134

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +G IP  F + S   VL L  N+LTG +P+ L     +  L +S+N L G IP
Sbjct: 135 QGIIPS-FANCSDLRVLWLDHNELTGGLPDGLPLG--LEELQVSSNTLVGTIP 184

[94][TOP]
>UniRef100_Q2EZ10 Receptor kinase TRKb n=1 Tax=Oryza sativa Indica Group
            RepID=Q2EZ10_ORYSI
          Length = 1096

 Score =  125 bits (315), Expect = 2e-27
 Identities = 67/190 (35%), Positives = 107/190 (56%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P +I  +  ++ L L +N+I G +P D   L  L   LLS NQL  T+P S+  ++++  
Sbjct: 537  PSNIALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNQLTSTVPPSLFHLDKIIR 596

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N ++G++PV +G ++ ++ + L  NS +G IP ++     +  LNLS N F  ++
Sbjct: 597  LDLSRNFLSGALPVDVGYLKQITIIDLSDNSFSGSIPDSIGELQMLTHLNLSANEFYDSV 656

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            PD FG+ +    LD+S N ++G +PN LA    +  L++S N L G IP G  F ++   
Sbjct: 657  PDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGIFANITLQ 716

Query: 543  SFSNNDCLCG 572
                N  LCG
Sbjct: 717  YLVGNSGLCG 726

 Score =  104 bits (260), Expect = 4e-21
 Identities = 59/173 (34%), Positives = 94/173 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  ++ L HL LS+NQ+   +P     L K+ R  LSRN L G +P  V  + ++  
Sbjct: 561  PKDMRNLTNLEHLLLSDNQLTSTVPPSLFHLDKIIRLDLSRNFLSGALPVDVGYLKQITI 620

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            +DLS N  +GSIP  +G++++L+ L L  N     +P +  + TG+  L++S N   GTI
Sbjct: 621  IDLSDNSFSGSIPDSIGELQMLTHLNLSANEFYDSVPDSFGNLTGLQTLDISHNSISGTI 680

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSP 521
            P+   + +  + L+LSFNKL G++P     A       + N+ LCG   +G P
Sbjct: 681  PNYLANFTTLVSLNLSFNKLHGQIPEGGIFANITLQYLVGNSGLCGAARLGFP 733

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 57/169 (33%), Positives = 87/169 (51%), Gaps = 1/169 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           IS L  L+L+N  + G +P++ G+LR+L    L  N + G I  ++  + RL  L+L  N
Sbjct: 109 ISFLFILNLTNTGLAGSVPNEIGRLRRLELLDLGHNAMSGGILIAIGNLTRLQLLNLQFN 168

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFG 377
           ++ G IP  L  +  L ++ L  N +TG IP  L +NT  +  LN+  N   G IP   G
Sbjct: 169 QLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIG 228

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF 524
           S      L+L  N LTG VP ++     +  + + +N L G IP  + F
Sbjct: 229 SLPILQHLNLQANNLTGAVPPAIFNMSKLSTISLVSNGLTGPIPGNTSF 277

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 52/169 (30%), Positives = 86/169 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  ++ L  +DLS+NQ+   +P     +  L    LS N L G IP ++  +  +  
Sbjct: 489 PATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIPSNIALLRNIVK 548

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N I+GSIP  +  +  L  L L  N +T  +P +L     +  L+LSRN   G +
Sbjct: 549 LFLESNEISGSIPKDMRNLTNLEHLLLSDNQLTSTVPPSLFHLDKIIRLDLSRNFLSGAL 608

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G      ++DLS N  +G +P+S+ + + + HL++S N    ++P
Sbjct: 609 PVDVGYLKQITIIDLSDNSFSGSIPDSIGELQMLTHLNLSANEFYDSVP 657

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 57/162 (35%), Positives = 85/162 (52%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L    LSNN++ G LP+    L  L    LS NQL   IP+S++ +  L  LDLS N 
Sbjct: 472 SQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNS 531

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           ++G IP  +  +R +  L L+ N ++G IP  + + T +  L LS N    T+P      
Sbjct: 532 LSGFIPSNIALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNQLTSTVPPSLFHL 591

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              + LDLS N L+G +P  +   K +  +D+S+N   G+IP
Sbjct: 592 DKIIRLDLSRNFLSGALPVDVGYLKQITIIDLSDNSFSGSIP 633

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 50/158 (31%), Positives = 82/158 (51%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+L N  + GEL S  G +  L    L+   L G++P+ + ++ RL  LDL  N ++G I
Sbjct: 91  LELPNVPLQGELSSHLGNISFLFILNLTNTGLAGSVPNEIGRLRRLELLDLGHNAMSGGI 150

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFM 395
            + +G +  L  L L  N + G IP+ L     +G +NL  N   G+IP D+F +     
Sbjct: 151 LIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLT 210

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L++  N L+G +P  +     + HL++  N+L G +P
Sbjct: 211 YLNVGNNSLSGLIPGCIGSLPILQHLNLQANNLTGAVP 248

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 57/162 (35%), Positives = 82/162 (50%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  L +  N I G LP   G L  +L    LS N+L GT+P ++  +  L  +DLS N++
Sbjct: 449 LSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQL 508

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
             +IP  +  +  L  L L GNS++G IPS +     +  L L  N   G+IP    + +
Sbjct: 509 RNAIPESIMTIENLQWLDLSGNSLSGFIPSNIALLRNIVKLFLESNEISGSIPKDMRNLT 568

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               L LS N+LT  VP SL     +  LD+S N L G +P+
Sbjct: 569 NLEHLLLSDNQLTSTVPPSLFHLDKIIRLDLSRNFLSGALPV 610

 Score = 80.5 bits (197), Expect = 9e-14
 Identities = 57/173 (32%), Positives = 83/173 (47%), Gaps = 2/173 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I R+  L  LDL +N + G +    G L +L    L  NQL G IP  +  ++ L  
Sbjct: 127 PNEIGRLRRLELLDLGHNAMSGGILIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGS 186

Query: 183 LDLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           ++L  N +TGSIP  L     +L+ L +  NS++G IP  + S   +  LNL  N   G 
Sbjct: 187 MNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNLQANNLTGA 246

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP-NSLAKAKFMGHLDISNNHLCGNIPIG 515
           +P    + S    + L  N LTG +P N+      +    IS N+  G IP+G
Sbjct: 247 VPPAIFNMSKLSTISLVSNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPVG 299

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 49/164 (29%), Positives = 79/164 (48%), Gaps = 2/164 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L +L++ NN + G +P   G L  L    L  N L G +P ++  M++L+ + L  N +T
Sbjct: 209 LTYLNVGNNSLSGLIPGCIGSLPILQHLNLQANNLTGAVPPAIFNMSKLSTISLVSNGLT 268

Query: 210 GSIPVRLG-KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           G IP      + VL    +  N+  GQIP  L +   + ++ +  N FEG +P   G   
Sbjct: 269 GPIPGNTSFSLPVLRWFAISKNNFFGQIPVGLAACPYLQVIAMPYNLFEGVLPPWLGR-- 326

Query: 387 YFMVLDLSFNKL-TGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
             + + L  N    G +P  L+    +  LD++  +L GNIP G
Sbjct: 327 --LTISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPAG 368

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 52/180 (28%), Positives = 84/180 (46%), Gaps = 27/180 (15%)
 Frame = +3

Query: 51  NNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRL 230
           NN   G +P++   L  L+   L+   L G IP  +  + +L+ L L+MN++TG IP  L
Sbjct: 334 NNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPAGIGHLGQLSWLHLAMNQLTGPIPASL 393

Query: 231 GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE------------------- 353
           G +  L+ L L GN + G +PST+ S   +  ++++ N                      
Sbjct: 394 GNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQ 453

Query: 354 -------GTIPDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                  G +PD  G+  S      LS NKLTG +P +++    +  +D+S+N L   IP
Sbjct: 454 MDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIP 513

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 52/189 (27%), Positives = 93/189 (49%), Gaps = 4/189 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ +     L  + +  N   G LP   G+L   + +L   N   G IP  +  +  L  
Sbjct: 297 PVGLAACPYLQVIAMPYNLFEGVLPPWLGRL---TISLGGNNFDAGPIPTELSNLTMLTV 353

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL+   +TG+IP  +G +  LS L L  N +TG IP++L + + + IL L  N  +G++
Sbjct: 354 LDLTTCNLTGNIPAGIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSL 413

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP--IGSPFDH 530
           P    S +    +D++ N L G +   ++++  + +  L +  N++ G +P  +G+    
Sbjct: 414 PSTVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQ 473

Query: 531 LDAASFSNN 557
           L   + SNN
Sbjct: 474 LKWFTLSNN 482

 Score = 57.4 bits (137), Expect = 8e-07
 Identities = 31/116 (26%), Positives = 57/116 (49%)
 Frame = +3

Query: 162 KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
           +  R+  L+L    + G +   LG +  L  L L    + G +P+ +     + +L+L  
Sbjct: 84  RRQRVTALELPNVPLQGELSSHLGNISFLFILNLTNTGLAGSVPNEIGRLRRLELLDLGH 143

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           N   G I    G+ +   +L+L FN+L G +P  L     +G +++ +N+L G+IP
Sbjct: 144 NAMSGGILIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIP 199

[95][TOP]
>UniRef100_C5X0T5 Putative uncharacterized protein Sb01g036160 n=1 Tax=Sorghum
           bicolor RepID=C5X0T5_SORBI
          Length = 972

 Score =  125 bits (315), Expect = 2e-27
 Identities = 71/183 (38%), Positives = 106/183 (57%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L  +DLSNN   G +PS+  KL+ L    +S N + G+IP S+L+M  L  LDL+ NR
Sbjct: 386 SVLQGVDLSNNAFSGVIPSEISKLQNLHSLNMSWNSMSGSIPASILEMKSLEVLDLTANR 445

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           + G IP   G    L  L+L  N +TG IP+ + + + +  L+LS N   G IP+   + 
Sbjct: 446 LNGCIPASTGG-ESLQELRLGKNFLTGNIPAQIGNCSSLASLDLSHNNLTGGIPETISNL 504

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNNDC 563
           +   ++DLS NKLTG +P  L+    +   ++S+N L G++P GS FD +  +S S+N  
Sbjct: 505 TNLEIVDLSQNKLTGVLPKQLSNLPHLLQFNVSHNQLSGDLPPGSFFDTIPLSSVSDNPG 564

Query: 564 LCG 572
           LCG
Sbjct: 565 LCG 567

 Score =  106 bits (265), Expect = 1e-21
 Identities = 64/186 (34%), Positives = 94/186 (50%), Gaps = 1/186 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ I R+  L  L+L  N++ G LP D G    L    L  N L G +P+S+ +++    
Sbjct: 212 PIGISRMFNLRALNLRGNRLTGSLPDDIGDCPLLRSLDLGSNSLSGDLPESLRRLSTCTY 271

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N  TGS+P   G+M  L  L L GN  +G+IP ++     +  L LS NGF G +
Sbjct: 272 LDLSSNEFTGSVPTWFGEMGSLEILDLSGNKFSGEIPGSIGGLMSLRELRLSGNGFTGAL 331

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI-GSPFDHLDA 539
           P+  G     M +D+S+N LTG +P S      +  + +S N L G + +  +    L  
Sbjct: 332 PESIGGCKSLMHVDVSWNSLTGALP-SWVLGSGVQWVSVSQNTLSGEVKVPANASSVLQG 390

Query: 540 ASFSNN 557
              SNN
Sbjct: 391 VDLSNN 396

 Score =  105 bits (262), Expect = 3e-21
 Identities = 59/169 (34%), Positives = 90/169 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +   + L  L+LS+N + G LPSD   L  L    +S N + G +P  + +M  L  
Sbjct: 164 PRDVAACATLASLNLSSNLLAGALPSDIWSLNALRTLDISGNAVTGDLPIGISRMFNLRA 223

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L  NR+TGS+P  +G   +L +L L  NS++G +P +L   +    L+LS N F G++
Sbjct: 224 LNLRGNRLTGSLPDDIGDCPLLRSLDLGSNSLSGDLPESLRRLSTCTYLDLSSNEFTGSV 283

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P  FG      +LDLS NK +G +P S+     +  L +S N   G +P
Sbjct: 284 PTWFGEMGSLEILDLSGNKFSGEIPGSIGGLMSLRELRLSGNGFTGALP 332

 Score =  103 bits (258), Expect = 7e-21
 Identities = 59/170 (34%), Positives = 86/170 (50%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSD-FGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  + R+  L  LDLS N   G +P   FG+ R L    L+ N   G IP  V     LA
Sbjct: 115 PAELARLPALQTLDLSANAFAGAIPEGLFGRCRSLRDVSLAGNAFSGGIPRDVAACATLA 174

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L+LS N + G++P  +  +  L TL + GN++TG +P  +     +  LNL  N   G+
Sbjct: 175 SLNLSSNLLAGALPSDIWSLNALRTLDISGNAVTGDLPIGISRMFNLRALNLRGNRLTGS 234

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +PD  G       LDL  N L+G +P SL +     +LD+S+N   G++P
Sbjct: 235 LPDDIGDCPLLRSLDLGSNSLSGDLPESLRRLSTCTYLDLSSNEFTGSVP 284

 Score =  100 bits (248), Expect = 1e-19
 Identities = 57/169 (33%), Positives = 84/169 (49%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++ L  LD+S N + G+LP    ++  L    L  N+L G++PD +     L  
Sbjct: 188 PSDIWSLNALRTLDISGNAVTGDLPIGISRMFNLRALNLRGNRLTGSLPDDIGDCPLLRS 247

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL  N ++G +P  L ++   + L L  N  TG +P+       + IL+LS N F G I
Sbjct: 248 LDLGSNSLSGDLPESLRRLSTCTYLDLSSNEFTGSVPTWFGEMGSLEILDLSGNKFSGEI 307

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G       L LS N  TG +P S+   K + H+D+S N L G +P
Sbjct: 308 PGSIGGLMSLRELRLSGNGFTGALPESIGGCKSLMHVDVSWNSLTGALP 356

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 54/164 (32%), Positives = 78/164 (47%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           R   L  + L+ N   G +P D      L+   LS N L G +P  +  +N L  LD+S 
Sbjct: 145 RCRSLRDVSLAGNAFSGGIPRDVAACATLASLNLSSNLLAGALPSDIWSLNALRTLDISG 204

Query: 198 NRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
           N +TG +P+ + +M  L  L L GN +TG +P  +     +  L+L  N   G +P+   
Sbjct: 205 NAVTGDLPIGISRMFNLRALNLRGNRLTGSLPDDIGDCPLLRSLDLGSNSLSGDLPESLR 264

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             S    LDLS N+ TG VP    +   +  LD+S N   G IP
Sbjct: 265 RLSTCTYLDLSSNEFTGSVPTWFGEMGSLEILDLSGNKFSGEIP 308

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 51/158 (32%), Positives = 81/158 (51%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L+   + G+L     +L  L    L+RN L G +P  + ++  L  LDLS N   G+I
Sbjct: 79  LSLAGFGLSGKLGRGLLRLEALQSLSLARNNLSGDVPAELARLPALQTLDLSANAFAGAI 138

Query: 219 PVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFM 395
           P  L G+ R L  + L GN+ +G IP  + +   +  LNLS N   G +P    S +   
Sbjct: 139 PEGLFGRCRSLRDVSLAGNAFSGGIPRDVAACATLASLNLSSNLLAGALPSDIWSLNALR 198

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            LD+S N +TG +P  +++   +  L++  N L G++P
Sbjct: 199 TLDISGNAVTGDLPIGISRMFNLRALNLRGNRLTGSLP 236

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 43/140 (30%), Positives = 71/140 (50%), Gaps = 1/140 (0%)
 Frame = +3

Query: 99  KLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSM 278
           ++S   L+   L G +   +L++  L  L L+ N ++G +P  L ++  L TL L  N+ 
Sbjct: 75  RVSALSLAGFGLSGKLGRGLLRLEALQSLSLARNNLSGDVPAELARLPALQTLDLSANAF 134

Query: 279 TGQIPSTLLSNT-GMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA 455
            G IP  L      +  ++L+ N F G IP    + +    L+LS N L G +P+ +   
Sbjct: 135 AGAIPEGLFGRCRSLRDVSLAGNAFSGGIPRDVAACATLASLNLSSNLLAGALPSDIWSL 194

Query: 456 KFMGHLDISNNHLCGNIPIG 515
             +  LDIS N + G++PIG
Sbjct: 195 NALRTLDISGNAVTGDLPIG 214

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 33/117 (28%), Positives = 62/117 (52%), Gaps = 1/117 (0%)
 Frame = +3

Query: 162 KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
           +  R++ L L+   ++G +   L ++  L +L L  N+++G +P+ L     +  L+LS 
Sbjct: 72  RTGRVSALSLAGFGLSGKLGRGLLRLEALQSLSLARNNLSGDVPAELARLPALQTLDLSA 131

Query: 342 NGFEGTIPD-VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           N F G IP+ +FG       + L+ N  +G +P  +A    +  L++S+N L G +P
Sbjct: 132 NAFAGAIPEGLFGRCRSLRDVSLAGNAFSGGIPRDVAACATLASLNLSSNLLAGALP 188

[96][TOP]
>UniRef100_B9IHK8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IHK8_POPTR
          Length = 1019

 Score =  125 bits (315), Expect = 2e-27
 Identities = 71/190 (37%), Positives = 104/190 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I     L+ + L+NN + GE+PS  G L  L    L  N L  TIP ++  +  L  
Sbjct: 461  PSDICLARRLVDITLNNNVLSGEIPSCIGNLTSLRNLYLHFNILSSTIPMALWSLKDLLI 520

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+L  N + GS+P ++G+M     ++L  N ++G IPST+ S   +   +LS+N F+G+I
Sbjct: 521  LNLHSNFLYGSLPSQVGEMEAAIGIRLSSNQLSGNIPSTIGSLQNLIRFSLSKNSFQGSI 580

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P+ FG      +LDLS N L+G +P SL   +++    +S N L G IP G PF +  A 
Sbjct: 581  PEAFGGLVSLELLDLSQNNLSGEIPKSLEALRYLEFFSVSFNGLQGEIPRGGPFANFTAR 640

Query: 543  SFSNNDCLCG 572
            SF  N  LCG
Sbjct: 641  SFIMNKGLCG 650

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 57/177 (32%), Positives = 88/177 (49%), Gaps = 2/177 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQI-IGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  +  L  +D+ +N++ +  +P  FG L +L       N L GTIP ++  ++ L 
Sbjct: 114 PSEIGNLRRLQVMDIGSNKLSLVIVPESFGNLHRLEELRFDGNNLTGTIPSTIFNISSLK 173

Query: 180 DLDLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEG 356
            LDL  N + GS+P  +   +  L  L L  N ++GQIPS L     + +L L  N F G
Sbjct: 174 VLDLMFNGLFGSLPKNMCDHLPRLEMLLLSSNQLSGQIPSDLFKCRELQLLWLPYNNFTG 233

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFD 527
            IP+  G      VL+L  N L+G +P S+     +  + I  N+L G+IP  +  D
Sbjct: 234 VIPEELGFLPMLEVLNLGVNMLSGDLPRSIFNMTSLRTMQICCNNLSGSIPQENSID 290

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 58/170 (34%), Positives = 82/170 (48%), Gaps = 2/170 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDF-GKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  IS L  LDL  N + G LP +    L +L   LLS NQL G IP  + K   L 
Sbjct: 163 PSTIFNISSLKVLDLMFNGLFGSLPKNMCDHLPRLEMLLLSSNQLSGQIPSDLFKCRELQ 222

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N  TG IP  LG + +L  L L  N ++G +P ++ + T +  + +  N   G+
Sbjct: 223 LLWLPYNNFTGVIPEELGFLPMLEVLNLGVNMLSGDLPRSIFNMTSLRTMQICCNNLSGS 282

Query: 360 IPDVFG-SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           IP            L L+ N +TG +P  L     +  LD+S N + GN+
Sbjct: 283 IPQENSIDLPNLEELQLNLNGITGSMPRFLGNMSRLEILDLSYNKMTGNV 332

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 55/170 (32%), Positives = 87/170 (51%), Gaps = 2/170 (1%)
 Frame = +3

Query: 54  NQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLG 233
           +++ G +P + G L  L    L  N L+G IP +V  + ++  L L  N + GSIP  + 
Sbjct: 406 SKLKGNIPGEIGNLSNLIVLSLEENSLMGPIPTTVGGLRKIQVLYLHKNNLNGSIPSDIC 465

Query: 234 KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSF 413
             R L  + L+ N ++G+IPS + + T +  L L  N    TIP    S    ++L+L  
Sbjct: 466 LARRLVDITLNNNVLSGEIPSCIGNLTSLRNLYLHFNILSSTIPMALWSLKDLLILNLHS 525

Query: 414 NKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAASFSNN 557
           N L G +P+ + + +    + +S+N L GNIP  IGS   +L   S S N
Sbjct: 526 NFLYGSLPSQVGEMEAAIGIRLSSNQLSGNIPSTIGS-LQNLIRFSLSKN 574

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 50/178 (28%), Positives = 85/178 (47%), Gaps = 9/178 (5%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P SI  ++ L  + +  N + G +P +    L  L    L+ N + G++P  +  M+RL 
Sbjct: 260 PRSIFNMTSLRTMQICCNNLSGSIPQENSIDLPNLEELQLNLNGITGSMPRFLGNMSRLE 319

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS-------TLLSNTGMGILNLS 338
            LDLS N++TG++    G +R L  L L  NS T    S       +L ++  +  L++ 
Sbjct: 320 ILDLSYNKMTGNVLQEFGNLRALQVLSLQSNSFTNHPSSQTLNFITSLTNSRQLKELHIG 379

Query: 339 RNGFEGTIPDVFGSKSYFMVLDLSF-NKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            N  +G +P+  G+ S F+     + +KL G +P  +     +  L +  N L G IP
Sbjct: 380 DNPLDGMLPNSVGNLSSFLTKFYVYASKLKGNIPGEIGNLSNLIVLSLEENSLMGPIP 437

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 46/157 (29%), Positives = 76/157 (48%), Gaps = 26/157 (16%)
 Frame = +3

Query: 117 LSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLST-------------- 254
           LS   L+GTIP  +  ++ L  L L  N   G +P  +G +R L                
Sbjct: 80  LSSMGLLGTIPPQLGNLSFLQYLILYNNSFHGDLPSEIGNLRRLQVMDIGSNKLSLVIVP 139

Query: 255 -----------LKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFMV 398
                      L+ DGN++TG IPST+ + + + +L+L  NG  G++P ++        +
Sbjct: 140 ESFGNLHRLEELRFDGNNLTGTIPSTIFNISSLKVLDLMFNGLFGSLPKNMCDHLPRLEM 199

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           L LS N+L+G++P+ L K + +  L +  N+  G IP
Sbjct: 200 LLLSSNQLSGQIPSDLFKCRELQLLWLPYNNFTGVIP 236

 Score = 58.2 bits (139), Expect = 5e-07
 Identities = 39/126 (30%), Positives = 64/126 (50%), Gaps = 1/126 (0%)
 Frame = +3

Query: 159 LKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLS 338
           L+  R+  LDLS   + G+IP +LG +  L  L L  NS  G +PS + +   + ++++ 
Sbjct: 70  LRRQRVTALDLSSMGLLGTIPPQLGNLSFLQYLILYNNSFHGDLPSEIGNLRRLQVMDIG 129

Query: 339 RNGFEGTI-PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
            N     I P+ FG+      L    N LTG +P+++     +  LD+  N L G++P  
Sbjct: 130 SNKLSLVIVPESFGNLHRLEELRFDGNNLTGTIPSTIFNISSLKVLDLMFNGLFGSLP-K 188

Query: 516 SPFDHL 533
           +  DHL
Sbjct: 189 NMCDHL 194

[97][TOP]
>UniRef100_Q2R9X8 Leucine Rich Repeat family protein, expressed n=3 Tax=Oryza sativa
           Japonica Group RepID=Q2R9X8_ORYSJ
          Length = 1012

 Score =  125 bits (315), Expect = 2e-27
 Identities = 69/189 (36%), Positives = 106/189 (56%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  IS L  L LS N   G++P+  GKL+ L    LS N L+G+IP+S+  +  L  
Sbjct: 433 PSSISNISNLEDLRLSTNLFGGKIPAGLGKLQVLHLMELSDNNLLGSIPESIFSIPTLTR 492

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
             LS N++ G++P  +G  + L +L L  N +TG IPSTL +   +  L+L +N   G+I
Sbjct: 493 CMLSFNKLDGALPTEIGNAKQLGSLHLSANKLTGHIPSTLSNCDSLEELHLDQNFLNGSI 552

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P   G+      ++LS+N L+G +P+SL + + +  LD+S N+L G +P    F +  A 
Sbjct: 553 PTSLGNMQSLTAVNLSYNDLSGSIPDSLGRLQSLEQLDLSFNNLVGEVPGIGVFKNATAI 612

Query: 543 SFSNNDCLC 569
             + N  LC
Sbjct: 613 RLNRNHGLC 621

 Score =  105 bits (261), Expect = 3e-21
 Identities = 63/187 (33%), Positives = 92/187 (49%), Gaps = 1/187 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L+ L L+ N   G +P   G L  L    L  N+  G +P S+  ++ L D
Sbjct: 385 PSGIRNLPNLISLGLNENHFTGIVPEWVGTLANLEGIYLDNNKFTGFLPSSISNISNLED 444

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N   G IP  LGK++VL  ++L  N++ G IP ++ S   +    LS N  +G +
Sbjct: 445 LRLSTNLFGGKIPAGLGKLQVLHLMELSDNNLLGSIPESIFSIPTLTRCMLSFNKLDGAL 504

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDA 539
           P   G+      L LS NKLTG +P++L+    +  L +  N L G+IP        L A
Sbjct: 505 PTEIGNAKQLGSLHLSANKLTGHIPSTLSNCDSLEELHLDQNFLNGSIPTSLGNMQSLTA 564

Query: 540 ASFSNND 560
            + S ND
Sbjct: 565 VNLSYND 571

 Score = 97.1 bits (240), Expect = 9e-19
 Identities = 59/168 (35%), Positives = 92/168 (54%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S    S L  L LS NQI+G +P +      +S+ +++ N L GTIP S+  +  L  L 
Sbjct: 139 SFANCSALKILHLSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIPTSLGDVATLNILI 198

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           +S N I GSIP  +GKM VL+ L + GN+++G+ P  L + + +  L L  N F G +P 
Sbjct: 199 VSYNYIEGSIPDEIGKMPVLTNLYVGGNNLSGRFPLALTNISSLVELGLGFNYFHGGLPP 258

Query: 369 VFG-SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             G S     VL+++ N   G +P S++ A  +  +D S+N+  G +P
Sbjct: 259 NLGTSLPRLQVLEIASNLFEGHLPYSISNATSLYTIDFSSNYFSGVVP 306

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 60/185 (32%), Positives = 92/185 (49%), Gaps = 2/185 (1%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S+  ++ L HL L+ NQ+ G++P   G L  L    L+ N L G IP S    + L  L 
Sbjct: 92  SLGNLTSLEHLFLNTNQLSGQIPPSLGHLHHLRSLYLANNTLQGNIP-SFANCSALKILH 150

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           LS N+I G IP  +     +S L ++ N++TG IP++L     + IL +S N  EG+IPD
Sbjct: 151 LSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIPTSLGDVATLNILIVSYNYIEGSIPD 210

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAA 542
             G       L +  N L+GR P +L     +  L +  N+  G +P  +G+    L   
Sbjct: 211 EIGKMPVLTNLYVGGNNLSGRFPLALTNISSLVELGLGFNYFHGGLPPNLGTSLPRLQVL 270

Query: 543 SFSNN 557
             ++N
Sbjct: 271 EIASN 275

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 49/158 (31%), Positives = 78/158 (49%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           LDLSN  ++G +    G L  L    L+ NQL G IP S+  ++ L  L L+ N + G+I
Sbjct: 78  LDLSNRGLVGLISPSLGNLTSLEHLFLNTNQLSGQIPPSLGHLHHLRSLYLANNTLQGNI 137

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P        L  L L  N + G+IP  +     +  L ++ N   GTIP   G  +   +
Sbjct: 138 P-SFANCSALKILHLSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIPTSLGDVATLNI 196

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           L +S+N + G +P+ + K   + +L +  N+L G  P+
Sbjct: 197 LIVSYNYIEGSIPDEIGKMPVLTNLYVGGNNLSGRFPL 234

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 59/200 (29%), Positives = 93/200 (46%), Gaps = 8/200 (4%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI   + L  +D S+N   G +PS  G L++LS   L  NQ        +  ++ L++
Sbjct: 282 PYSISNATSLYTIDFSSNYFSGVVPSSIGMLKELSLLNLEWNQFESFNNKDLEFLHSLSN 341

Query: 183 ------LDLSMNRITGSIPVRLGKMRV-LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
                 L L  N++ G IP  LG + + L  L L  N ++G  PS + +   +  L L+ 
Sbjct: 342 CTDLQVLALYDNKLKGQIPYSLGNLSIQLQYLFLGSNQLSGGFPSGIRNLPNLISLGLNE 401

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-S 518
           N F G +P+  G+ +    + L  NK TG +P+S++    +  L +S N   G IP G  
Sbjct: 402 NHFTGIVPEWVGTLANLEGIYLDNNKFTGFLPSSISNISNLEDLRLSTNLFGGKIPAGLG 461

Query: 519 PFDHLDAASFSNNDCLCGNP 578
               L     S+N+ L   P
Sbjct: 462 KLQVLHLMELSDNNLLGSIP 481

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 39/113 (34%), Positives = 61/113 (53%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  LDLS   + G I   LG +  L  L L+ N ++GQIP +L     +  L L+ N  
Sbjct: 74  RVTSLDLSNRGLVGLISPSLGNLTSLEHLFLNTNQLSGQIPPSLGHLHHLRSLYLANNTL 133

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +G IP  F + S   +L LS N++ GR+P ++     +  L +++N+L G IP
Sbjct: 134 QGNIPS-FANCSALKILHLSRNQIVGRIPKNVHLPPSISQLIVNDNNLTGTIP 185

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 55/208 (26%), Positives = 87/208 (41%), Gaps = 37/208 (17%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ L  L +S N I G +P + GK+  L+   +  N L G  P ++  ++ L +
Sbjct: 185 PTSLGDVATLNILIVSYNYIEGSIPDEIGKMPVLTNLYVGGNNLSGRFPLALTNISSLVE 244

Query: 183 LDLSMNRITGSIPVRLG----KMRVLS---------------------TLKLDGNSMTGQ 287
           L L  N   G +P  LG    +++VL                      T+    N  +G 
Sbjct: 245 LGLGFNYFHGGLPPNLGTSLPRLQVLEIASNLFEGHLPYSISNATSLYTIDFSSNYFSGV 304

Query: 288 IPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY-----------FMVLDLSFNKLTGRV 434
           +PS++     + +LNL  N FE      F +K               VL L  NKL G++
Sbjct: 305 VPSSIGMLKELSLLNLEWNQFES-----FNNKDLEFLHSLSNCTDLQVLALYDNKLKGQI 359

Query: 435 PNSLAKAKF-MGHLDISNNHLCGNIPIG 515
           P SL      + +L + +N L G  P G
Sbjct: 360 PYSLGNLSIQLQYLFLGSNQLSGGFPSG 387

[98][TOP]
>UniRef100_B8BIH2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8BIH2_ORYSI
          Length = 715

 Score =  125 bits (315), Expect = 2e-27
 Identities = 67/190 (35%), Positives = 107/190 (56%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  +  ++ L L +N+I G +P D   L  L   LLS NQL  T+P S+  ++++  
Sbjct: 156 PSNIALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNQLTSTVPPSLFHLDKIIR 215

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N ++G++PV +G ++ ++ + L  NS +G IP ++     +  LNLS N F  ++
Sbjct: 216 LDLSRNFLSGALPVDVGYLKQITIIDLSDNSFSGSIPDSIGELQMLTHLNLSANEFYDSV 275

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PD FG+ +    LD+S N ++G +PN LA    +  L++S N L G IP G  F ++   
Sbjct: 276 PDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGIFANITLQ 335

Query: 543 SFSNNDCLCG 572
               N  LCG
Sbjct: 336 YLVGNSGLCG 345

 Score =  104 bits (260), Expect = 4e-21
 Identities = 59/173 (34%), Positives = 94/173 (54%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  ++ L HL LS+NQ+   +P     L K+ R  LSRN L G +P  V  + ++  
Sbjct: 180 PKDMRNLTNLEHLLLSDNQLTSTVPPSLFHLDKIIRLDLSRNFLSGALPVDVGYLKQITI 239

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +DLS N  +GSIP  +G++++L+ L L  N     +P +  + TG+  L++S N   GTI
Sbjct: 240 IDLSDNSFSGSIPDSIGELQMLTHLNLSANEFYDSVPDSFGNLTGLQTLDISHNSISGTI 299

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSP 521
           P+   + +  + L+LSFNKL G++P     A       + N+ LCG   +G P
Sbjct: 300 PNYLANFTTLVSLNLSFNKLHGQIPEGGIFANITLQYLVGNSGLCGAARLGFP 352

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 52/169 (30%), Positives = 86/169 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  ++ L  +DLS+NQ+   +P     +  L    LS N L G IP ++  +  +  
Sbjct: 108 PATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIPSNIALLRNIVK 167

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N I+GSIP  +  +  L  L L  N +T  +P +L     +  L+LSRN   G +
Sbjct: 168 LFLESNEISGSIPKDMRNLTNLEHLLLSDNQLTSTVPPSLFHLDKIIRLDLSRNFLSGAL 227

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G      ++DLS N  +G +P+S+ + + + HL++S N    ++P
Sbjct: 228 PVDVGYLKQITIIDLSDNSFSGSIPDSIGELQMLTHLNLSANEFYDSVP 276

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 57/162 (35%), Positives = 85/162 (52%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L    LSNN++ G LP+    L  L    LS NQL   IP+S++ +  L  LDLS N 
Sbjct: 91  SQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNS 150

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           ++G IP  +  +R +  L L+ N ++G IP  + + T +  L LS N    T+P      
Sbjct: 151 LSGFIPSNIALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNQLTSTVPPSLFHL 210

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              + LDLS N L+G +P  +   K +  +D+S+N   G+IP
Sbjct: 211 DKIIRLDLSRNFLSGALPVDVGYLKQITIIDLSDNSFSGSIP 252

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 57/162 (35%), Positives = 82/162 (50%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  L +  N I G LP   G L  +L    LS N+L GT+P ++  +  L  +DLS N++
Sbjct: 68  LSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQL 127

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
             +IP  +  +  L  L L GNS++G IPS +     +  L L  N   G+IP    + +
Sbjct: 128 RNAIPESIMTIENLQWLDLSGNSLSGFIPSNIALLRNIVKLFLESNEISGSIPKDMRNLT 187

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               L LS N+LT  VP SL     +  LD+S N L G +P+
Sbjct: 188 NLEHLLLSDNQLTSTVPPSLFHLDKIIRLDLSRNFLSGALPV 229

 Score = 77.8 bits (190), Expect = 6e-13
 Identities = 46/172 (26%), Positives = 85/172 (49%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELP--SDFGKLRKLSRALLSRNQLIGTIPDSVLKM-NR 173
           P ++  ++ L  +D++ N + G+L   S     RKLS   +  N + G +PD V  + ++
Sbjct: 33  PSTVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQ 92

Query: 174 LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L    LS N++TG++P  +  +  L  + L  N +   IP ++++   +  L+LS N   
Sbjct: 93  LKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLS 152

Query: 354 GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G IP         + L L  N+++G +P  +     + HL +S+N L   +P
Sbjct: 153 GFIPSNIALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNQLTSTVP 204

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 48/155 (30%), Positives = 73/155 (47%), Gaps = 27/155 (17%)
 Frame = +3

Query: 126 NQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKM---------------------- 239
           NQL G IP S+  ++ LA L L  N + GS+P  +  M                      
Sbjct: 2   NQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNFLST 61

Query: 240 ----RVLSTLKLDGNSMTGQIPSTLLS-NTGMGILNLSRNGFEGTIPDVFGSKSYFMVLD 404
               R LSTL++D N +TG +P  + + ++ +    LS N   GT+P    + +   V+D
Sbjct: 62  VSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVID 121

Query: 405 LSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           LS N+L   +P S+   + +  LD+S N L G IP
Sbjct: 122 LSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIP 156

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 38/132 (28%), Positives = 60/132 (45%), Gaps = 27/132 (20%)
 Frame = +3

Query: 195 MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE------- 353
           MN++TG IP  LG +  L+ L L GN + G +PST+ S   +  ++++ N          
Sbjct: 1   MNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNFLS 60

Query: 354 -------------------GTIPDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHL 473
                              G +PD  G+  S      LS NKLTG +P +++    +  +
Sbjct: 61  TVSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVI 120

Query: 474 DISNNHLCGNIP 509
           D+S+N L   IP
Sbjct: 121 DLSHNQLRNAIP 132

[99][TOP]
>UniRef100_A7Q8Z3 Chromosome chr9 scaffold_65, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7Q8Z3_VITVI
          Length = 948

 Score =  125 bits (315), Expect = 2e-27
 Identities = 68/190 (35%), Positives = 99/190 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +  L  L L NN++ G +P   G L +L +  LS N L  +IP  +  +  L  
Sbjct: 388 PEELCGLRDLGELSLYNNKLSGSIPHCIGNLSRLQKLFLSSNSLTSSIPTGLWSLGNLLF 447

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LS N + GS+P  +G + V+  + L  N + G IP  L +   +  LNLSRN F+  I
Sbjct: 448 LNLSFNSLGGSLPSDMGTLTVIEDIDLSWNKLIGNIPGILGTFESLYSLNLSRNSFQEAI 507

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P+  G       +DLS N L+G +P S      + +L++S N+L G IP G PF +  A 
Sbjct: 508 PETLGKLRALEFMDLSQNNLSGTIPKSFEALSHLKYLNLSFNNLSGEIPNGGPFVNFTAQ 567

Query: 543 SFSNNDCLCG 572
           SF  N  LCG
Sbjct: 568 SFLENKALCG 577

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 55/168 (32%), Positives = 85/168 (50%), Gaps = 1/168 (0%)
 Frame = +3

Query: 57  QIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGK 236
           Q+ G +PS  G L+ L    L  N L G IP ++ ++  L  +++  N + G IP  L  
Sbjct: 334 QLKGHIPSGIGSLKNLGTLELGDNNLNGNIPSTIGRLENLQRMNIFNNELEGPIPEELCG 393

Query: 237 MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFN 416
           +R L  L L  N ++G IP  + + + +  L LS N    +IP    S    + L+LSFN
Sbjct: 394 LRDLGELSLYNNKLSGSIPHCIGNLSRLQKLFLSSNSLTSSIPTGLWSLGNLLFLNLSFN 453

Query: 417 KLTGRVPNSLAKAKFMGHLDISNNHLCGNIP-IGSPFDHLDAASFSNN 557
            L G +P+ +     +  +D+S N L GNIP I   F+ L + + S N
Sbjct: 454 SLGGSLPSDMGTLTVIEDIDLSWNKLIGNIPGILGTFESLYSLNLSRN 501

 Score = 84.7 bits (208), Expect = 5e-15
 Identities = 52/164 (31%), Positives = 83/164 (50%), Gaps = 1/164 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S ++ L L NNQ+ G++P      R+L    L+ N L G IP+ +  + +L  L L  N
Sbjct: 98  LSFIVILILQNNQLEGKIPPSISHCRRLEFISLASNWLSGGIPEELGILPKLDSLLLGGN 157

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEG-TIPDVFG 377
            + G+IP  LG +  L  L L    +TG IPS + + + +  + L+ N   G +IP   G
Sbjct: 158 NLRGTIPSSLGNISTLELLGLRETGLTGSIPSLIFNISSLLSIILTGNSISGSSIPSTLG 217

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +      L L  N+LTG +P  +     +  L +  N+L GN+P
Sbjct: 218 NLLNLSYLVLELNELTGAIPQEIFNISSLQILSVVKNNLSGNLP 261

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 51/158 (32%), Positives = 82/158 (51%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L    + G L    G L  +   +L  NQL G IP S+    RL  + L+ N ++G I
Sbjct: 80  LRLQKRGLKGTLSPYLGNLSFIVILILQNNQLEGKIPPSISHCRRLEFISLASNWLSGGI 139

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  LG +  L +L L GN++ G IPS+L + + + +L L   G  G+IP +  + S  + 
Sbjct: 140 PEELGILPKLDSLLLGGNNLRGTIPSSLGNISTLELLGLRETGLTGSIPSLIFNISSLLS 199

Query: 399 LDLSFNKLTG-RVPNSLAKAKFMGHLDISNNHLCGNIP 509
           + L+ N ++G  +P++L     + +L +  N L G IP
Sbjct: 200 IILTGNSISGSSIPSTLGNLLNLSYLVLELNELTGAIP 237

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 52/148 (35%), Positives = 77/148 (52%), Gaps = 1/148 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI     L  + L++N + G +P + G L KL   LL  N L GTIP S+  ++ L  
Sbjct: 116 PPSISHCRRLEFISLASNWLSGGIPEELGILPKLDSLLLGGNNLRGTIPSSLGNISTLEL 175

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTG-QIPSTLLSNTGMGILNLSRNGFEGT 359
           L L    +TGSIP  +  +  L ++ L GNS++G  IPSTL +   +  L L  N   G 
Sbjct: 176 LGLRETGLTGSIPSLIFNISSLLSIILTGNSISGSSIPSTLGNLLNLSYLVLELNELTGA 235

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNS 443
           IP    + S   +L +  N L+G +P++
Sbjct: 236 IPQEIFNISSLQILSVVKNNLSGNLPST 263

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 60/196 (30%), Positives = 98/196 (50%), Gaps = 10/196 (5%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGE-LPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  IS L+ + L+ N I G  +PS  G L  LS  +L  N+L G IP  +  ++ L 
Sbjct: 188 PSLIFNISSLLSIILTGNSISGSSIPSTLGNLLNLSYLVLELNELTGAIPQEIFNISSLQ 247

Query: 180 DLDLSMNRITGSIPVRLG-KMRVLSTLKLDGNSMTGQIPS----TLLSNTG-MGILNLSR 341
            L +  N ++G++P   G  +  L  L L GN +    P     T L+N   +  + +  
Sbjct: 248 ILSVVKNNLSGNLPSTTGLGLPNLMVLFLAGNGLKPGRPELSFITALTNCRLLEEITMPN 307

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFN-KLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--I 512
           N   G IP+  G+ S  +   ++F  +L G +P+ +   K +G L++ +N+L GNIP  I
Sbjct: 308 NPLGGIIPNSIGNLSNHVRNIVAFGCQLKGHIPSGIGSLKNLGTLELGDNNLNGNIPSTI 367

Query: 513 GSPFDHLDAASFSNND 560
           G   ++L   +  NN+
Sbjct: 368 GR-LENLQRMNIFNNE 382

[100][TOP]
>UniRef100_A7PVF0 Chromosome chr9 scaffold_33, whole genome shotgun sequence n=1
            Tax=Vitis vinifera RepID=A7PVF0_VITVI
          Length = 1058

 Score =  125 bits (315), Expect = 2e-27
 Identities = 68/191 (35%), Positives = 111/191 (58%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVL-KMNRLA 179
            P S+  +S L +L++SNN + G +P+     + +   LL  N+L G +P++V+   N+L 
Sbjct: 442  PSSLGNLSQLFYLEMSNNNLEGNIPTSLRNCQNMEILLLDHNKLSGGVPENVIGHFNQLR 501

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
             L L  N  TGS+P  +G+++ L+ L +  N ++G+IP+ L S   +  L+++RN F+G 
Sbjct: 502  SLYLQQNTFTGSLPADVGQLKNLNELLVSDNKLSGEIPTELGSCLVLEYLDMARNSFQGN 561

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
            IP  F S      LDLS N L+GR+PN L     +  L++S N+L G +P G  F ++  
Sbjct: 562  IPLSFSSLRGIQFLDLSCNNLSGRIPNELEDLGLLS-LNLSYNYLEGEVPSGGVFKNVSG 620

Query: 540  ASFSNNDCLCG 572
             S + N+ LCG
Sbjct: 621  ISITGNNKLCG 631

 Score =  107 bits (267), Expect = 7e-22
 Identities = 65/165 (39%), Positives = 92/165 (55%), Gaps = 1/165 (0%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  ++ L  L LSNN + G +PSD G LR++    LS N L G IP  +   + L  +DL
Sbjct: 100 IGNLTFLRELVLSNNLLHGTIPSDIGLLRRMRHLNLSTNSLQGEIPIELTNCSNLETVDL 159

Query: 192 SMNRITGSIPVRLGKMRV-LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           + N +TG IP R+G M   L  L+L GN +TG IPSTL + + +  L++S N  EG+IP 
Sbjct: 160 TRNNLTGQIPFRVGNMSTKLLVLRLGGNGLTGVIPSTLGNLSSLQHLSVSFNHLEGSIPH 219

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGN 503
             G      +L LS N L+G +P SL     +    +++N L GN
Sbjct: 220 DLGRLKSLKILYLSVNNLSGTIPPSLYNLSSVIEFAVTDNILSGN 264

 Score =  102 bits (253), Expect = 3e-20
 Identities = 70/193 (36%), Positives = 102/193 (52%), Gaps = 8/193 (4%)
 Frame = +3

Query: 3   PMSIVRISG-LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P SIV +S  L  L L  N+I G +P + G L  L+     +N L G +P SV K+ +L 
Sbjct: 369 PNSIVNLSTQLQALHLGENKIFGNIPEEIGNLINLTTFDAGQNYLTGVVPTSVGKLQKLV 428

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L LS NR++G +P  LG +  L  L++  N++ G IP++L +   M IL L  N   G 
Sbjct: 429 TLRLSWNRLSGLLPSSLGNLSQLFYLEMSNNNLEGNIPTSLRNCQNMEILLLDHNKLSGG 488

Query: 360 IPD-VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS--PF 524
           +P+ V G  +    L L  N  TG +P  + + K +  L +S+N L G IP  +GS    
Sbjct: 489 VPENVIGHFNQLRSLYLQQNTFTGSLPADVGQLKNLNELLVSDNKLSGEIPTELGSCLVL 548

Query: 525 DHLDAA--SFSNN 557
           ++LD A  SF  N
Sbjct: 549 EYLDMARNSFQGN 561

 Score = 96.3 bits (238), Expect = 2e-18
 Identities = 60/158 (37%), Positives = 84/158 (53%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L    + G LP   G L  L   +LS N L GTIP  +  + R+  L+LS N + G I
Sbjct: 86  LRLEGQSLGGSLPP-IGNLTFLRELVLSNNLLHGTIPSDIGLLRRMRHLNLSTNSLQGEI 144

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLS-NTGMGILNLSRNGFEGTIPDVFGSKSYFM 395
           P+ L     L T+ L  N++TGQIP  + + +T + +L L  NG  G IP   G+ S   
Sbjct: 145 PIELTNCSNLETVDLTRNNLTGQIPFRVGNMSTKLLVLRLGGNGLTGVIPSTLGNLSSLQ 204

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L +SFN L G +P+ L + K +  L +S N+L G IP
Sbjct: 205 HLSVSFNHLEGSIPHDLGRLKSLKILYLSVNNLSGTIP 242

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 53/156 (33%), Positives = 83/156 (53%), Gaps = 1/156 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L+ L L  N + G +PS  G L  L    +S N L G+IP  + ++  L  L LS+N ++
Sbjct: 179 LLVLRLGGNGLTGVIPSTLGNLSSLQHLSVSFNHLEGSIPHDLGRLKSLKILYLSVNNLS 238

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           G+IP  L  +  +    +  N ++G   ST+  S   +  L ++ N F G IPD   + S
Sbjct: 239 GTIPPSLYNLSSVIEFAVTDNILSGNFLSTMRFSFPQLRKLGIALNQFTGIIPDTLSNIS 298

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHL 494
              +LDL  N LTG+VP+SL   K +  L++ +N+L
Sbjct: 299 GLELLDLGPNYLTGQVPDSLGVLKDLYWLNVESNNL 334

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 61/195 (31%), Positives = 87/195 (44%), Gaps = 26/195 (13%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMN-RLA 179
           P  I  +  + HL+LS N + GE+P +      L    L+RN L G IP  V  M+ +L 
Sbjct: 121 PSDIGLLRRMRHLNLSTNSLQGEIPIELTNCSNLETVDLTRNNLTGQIPFRVGNMSTKLL 180

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N +TG IP  LG +  L  L +  N + G IP  L     + IL LS N   GT
Sbjct: 181 VLRLGGNGLTGVIPSTLGNLSSLQHLSVSFNHLEGSIPHDLGRLKSLKILYLSVNNLSGT 240

Query: 360 IP---------------DVFGSKSYFMVLDLSF----------NKLTGRVPNSLAKAKFM 464
           IP               D   S ++   +  SF          N+ TG +P++L+    +
Sbjct: 241 IPPSLYNLSSVIEFAVTDNILSGNFLSTMRFSFPQLRKLGIALNQFTGIIPDTLSNISGL 300

Query: 465 GHLDISNNHLCGNIP 509
             LD+  N+L G +P
Sbjct: 301 ELLDLGPNYLTGQVP 315

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 58/225 (25%), Positives = 92/225 (40%), Gaps = 56/225 (24%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMN---- 170
           P ++  +S L HL +S N + G +P D G+L+ L    LS N L GTIP S+  ++    
Sbjct: 194 PSTLGNLSSLQHLSVSFNHLEGSIPHDLGRLKSLKILYLSVNNLSGTIPPSLYNLSSVIE 253

Query: 171 ---------------------RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQ 287
                                +L  L +++N+ TG IP  L  +  L  L L  N +TGQ
Sbjct: 254 FAVTDNILSGNFLSTMRFSFPQLRKLGIALNQFTGIIPDTLSNISGLELLDLGPNYLTGQ 313

Query: 288 IPSTL------------LSNTGMG------------------ILNLSRNGFEGTIPD-VF 374
           +P +L             +N G G                   ++L +N F G +P+ + 
Sbjct: 314 VPDSLGVLKDLYWLNVESNNLGRGTSGDLNFLNSLTNISSLRTISLYQNNFGGVLPNSIV 373

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              +    L L  NK+ G +P  +     +   D   N+L G +P
Sbjct: 374 NLSTQLQALHLGENKIFGNIPEEIGNLINLTTFDAGQNYLTGVVP 418

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 49/139 (35%), Positives = 75/139 (53%), Gaps = 1/139 (0%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           R+   AL    Q +G     +  +  L +L LS N + G+IP  +G +R +  L L  NS
Sbjct: 80  RQRVTALRLEGQSLGGSLPPIGNLTFLRELVLSNNLLHGTIPSDIGLLRRMRHLNLSTNS 139

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS-YFMVLDLSFNKLTGRVPNSLAK 452
           + G+IP  L + + +  ++L+RN   G IP   G+ S   +VL L  N LTG +P++L  
Sbjct: 140 LQGEIPIELTNCSNLETVDLTRNNLTGQIPFRVGNMSTKLLVLRLGGNGLTGVIPSTLGN 199

Query: 453 AKFMGHLDISNNHLCGNIP 509
              + HL +S NHL G+IP
Sbjct: 200 LSSLQHLSVSFNHLEGSIP 218

[101][TOP]
>UniRef100_A7PVE6 Chromosome chr9 scaffold_33, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PVE6_VITVI
          Length = 653

 Score =  125 bits (315), Expect = 2e-27
 Identities = 70/197 (35%), Positives = 110/197 (55%), Gaps = 5/197 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I   S L  LDL NN + G +P   GKL++L    L++N+  G +P S   ++ L  
Sbjct: 377 PSTINNCSNLRILDLGNNGLSGMIPVSLGKLKQLRSLHLNKNKFSGGLPPSFQHLSNLET 436

Query: 183 LDLSMNRITGSIPVRLGK----MRVLS-TLKLDGNSMTGQIPSTLLSNTGMGILNLSRNG 347
           LDLS N+++GSIP  +G     +R+L+ ++ L  N+++G  P  + +  G+ +LNLS+N 
Sbjct: 437 LDLSYNKLSGSIPSWMGAAFSHLRILNLSIDLSHNNLSGDFPKEITNLFGLVVLNLSKNH 496

Query: 348 FEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFD 527
             G IP         +  DLS NKL+G +P S++   F+ +L++SNN+  G IP      
Sbjct: 497 ISGQIPRSIWRLHQLLSFDLSSNKLSGTIPLSMSSLTFLSYLNLSNNNFSGQIPFMGQMT 556

Query: 528 HLDAASFSNNDCLCGNP 578
              A +F+ N  LCG P
Sbjct: 557 TFTATAFAGNPNLCGAP 573

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 71/211 (33%), Positives = 99/211 (46%), Gaps = 28/211 (13%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSD-FGKLRKLSRALLSRNQLI-------------- 137
           P S  ++S L++LD+S N +IG L  + F KL KL   LLS N                 
Sbjct: 255 PDSFGQLSELVYLDVSFNNLIGILSEEKFSKLTKLKYLLLSSNSFTLNVRPIPLPNRGAY 314

Query: 138 ----------GTIPDSVLK-MNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTG 284
                     G IP  + + M  L  L LS N I G+IP  +G M  +  + L  N + G
Sbjct: 315 VLDLSDNKFSGPIPQRIGEFMPELWFLSLSDNEIKGTIPASVGHMWNVEVIDLSRNGLVG 374

Query: 285 QIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFM 464
            IPST+ + + + IL+L  NG  G IP   G       L L+ NK +G +P S      +
Sbjct: 375 SIPSTINNCSNLRILDLGNNGLSGMIPVSLGKLKQLRSLHLNKNKFSGGLPPSFQHLSNL 434

Query: 465 GHLDISNNHLCGNIP--IGSPFDHLDAASFS 551
             LD+S N L G+IP  +G+ F HL   + S
Sbjct: 435 ETLDLSYNKLSGSIPSWMGAAFSHLRILNLS 465

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 58/173 (33%), Positives = 89/173 (51%), Gaps = 4/173 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQII--GELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRL 176
           P+ +  +  L +LDLS N+ +    +P+  G L+ L+   L  N+L GT+PDS  +++ L
Sbjct: 205 PLDLSELPNLQYLDLSGNKNLEGSRIPASLGTLQHLTEMWLGTNRLKGTLPDSFGQLSEL 264

Query: 177 ADLDLSMNRITGSI-PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
             LD+S N + G +   +  K+  L  L L  NS T  +    L N G  +L+LS N F 
Sbjct: 265 VYLDVSFNNLIGILSEEKFSKLTKLKYLLLSSNSFTLNVRPIPLPNRGAYVLDLSDNKFS 324

Query: 354 GTIPDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G IP   G        L LS N++ G +P S+     +  +D+S N L G+IP
Sbjct: 325 GPIPQRIGEFMPELWFLSLSDNEIKGTIPASVGHMWNVEVIDLSRNGLVGSIP 377

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 55/180 (30%), Positives = 92/180 (51%), Gaps = 7/180 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKL-SRALLS--RNQLIGTIPDSVLKMNR 173
           P     +  L +L+LSN+   G +P + G L  L S A+LS  +N      P+ ++ ++ 
Sbjct: 130 PQFFGSLKNLQYLNLSNSGFSGAIPPNLGNLSNLHSLAILSISQNAFNSKFPEWLVNVSS 189

Query: 174 LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMT--GQIPSTLLSNTGMGILNLSRNG 347
           L  +D+S   + G +P+ L ++  L  L L GN      +IP++L +   +  + L  N 
Sbjct: 190 LVSIDISNCELWGRVPLDLSELPNLQYLDLSGNKNLEGSRIPASLGTLQHLTEMWLGTNR 249

Query: 348 FEGTIPDVFGSKSYFMVLDLSFNKLTGRV-PNSLAKAKFMGHLDISNNHLCGNI-PIGSP 521
            +GT+PD FG  S  + LD+SFN L G +     +K   + +L +S+N    N+ PI  P
Sbjct: 250 LKGTLPDSFGQLSELVYLDVSFNNLIGILSEEKFSKLTKLKYLLLSSNSFTLNVRPIPLP 309

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 45/127 (35%), Positives = 67/127 (52%), Gaps = 4/127 (3%)
 Frame = +3

Query: 120 SRNQLIGTIPDSVLKMNRLADLDLSMNRITG-SIPVRLGKMRVLSTLKLDGNSMTGQIPS 296
           S  +L G I  S+ K+  L  LDLS N     SIP   G ++ L  L L  +  +G IP 
Sbjct: 96  SSMKLSGEIRPSLKKLKFLRYLDLSGNSFNDISIPQFFGSLKNLQYLNLSNSGFSGAIPP 155

Query: 297 TL--LSNT-GMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
            L  LSN   + IL++S+N F    P+   + S  + +D+S  +L GRVP  L++   + 
Sbjct: 156 NLGNLSNLHSLAILSISQNAFNSKFPEWLVNVSSLVSIDISNCELWGRVPLDLSELPNLQ 215

Query: 468 HLDISNN 488
           +LD+S N
Sbjct: 216 YLDLSGN 222

[102][TOP]
>UniRef100_A2ZJ30 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2ZJ30_ORYSI
          Length = 856

 Score =  125 bits (314), Expect = 2e-27
 Identities = 69/190 (36%), Positives = 102/190 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  +  +  L L +N + G +P+  G L KL + LLS NQL  TIP S+  +  L  
Sbjct: 297 PSNIGMLMSVEKLYLQSNALSGSIPNGIGNLTKLGKLLLSDNQLSSTIPSSLFHLGSLFQ 356

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N +TG++P  +G ++ ++ L L  N  T  +P ++     +  LNLS N  + +I
Sbjct: 357 LDLSRNLLTGALPADIGYLKQINVLDLSTNRFTSSLPESIGQIQMITYLNLSVNSIQNSI 416

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PD F S +    LDLS N ++G +P  LA    +  L++S N L G IP G  F ++   
Sbjct: 417 PDSFRSLTSLQTLDLSHNNISGTIPKYLANFSILTSLNLSFNKLQGQIPEGGVFSNITLE 476

Query: 543 SFSNNDCLCG 572
           S   N  LCG
Sbjct: 477 SLVGNSRLCG 486

 Score = 96.3 bits (238), Expect = 2e-18
 Identities = 52/169 (30%), Positives = 90/169 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI+ +  L  + L  N++ G +PS+ G L  + +  L  N L G+IP+ +  + +L  
Sbjct: 273 PESIMTMENLQLIQLEENRLSGSIPSNIGMLMSVEKLYLQSNALSGSIPNGIGNLTKLGK 332

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N+++ +IP  L  +  L  L L  N +TG +P+ +     + +L+LS N F  ++
Sbjct: 333 LLLSDNQLSSTIPSSLFHLGSLFQLDLSRNLLTGALPADIGYLKQINVLDLSTNRFTSSL 392

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P+  G       L+LS N +   +P+S      +  LD+S+N++ G IP
Sbjct: 393 PESIGQIQMITYLNLSVNSIQNSIPDSFRSLTSLQTLDLSHNNISGTIP 441

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 55/169 (32%), Positives = 89/169 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  ++ L  LD+S +Q+ G +P     +  L    L  N+L G+IP ++  +  +  
Sbjct: 249 PSSISNLTSLEMLDISESQLQGAIPESIMTMENLQLIQLEENRLSGSIPSNIGMLMSVEK 308

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N ++GSIP  +G +  L  L L  N ++  IPS+L     +  L+LSRN   G +
Sbjct: 309 LYLQSNALSGSIPNGIGNLTKLGKLLLSDNQLSSTIPSSLFHLGSLFQLDLSRNLLTGAL 368

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G      VLDLS N+ T  +P S+ + + + +L++S N +  +IP
Sbjct: 369 PADIGYLKQINVLDLSTNRFTSSLPESIGQIQMITYLNLSVNSIQNSIP 417

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 53/152 (34%), Positives = 80/152 (52%)
 Frame = +3

Query: 54  NQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLG 233
           N++ G +PS    L  L    +S +QL G IP+S++ M  L  + L  NR++GSIP  +G
Sbjct: 242 NRVSGGIPSSISNLTSLEMLDISESQLQGAIPESIMTMENLQLIQLEENRLSGSIPSNIG 301

Query: 234 KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSF 413
            +  +  L L  N+++G IP+ + + T +G L LS N    TIP           LDLS 
Sbjct: 302 MLMSVEKLYLQSNALSGSIPNGIGNLTKLGKLLLSDNQLSSTIPSSLFHLGSLFQLDLSR 361

Query: 414 NKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           N LTG +P  +   K +  LD+S N    ++P
Sbjct: 362 NLLTGALPADIGYLKQINVLDLSTNRFTSSLP 393

 Score = 77.8 bits (190), Expect = 6e-13
 Identities = 55/199 (27%), Positives = 96/199 (48%), Gaps = 28/199 (14%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ I R+S L  LDLS N + G +P+  G L +L    L  N L G I   +  ++ L  
Sbjct: 125 PVDIGRLSLLRILDLSFNALSGGIPAALGNLTRLQLFNLESNGLSGPIMADLRNLHDLRG 184

Query: 183 LDLSMNRITGSIPV---RLGKMRVLSTLKLD-------------------------GNSM 278
           L++  N +TG IP+     G    LS L+++                         GN +
Sbjct: 185 LNIQTNHLTGFIPIGWISAGINWQLSILQINSNYFTGSIPEYVGNLSTTLQAFVAYGNRV 244

Query: 279 TGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAK 458
           +G IPS++ + T + +L++S +  +G IP+   +     ++ L  N+L+G +P+++    
Sbjct: 245 SGGIPSSISNLTSLEMLDISESQLQGAIPESIMTMENLQLIQLEENRLSGSIPSNIGMLM 304

Query: 459 FMGHLDISNNHLCGNIPIG 515
            +  L + +N L G+IP G
Sbjct: 305 SVEKLYLQSNALSGSIPNG 323

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 39/129 (30%), Positives = 67/129 (51%), Gaps = 3/129 (2%)
 Frame = +3

Query: 132 LIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN 311
           L G +   +  ++ L  L+L+   +TGS+PV +G++ +L  L L  N+++G IP+ L + 
Sbjct: 96  LHGGLSPHLGNLSFLTVLNLTKTNLTGSLPVDIGRLSLLRILDLSFNALSGGIPAALGNL 155

Query: 312 TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF---MGHLDIS 482
           T + + NL  NG  G I     +      L++  N LTG +P     A     +  L I+
Sbjct: 156 TRLQLFNLESNGLSGPIMADLRNLHDLRGLNIQTNHLTGFIPIGWISAGINWQLSILQIN 215

Query: 483 NNHLCGNIP 509
           +N+  G+IP
Sbjct: 216 SNYFTGSIP 224

 Score = 58.2 bits (139), Expect = 5e-07
 Identities = 35/118 (29%), Positives = 58/118 (49%)
 Frame = +3

Query: 162 KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
           +  R+  ++L    + G +   LG +  L+ L L   ++TG +P  +   + + IL+LS 
Sbjct: 82  RQQRVTAVELPGVPLHGGLSPHLGNLSFLTVLNLTKTNLTGSLPVDIGRLSLLRILDLSF 141

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           N   G IP   G+ +   + +L  N L+G +   L     +  L+I  NHL G IPIG
Sbjct: 142 NALSGGIPAALGNLTRLQLFNLESNGLSGPIMADLRNLHDLRGLNIQTNHLTGFIPIG 199

[103][TOP]
>UniRef100_A2ZBY8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
            RepID=A2ZBY8_ORYSI
          Length = 1007

 Score =  125 bits (314), Expect = 2e-27
 Identities = 66/190 (34%), Positives = 107/190 (56%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P S+  +S L+ L L +NQ++G +PS FGKL+ L+R  +S N L G++P  + ++  +A+
Sbjct: 432  PSSLSNLSHLVELYLQSNQLLGNIPSSFGKLQFLTRIDISDNSLNGSLPKEIFRIPTIAE 491

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            +  S N ++G +P  +G  + L +L L  N+++G IP+TL +   +  + L +N F G+I
Sbjct: 492  VGFSFNNLSGELPTEVGYAKQLRSLHLSSNNLSGDIPNTLGNCENLQEVVLDQNNFGGSI 551

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P   G       L+LS N L G +P SL   + +  +D+S NHL G +P    F +  A 
Sbjct: 552  PASLGKLISLKSLNLSHNILNGSIPVSLGDLELLEQIDLSFNHLSGQVPTKGIFKNSTAT 611

Query: 543  SFSNNDCLCG 572
                N  LCG
Sbjct: 612  HMDGNLGLCG 621

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 56/168 (33%), Positives = 84/168 (50%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           S+   + L  L ++ NQ+ G LP+  G    +L R  L +NQL G+ P  +  +  L   
Sbjct: 337 SLTNCTQLQALSMAGNQLEGHLPNSVGNSSVQLQRLYLGQNQLSGSFPSGIENLPNLIVF 396

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
            L  NR TGS+P  LG +  L  L L  N+ TG IPS+L + + +  L L  N   G IP
Sbjct: 397 GLDYNRFTGSVPPWLGGLITLQVLSLTNNNFTGYIPSSLSNLSHLVELYLQSNQLLGNIP 456

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             FG   +   +D+S N L G +P  + +   +  +  S N+L G +P
Sbjct: 457 SSFGKLQFLTRIDISDNSLNGSLPKEIFRIPTIAEVGFSFNNLSGELP 504

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 57/176 (32%), Positives = 87/176 (49%), Gaps = 7/176 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIP------DSVLK 164
           P S+   S L+ LD+S N  +G +P+  GKL  L+   L  NQL   I       DS+  
Sbjct: 281 PSSLANASNLVDLDISQNNFVGVVPAFIGKLANLTWLNLEMNQLHARIKQDWDFMDSLTN 340

Query: 165 MNRLADLDLSMNRITGSIPVRLGKMRV-LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
             +L  L ++ N++ G +P  +G   V L  L L  N ++G  PS + +   + +  L  
Sbjct: 341 CTQLQALSMAGNQLEGHLPNSVGNSSVQLQRLYLGQNQLSGSFPSGIENLPNLIVFGLDY 400

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           N F G++P   G      VL L+ N  TG +P+SL+    +  L + +N L GNIP
Sbjct: 401 NRFTGSVPPWLGGLITLQVLSLTNNNFTGYIPSSLSNLSHLVELYLQSNQLLGNIP 456

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 48/169 (28%), Positives = 80/169 (47%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L+   L  N+  G +P   G L  L    L+ N   G IP S+  ++ L +
Sbjct: 384 PSGIENLPNLIVFGLDYNRFTGSVPPWLGGLITLQVLSLTNNNFTGYIPSSLSNLSHLVE 443

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N++ G+IP   GK++ L+ + +  NS+ G +P  +     +  +  S N   G +
Sbjct: 444 LYLQSNQLLGNIPSSFGKLQFLTRIDISDNSLNGSLPKEIFRIPTIAEVGFSFNNLSGEL 503

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G       L LS N L+G +PN+L   + +  + +  N+  G+IP
Sbjct: 504 PTEVGYAKQLRSLHLSSNNLSGDIPNTLGNCENLQEVVLDQNNFGGSIP 552

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 54/157 (34%), Positives = 74/157 (47%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           +DLSN  + G +    G L  L    L+ N+  G IP+S+  + RL  L LS N + G I
Sbjct: 79  IDLSNQNLAGNISPSLGNLTFLKHLSLATNEFTGRIPESLGHLRRLRSLYLSNNTLQGII 138

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P        L  L LD N +TG +P  L    G+  L +S N   GTI    G+ +   +
Sbjct: 139 P-SFANCSDLRVLWLDHNELTGGLPDGL--PLGLEELQVSSNTLVGTITPSLGNVTTLRM 195

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           L  +FN + G +P  LA  + M  L I  N L G  P
Sbjct: 196 LRFAFNGIEGGIPGELAALREMEILTIGGNRLSGGFP 232

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 52/169 (30%), Positives = 80/169 (47%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S+  ++ L HL L+ N+  G +P   G LR+L    LS N L G IP S    + L  L 
Sbjct: 93  SLGNLTFLKHLSLATNEFTGRIPESLGHLRRLRSLYLSNNTLQGIIP-SFANCSDLRVLW 151

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           L  N +TG +P   G    L  L++  N++ G I  +L + T + +L  + NG EG IP 
Sbjct: 152 LDHNELTGGLPD--GLPLGLEELQVSSNTLVGTITPSLGNVTTLRMLRFAFNGIEGGIPG 209

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
              +     +L +  N+L+G  P  +     +  L +  N   G +P G
Sbjct: 210 ELAALREMEILTIGGNRLSGGFPEPIMNMSVLIRLSLETNRFSGKMPSG 258

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 55/168 (32%), Positives = 81/168 (48%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S    S L  L L +N++ G LP   G    L    +S N L+GTI  S+  +  L  L 
Sbjct: 140 SFANCSDLRVLWLDHNELTGGLPD--GLPLGLEELQVSSNTLVGTITPSLGNVTTLRMLR 197

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
            + N I G IP  L  +R +  L + GN ++G  P  +++ + +  L+L  N F G +P 
Sbjct: 198 FAFNGIEGGIPGELAALREMEILTIGGNRLSGGFPEPIMNMSVLIRLSLETNRFSGKMPS 257

Query: 369 VFG-SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             G S      L +  N   G +P+SLA A  +  LDIS N+  G +P
Sbjct: 258 GIGTSLPNLWRLFIGGNFFQGNLPSSLANASNLVDLDISQNNFVGVVP 305

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 45/161 (27%), Positives = 76/161 (47%), Gaps = 1/161 (0%)
 Frame = +3

Query: 27  GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           GL  L +S+N ++G +    G +  L     + N + G IP  +  +  +  L +  NR+
Sbjct: 168 GLEELQVSSNTLVGTITPSLGNVTTLRMLRFAFNGIEGGIPGELAALREMEILTIGGNRL 227

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGTIPDVFGSK 383
           +G  P  +  M VL  L L+ N  +G++PS +  S   +  L +  N F+G +P    + 
Sbjct: 228 SGGFPEPIMNMSVLIRLSLETNRFSGKMPSGIGTSLPNLWRLFIGGNFFQGNLPSSLANA 287

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           S  + LD+S N   G VP  + K   +  L++  N L   I
Sbjct: 288 SNLVDLDISQNNFVGVVPAFIGKLANLTWLNLEMNQLHARI 328

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 41/112 (36%), Positives = 57/112 (50%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  +DLS   + G+I   LG +  L  L L  N  TG+IP +L     +  L LS N  
Sbjct: 75  RVTSIDLSNQNLAGNISPSLGNLTFLKHLSLATNEFTGRIPESLGHLRRLRSLYLSNNTL 134

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           +G IP  F + S   VL L  N+LTG +P+ L     +  L +S+N L G I
Sbjct: 135 QGIIPS-FANCSDLRVLWLDHNELTGGLPDGLPLG--LEELQVSSNTLVGTI 183

[104][TOP]
>UniRef100_UPI0000DD9D3E Os11g0692300 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD9D3E
          Length = 1128

 Score =  125 bits (313), Expect = 3e-27
 Identities = 66/190 (34%), Positives = 107/190 (56%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P +   +  ++ L L +N+I G +P D   L  L   LLS N+L  TIP S+  ++++  
Sbjct: 545  PSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVR 604

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N ++G++PV +G ++ ++ + L  N  +G+IP ++     +  LNLS NGF  ++
Sbjct: 605  LDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSV 664

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            PD FG+ +    LD+S N ++G +PN LA    +  L++S N L G IP G  F ++   
Sbjct: 665  PDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQ 724

Query: 543  SFSNNDCLCG 572
                N  LCG
Sbjct: 725  YLEGNSGLCG 734

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 56/169 (33%), Positives = 86/169 (50%), Gaps = 1/169 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           IS L  L+L+N  + G +P++ G+L +L    L  N + G IP ++  + RL  L+L  N
Sbjct: 113 ISFLFILNLTNTGLAGSVPNEIGRLHRLELLDLGHNAMSGGIPIAIGNLTRLQLLNLQFN 172

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFG 377
           ++ G IP  L  +  L ++ L  N +TG IP  L +NT  +  LN+  N   G IP   G
Sbjct: 173 QLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIG 232

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF 524
           S      L+   N LTG VP ++     +  + + +N L G IP  + F
Sbjct: 233 SLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSF 281

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 59/162 (36%), Positives = 84/162 (51%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L    LSNN++ G LP+    L  L    LS NQL   IP+S++ +  L  LDLS N 
Sbjct: 480 SQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNS 539

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           ++G IP     +R +  L L+ N ++G IP  + + T +  L LS N    TIP      
Sbjct: 540 LSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHL 599

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              + LDLS N L+G +P  +   K +  +D+S+NH  G IP
Sbjct: 600 DKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIP 641

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 49/155 (31%), Positives = 81/155 (52%), Gaps = 1/155 (0%)
 Frame = +3

Query: 48  SNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVR 227
           S + + GEL S  G +  L    L+   L G++P+ + +++RL  LDL  N ++G IP+ 
Sbjct: 98  SASPLQGELSSHLGNISFLFILNLTNTGLAGSVPNEIGRLHRLELLDLGHNAMSGGIPIA 157

Query: 228 LGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFMVLD 404
           +G +  L  L L  N + G IP+ L     +G +NL  N   G+IP D+F +      L+
Sbjct: 158 IGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLN 217

Query: 405 LSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +  N L+G +P  +     + HL+   N+L G +P
Sbjct: 218 VGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVP 252

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 57/173 (32%), Positives = 83/173 (47%), Gaps = 2/173 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I R+  L  LDL +N + G +P   G L +L    L  NQL G IP  +  ++ L  
Sbjct: 131 PNEIGRLHRLELLDLGHNAMSGGIPIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGS 190

Query: 183 LDLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           ++L  N +TGSIP  L     +L+ L +  NS++G IP  + S   +  LN   N   G 
Sbjct: 191 MNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGA 250

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP-NSLAKAKFMGHLDISNNHLCGNIPIG 515
           +P    + S    + L  N LTG +P N+      +    IS N+  G IP+G
Sbjct: 251 VPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLG 303

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 57/162 (35%), Positives = 81/162 (50%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  L +  N I G LP   G L  +L    LS N+L GT+P ++  +  L  +DLS N++
Sbjct: 457 LSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQL 516

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
             +IP  +  +  L  L L GNS++G IPS       +  L L  N   G+IP    + +
Sbjct: 517 RNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLT 576

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               L LS NKLT  +P SL     +  LD+S N L G +P+
Sbjct: 577 NLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPV 618

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 55/197 (27%), Positives = 91/197 (46%), Gaps = 28/197 (14%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQI-IGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  + R++ L  + L  N    G +P++   L  L+   L+   L G IP  +  + +L+
Sbjct: 325 PPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLS 384

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE-- 353
            L L+MN++TG IP  LG +  L+ L L GN + G +PST+ S   +  ++++ N     
Sbjct: 385 WLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGD 444

Query: 354 ------------------------GTIPDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAK 458
                                   G +PD  G+  S      LS NKLTG +P +++   
Sbjct: 445 LNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLT 504

Query: 459 FMGHLDISNNHLCGNIP 509
            +  +D+S+N L   IP
Sbjct: 505 ALEVIDLSHNQLRNAIP 521

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 50/171 (29%), Positives = 80/171 (46%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  +S L  + L +N + G +P +    L  L    +S+N   G IP  +     L 
Sbjct: 252 PPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQ 311

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSM-TGQIPSTLLSNTGMGILNLSRNGFEG 356
            + +  N   G +P  LG++  L  + L GN+   G IP+ L + T + +L+L+     G
Sbjct: 312 VIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTG 371

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            IP   G       L L+ N+LTG +P SL     +  L +  N L G++P
Sbjct: 372 NIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLP 422

[105][TOP]
>UniRef100_Q5QMC8 Putative uncharacterized protein P0516D04.31 n=1 Tax=Oryza sativa
            Japonica Group RepID=Q5QMC8_ORYSJ
          Length = 1040

 Score =  125 bits (313), Expect = 3e-27
 Identities = 75/215 (34%), Positives = 105/215 (48%), Gaps = 25/215 (11%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P SI  ++ L+ LDLSNNQ+ G +P   G + +L+   LS N+L+ +IPD +  +  L D
Sbjct: 439  PFSIGNLTQLLTLDLSNNQLNGSIPKSLGSMERLTNLDLSSNRLVESIPDVIFSLPSLTD 498

Query: 183  -------------------------LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQ 287
                                     L LS N ++G IP  LG    L  L LD N  TG 
Sbjct: 499  SLLLSDNYLSGALPPKVGNLRRATTLSLSRNNLSGKIPTTLGDCASLVYLALDSNHFTGS 558

Query: 288  IPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
            IP +L +  G+ ILNL+RN   G+IP    +      L L+ N L+G +P  L K+  + 
Sbjct: 559  IPPSLGNLRGLSILNLTRNALSGSIPQQLSNIHGLQQLYLAHNNLSGTIPQFLEKSSALI 618

Query: 468  HLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
             LD+S NHL G +P    F ++   S   N  LCG
Sbjct: 619  ELDLSYNHLSGEVPSHGLFANMSGFSVLGNYALCG 653

 Score =  105 bits (262), Expect = 3e-21
 Identities = 59/170 (34%), Positives = 88/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  + G+  L+   N + G++P D G+LR L    L+ N + G IP S+  + +L  
Sbjct: 391 PPGIGSLKGIEDLEFQGNNLFGDIPGDIGRLRNLKVLWLNMNNMSGGIPFSIGNLTQLLT 450

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGM-GILNLSRNGFEGT 359
           LDLS N++ GSIP  LG M  L+ L L  N +   IP  + S   +   L LS N   G 
Sbjct: 451 LDLSNNQLNGSIPKSLGSMERLTNLDLSSNRLVESIPDVIFSLPSLTDSLLLSDNYLSGA 510

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+      L LS N L+G++P +L     + +L + +NH  G+IP
Sbjct: 511 LPPKVGNLRRATTLSLSRNNLSGKIPTTLGDCASLVYLALDSNHFTGSIP 560

 Score =  104 bits (260), Expect = 4e-21
 Identities = 63/154 (40%), Positives = 81/154 (52%)
 Frame = +3

Query: 45  LSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPV 224
           LS+N + G LP   G LR+ +   LSRN L G IP ++     L  L L  N  TGSIP 
Sbjct: 502 LSDNYLSGALPPKVGNLRRATTLSLSRNNLSGKIPTTLGDCASLVYLALDSNHFTGSIPP 561

Query: 225 RLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLD 404
            LG +R LS L L  N+++G IP  L +  G+  L L+ N   GTIP      S  + LD
Sbjct: 562 SLGNLRGLSILNLTRNALSGSIPQQLSNIHGLQQLYLAHNNLSGTIPQFLEKSSALIELD 621

Query: 405 LSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           LS+N L+G VP+    A   G   + N  LCG I
Sbjct: 622 LSYNHLSGEVPSHGLFANMSGFSVLGNYALCGGI 655

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 55/162 (33%), Positives = 89/162 (54%), Gaps = 2/162 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKL-RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  +DLS+N + G LPS    L R +    +++NQ+ G IP  +  +  + DL+   N +
Sbjct: 351 LQVIDLSDNTLGGILPSFIANLSRSIQWLSMAKNQISGIIPPGIGSLKGIEDLEFQGNNL 410

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
            G IP  +G++R L  L L+ N+M+G IP ++ + T +  L+LS N   G+IP   GS  
Sbjct: 411 FGDIPGDIGRLRNLKVLWLNMNNMSGGIPFSIGNLTQLLTLDLSNNQLNGSIPKSLGSME 470

Query: 387 YFMVLDLSFNKLTGRVPNSL-AKAKFMGHLDISNNHLCGNIP 509
               LDLS N+L   +P+ + +       L +S+N+L G +P
Sbjct: 471 RLTNLDLSSNRLVESIPDVIFSLPSLTDSLLLSDNYLSGALP 512

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 51/172 (29%), Positives = 84/172 (48%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ +   S L+ L +  N++ G +PS  G L +L    L  N L GT+P S+  +  L  
Sbjct: 142 PVGLCNCSNLVFLSVEANELHGAIPSCLGSLLQLKVLYLGENNLTGTVPPSLGNLTMLLQ 201

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           + L  N++ G+IP  L  +R L  ++   NS++G +P    + + +  L  S N   G +
Sbjct: 202 IALYQNQLEGTIPEGLSGLRYLQYIQASRNSLSGTLPPLFFNISSLQYLGFSSNKLHGRL 261

Query: 363 PDVFGSK-SYFMVLDLS--FNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G++     VL L    N  +G +P SL+ A  +  L ++ N   G IP
Sbjct: 262 PPDAGTRLPNLQVLRLGGIGNNFSGTIPASLSNATEIQVLGLARNSFEGRIP 313

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 62/204 (30%), Positives = 96/204 (47%), Gaps = 33/204 (16%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ L+ + L  NQ+ G +P     LR L     SRN L GT+P     ++ L  
Sbjct: 190 PPSLGNLTMLLQIALYQNQLEGTIPEGLSGLRYLQYIQASRNSLSGTLPPLFFNISSLQY 249

Query: 183 LDLSMNRITGSIPVRLG-KMRVLSTLKLDG--NSMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L  S N++ G +P   G ++  L  L+L G  N+ +G IP++L + T + +L L+RN FE
Sbjct: 250 LGFSSNKLHGRLPPDAGTRLPNLQVLRLGGIGNNFSGTIPASLSNATEIQVLGLARNSFE 309

Query: 354 GTIPDVFGS-----------------------KSYF------MVLDLSFNKLTGRVPNSL 446
           G IP   G                          YF       V+DLS N L G +P+ +
Sbjct: 310 GRIPPEIGKLCPVSVQMGSNKLQANDAGDWEFLRYFTNCTRLQVIDLSDNTLGGILPSFI 369

Query: 447 AK-AKFMGHLDISNNHLCGNIPIG 515
           A  ++ +  L ++ N + G IP G
Sbjct: 370 ANLSRSIQWLSMAKNQISGIIPPG 393

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 50/166 (30%), Positives = 81/166 (48%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  ++ L  LDL NN + G++     +L +L    L+ N   G +P  +   + L  L +
Sbjct: 98  IGNLTFLQSLDLFNNTLSGDVYFT-SQLHRLHYLELAYNDFSGDLPVGLCNCSNLVFLSV 156

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
             N + G+IP  LG +  L  L L  N++TG +P +L + T +  + L +N  EGTIP+ 
Sbjct: 157 EANELHGAIPSCLGSLLQLKVLYLGENNLTGTVPPSLGNLTMLLQIALYQNQLEGTIPEG 216

Query: 372 FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                Y   +  S N L+G +P        + +L  S+N L G +P
Sbjct: 217 LSGLRYLQYIQASRNSLSGTLPPLFFNISSLQYLGFSSNKLHGRLP 262

[106][TOP]
>UniRef100_Q53K01 Leucine Rich Repeat, putative n=1 Tax=Oryza sativa Japonica Group
            RepID=Q53K01_ORYSJ
          Length = 1043

 Score =  125 bits (313), Expect = 3e-27
 Identities = 66/190 (34%), Positives = 107/190 (56%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P +   +  ++ L L +N+I G +P D   L  L   LLS N+L  TIP S+  ++++  
Sbjct: 485  PSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVR 544

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N ++G++PV +G ++ ++ + L  N  +G+IP ++     +  LNLS NGF  ++
Sbjct: 545  LDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSV 604

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            PD FG+ +    LD+S N ++G +PN LA    +  L++S N L G IP G  F ++   
Sbjct: 605  PDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQ 664

Query: 543  SFSNNDCLCG 572
                N  LCG
Sbjct: 665  YLEGNSGLCG 674

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 59/162 (36%), Positives = 84/162 (51%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L    LSNN++ G LP+    L  L    LS NQL   IP+S++ +  L  LDLS N 
Sbjct: 420 SQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNS 479

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           ++G IP     +R +  L L+ N ++G IP  + + T +  L LS N    TIP      
Sbjct: 480 LSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHL 539

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              + LDLS N L+G +P  +   K +  +D+S+NH  G IP
Sbjct: 540 DKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIP 581

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 57/162 (35%), Positives = 81/162 (50%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  L +  N I G LP   G L  +L    LS N+L GT+P ++  +  L  +DLS N++
Sbjct: 397 LSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQL 456

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
             +IP  +  +  L  L L GNS++G IPS       +  L L  N   G+IP    + +
Sbjct: 457 RNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLT 516

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               L LS NKLT  +P SL     +  LD+S N L G +P+
Sbjct: 517 NLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPV 558

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 55/168 (32%), Positives = 81/168 (48%), Gaps = 2/168 (1%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           R+  L  LDL +N + G +P   G L +L    L  NQL G IP  +  ++ L  ++L  
Sbjct: 76  RLHRLELLDLGHNAMSGGIPIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRH 135

Query: 198 NRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVF 374
           N +TGSIP  L     +L+ L +  NS++G IP  + S   +  LN   N   G +P   
Sbjct: 136 NYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAI 195

Query: 375 GSKSYFMVLDLSFNKLTGRVP-NSLAKAKFMGHLDISNNHLCGNIPIG 515
            + S    + L  N LTG +P N+      +    IS N+  G IP+G
Sbjct: 196 FNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLG 243

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 48/147 (32%), Positives = 72/147 (48%), Gaps = 1/147 (0%)
 Frame = +3

Query: 87  GKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLD 266
           G+L +L    L  N + G IP ++  + RL  L+L  N++ G IP  L  +  L ++ L 
Sbjct: 75  GRLHRLELLDLGHNAMSGGIPIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLR 134

Query: 267 GNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNS 443
            N +TG IP  L +NT  +  LN+  N   G IP   GS      L+   N LTG VP +
Sbjct: 135 HNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPA 194

Query: 444 LAKAKFMGHLDISNNHLCGNIPIGSPF 524
           +     +  + + +N L G IP  + F
Sbjct: 195 IFNMSKLSTISLISNGLTGPIPGNTSF 221

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 54/193 (27%), Positives = 96/193 (49%), Gaps = 7/193 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P++I  ++ L  L+L  NQ+ G +P++   L  L    L  N L G+IPD +     L  
Sbjct: 95  PIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLT 154

Query: 183 -LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L++  N ++G IP  +G + +L  L    N++TG +P  + + + +  ++L  NG  G 
Sbjct: 155 YLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGP 214

Query: 360 IPDVFGSKSYFMVL----DLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSP 521
           IP   G+ S+ + +     +S N   G++P  LA   ++  + +  N   G +P  +G  
Sbjct: 215 IP---GNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQVIAMPYNLFEGVLPPWLGR- 270

Query: 522 FDHLDAASFSNND 560
             +LDA S   N+
Sbjct: 271 LTNLDAISLGGNN 283

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 55/197 (27%), Positives = 91/197 (46%), Gaps = 28/197 (14%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQI-IGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  + R++ L  + L  N    G +P++   L  L+   L+   L G IP  +  + +L+
Sbjct: 265 PPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLS 324

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE-- 353
            L L+MN++TG IP  LG +  L+ L L GN + G +PST+ S   +  ++++ N     
Sbjct: 325 WLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGD 384

Query: 354 ------------------------GTIPDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAK 458
                                   G +PD  G+  S      LS NKLTG +P +++   
Sbjct: 385 LNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLT 444

Query: 459 FMGHLDISNNHLCGNIP 509
            +  +D+S+N L   IP
Sbjct: 445 ALEVIDLSHNQLRNAIP 461

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 50/171 (29%), Positives = 80/171 (46%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  +S L  + L +N + G +P +    L  L    +S+N   G IP  +     L 
Sbjct: 192 PPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQ 251

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSM-TGQIPSTLLSNTGMGILNLSRNGFEG 356
            + +  N   G +P  LG++  L  + L GN+   G IP+ L + T + +L+L+     G
Sbjct: 252 VIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTG 311

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            IP   G       L L+ N+LTG +P SL     +  L +  N L G++P
Sbjct: 312 NIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLP 362

[107][TOP]
>UniRef100_Q2QZC1 Leucine Rich Repeat family protein n=1 Tax=Oryza sativa Japonica
            Group RepID=Q2QZC1_ORYSJ
          Length = 1001

 Score =  125 bits (313), Expect = 3e-27
 Identities = 66/190 (34%), Positives = 107/190 (56%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P +   +  ++ L L +N+I G +P D   L  L   LLS N+L  TIP S+  ++++  
Sbjct: 484  PSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVR 543

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N ++G++PV +G ++ ++ + L  N  +G+IP ++     +  LNLS NGF  ++
Sbjct: 544  LDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSV 603

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            PD FG+ +    LD+S N ++G +PN LA    +  L++S N L G IP G  F ++   
Sbjct: 604  PDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQ 663

Query: 543  SFSNNDCLCG 572
                N  LCG
Sbjct: 664  YLEGNSGLCG 673

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 56/169 (33%), Positives = 86/169 (50%), Gaps = 1/169 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           IS L  L+L+N  + G +P++ G+L +L    L  N + G IP ++  + RL  L+L  N
Sbjct: 52  ISFLFILNLTNTGLAGSVPNEIGRLHRLELLDLGHNAMSGGIPIAIGNLTRLQLLNLQFN 111

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFG 377
           ++ G IP  L  +  L ++ L  N +TG IP  L +NT  +  LN+  N   G IP   G
Sbjct: 112 QLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIG 171

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF 524
           S      L+   N LTG VP ++     +  + + +N L G IP  + F
Sbjct: 172 SLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSF 220

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 59/162 (36%), Positives = 84/162 (51%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L    LSNN++ G LP+    L  L    LS NQL   IP+S++ +  L  LDLS N 
Sbjct: 419 SQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNS 478

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           ++G IP     +R +  L L+ N ++G IP  + + T +  L LS N    TIP      
Sbjct: 479 LSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHL 538

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              + LDLS N L+G +P  +   K +  +D+S+NH  G IP
Sbjct: 539 DKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIP 580

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 49/155 (31%), Positives = 81/155 (52%), Gaps = 1/155 (0%)
 Frame = +3

Query: 48  SNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVR 227
           S + + GEL S  G +  L    L+   L G++P+ + +++RL  LDL  N ++G IP+ 
Sbjct: 37  SASPLQGELSSHLGNISFLFILNLTNTGLAGSVPNEIGRLHRLELLDLGHNAMSGGIPIA 96

Query: 228 LGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFMVLD 404
           +G +  L  L L  N + G IP+ L     +G +NL  N   G+IP D+F +      L+
Sbjct: 97  IGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLN 156

Query: 405 LSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +  N L+G +P  +     + HL+   N+L G +P
Sbjct: 157 VGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVP 191

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 57/173 (32%), Positives = 83/173 (47%), Gaps = 2/173 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I R+  L  LDL +N + G +P   G L +L    L  NQL G IP  +  ++ L  
Sbjct: 70  PNEIGRLHRLELLDLGHNAMSGGIPIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGS 129

Query: 183 LDLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           ++L  N +TGSIP  L     +L+ L +  NS++G IP  + S   +  LN   N   G 
Sbjct: 130 MNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGA 189

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP-NSLAKAKFMGHLDISNNHLCGNIPIG 515
           +P    + S    + L  N LTG +P N+      +    IS N+  G IP+G
Sbjct: 190 VPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLG 242

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 57/162 (35%), Positives = 81/162 (50%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  L +  N I G LP   G L  +L    LS N+L GT+P ++  +  L  +DLS N++
Sbjct: 396 LSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQL 455

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
             +IP  +  +  L  L L GNS++G IPS       +  L L  N   G+IP    + +
Sbjct: 456 RNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLT 515

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               L LS NKLT  +P SL     +  LD+S N L G +P+
Sbjct: 516 NLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPV 557

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 55/197 (27%), Positives = 91/197 (46%), Gaps = 28/197 (14%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQI-IGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  + R++ L  + L  N    G +P++   L  L+   L+   L G IP  +  + +L+
Sbjct: 264 PPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLS 323

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE-- 353
            L L+MN++TG IP  LG +  L+ L L GN + G +PST+ S   +  ++++ N     
Sbjct: 324 WLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGD 383

Query: 354 ------------------------GTIPDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAK 458
                                   G +PD  G+  S      LS NKLTG +P +++   
Sbjct: 384 LNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLT 443

Query: 459 FMGHLDISNNHLCGNIP 509
            +  +D+S+N L   IP
Sbjct: 444 ALEVIDLSHNQLRNAIP 460

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 50/171 (29%), Positives = 80/171 (46%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  +S L  + L +N + G +P +    L  L    +S+N   G IP  +     L 
Sbjct: 191 PPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQ 250

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSM-TGQIPSTLLSNTGMGILNLSRNGFEG 356
            + +  N   G +P  LG++  L  + L GN+   G IP+ L + T + +L+L+     G
Sbjct: 251 VIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTG 310

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            IP   G       L L+ N+LTG +P SL     +  L +  N L G++P
Sbjct: 311 NIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLP 361

[108][TOP]
>UniRef100_Q00KZ8 Bacterial blight resistance protein XA26 n=2 Tax=Oryza sativa
            RepID=Q00KZ8_ORYSJ
          Length = 1103

 Score =  125 bits (313), Expect = 3e-27
 Identities = 66/190 (34%), Positives = 107/190 (56%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P +   +  ++ L L +N+I G +P D   L  L   LLS N+L  TIP S+  ++++  
Sbjct: 541  PSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVR 600

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N ++G++PV +G ++ ++ + L  N  +G+IP ++     +  LNLS NGF  ++
Sbjct: 601  LDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSV 660

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            PD FG+ +    LD+S N ++G +PN LA    +  L++S N L G IP G  F ++   
Sbjct: 661  PDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQ 720

Query: 543  SFSNNDCLCG 572
                N  LCG
Sbjct: 721  YLEGNSGLCG 730

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 57/169 (33%), Positives = 86/169 (50%), Gaps = 1/169 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           IS L  L+L+N  + G +P+  G+LR+L    L  N + G IP ++  + RL  L+L  N
Sbjct: 109 ISFLFILNLTNTGLTGSVPNKIGRLRRLELLDLGHNAMSGGIPAAIGNLTRLQLLNLQFN 168

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFG 377
           ++ G IP  L  +  L ++ L  N +TG IP  L +NT  +  LN+  N   G IP   G
Sbjct: 169 QLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIG 228

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF 524
           S      L+   N LTG VP ++     +  + + +N L G IP  + F
Sbjct: 229 SLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSF 277

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 59/162 (36%), Positives = 84/162 (51%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L    LSNN++ G LP+    L  L    LS NQL   IP+S++ +  L  LDLS N 
Sbjct: 476 SQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNS 535

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           ++G IP     +R +  L L+ N ++G IP  + + T +  L LS N    TIP      
Sbjct: 536 LSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHL 595

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              + LDLS N L+G +P  +   K +  +D+S+NH  G IP
Sbjct: 596 DKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIP 637

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 51/158 (32%), Positives = 81/158 (51%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+L N  + GEL S  G +  L    L+   L G++P+ + ++ RL  LDL  N ++G I
Sbjct: 91  LELPNVPLQGELSSHLGNISFLFILNLTNTGLTGSVPNKIGRLRRLELLDLGHNAMSGGI 150

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFM 395
           P  +G +  L  L L  N + G IP+ L     +G +NL  N   G+IP D+F +     
Sbjct: 151 PAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLT 210

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L++  N L+G +P  +     + HL+   N+L G +P
Sbjct: 211 YLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVP 248

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 57/173 (32%), Positives = 84/173 (48%), Gaps = 2/173 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I R+  L  LDL +N + G +P+  G L +L    L  NQL G IP  +  ++ L  
Sbjct: 127 PNKIGRLRRLELLDLGHNAMSGGIPAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGS 186

Query: 183 LDLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           ++L  N +TGSIP  L     +L+ L +  NS++G IP  + S   +  LN   N   G 
Sbjct: 187 MNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGA 246

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP-NSLAKAKFMGHLDISNNHLCGNIPIG 515
           +P    + S    + L  N LTG +P N+      +    IS N+  G IP+G
Sbjct: 247 VPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLG 299

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 57/162 (35%), Positives = 81/162 (50%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  L +  N I G LP   G L  +L    LS N+L GT+P ++  +  L  +DLS N++
Sbjct: 453 LSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQL 512

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
             +IP  +  +  L  L L GNS++G IPS       +  L L  N   G+IP    + +
Sbjct: 513 RNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLT 572

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               L LS NKLT  +P SL     +  LD+S N L G +P+
Sbjct: 573 NLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPV 614

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 55/197 (27%), Positives = 91/197 (46%), Gaps = 28/197 (14%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQI-IGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  + R++ L  + L  N    G +P++   L  L+   L+   L G IP  +  + +L+
Sbjct: 321 PPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLS 380

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE-- 353
            L L+MN++TG IP  LG +  L+ L L GN + G +PST+ S   +  ++++ N     
Sbjct: 381 WLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGD 440

Query: 354 ------------------------GTIPDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAK 458
                                   G +PD  G+  S      LS NKLTG +P +++   
Sbjct: 441 LNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLT 500

Query: 459 FMGHLDISNNHLCGNIP 509
            +  +D+S+N L   IP
Sbjct: 501 ALEVIDLSHNQLRNAIP 517

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 50/171 (29%), Positives = 80/171 (46%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  +S L  + L +N + G +P +    L  L    +S+N   G IP  +     L 
Sbjct: 248 PPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQ 307

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSM-TGQIPSTLLSNTGMGILNLSRNGFEG 356
            + +  N   G +P  LG++  L  + L GN+   G IP+ L + T + +L+L+     G
Sbjct: 308 VIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTG 367

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            IP   G       L L+ N+LTG +P SL     +  L +  N L G++P
Sbjct: 368 NIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLP 418

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 33/116 (28%), Positives = 59/116 (50%)
 Frame = +3

Query: 162 KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
           +  R+  L+L    + G +   LG +  L  L L    +TG +P+ +     + +L+L  
Sbjct: 84  RRQRVTALELPNVPLQGELSSHLGNISFLFILNLTNTGLTGSVPNKIGRLRRLELLDLGH 143

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           N   G IP   G+ +   +L+L FN+L G +P  L     +G +++ +N+L G+IP
Sbjct: 144 NAMSGGIPAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIP 199

[109][TOP]
>UniRef100_C5YQ51 Putative uncharacterized protein Sb08g000770 n=1 Tax=Sorghum bicolor
            RepID=C5YQ51_SORBI
          Length = 1100

 Score =  125 bits (313), Expect = 3e-27
 Identities = 67/190 (35%), Positives = 102/190 (53%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  +  L  L L +NQ+ G +P   G L +L    LS+N+L  TIP S+  ++ L  
Sbjct: 535  PEQLCVLGSLEQLVLHDNQLSGSIPDQIGNLSELIYLDLSQNRLSSTIPASLFHLDSLVQ 594

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDL  N + G++PV++G ++ +S + L  N   G +P +      +  LNLS N F  ++
Sbjct: 595  LDLYQNSLNGALPVQIGSLKQISIIDLSSNIFVGSLPGSFGQLQTLTNLNLSHNSFNDSV 654

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            PD +G+      LDLS+N L+G +P  LAK   +  L++S N L G IP G  F ++   
Sbjct: 655  PDSYGNLRSLKSLDLSYNDLSGTIPGYLAKLTELAILNLSFNELHGQIPEGGVFANITLQ 714

Query: 543  SFSNNDCLCG 572
            S   N  LCG
Sbjct: 715  SLIGNSALCG 724

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 58/162 (35%), Positives = 85/162 (52%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKL-RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L+HLD+  N   G +P   G L R+LS     RN L G +P ++  ++ L  +DLS N +
Sbjct: 447 LLHLDVGLNHFTGRIPDYIGNLSRQLSFFFADRNNLTGELPATMSNLSSLNWIDLSENHL 506

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           + SIP  +  M  L  + L GN ++G IP  L     +  L L  N   G+IPD  G+ S
Sbjct: 507 SSSIPKSIMMMNKLLNMYLYGNRLSGPIPEQLCVLGSLEQLVLHDNQLSGSIPDQIGNLS 566

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
             + LDLS N+L+  +P SL     +  LD+  N L G +P+
Sbjct: 567 ELIYLDLSQNRLSSTIPASLFHLDSLVQLDLYQNSLNGALPV 608

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 56/186 (30%), Positives = 82/186 (44%), Gaps = 26/186 (13%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADL-------- 185
           L +L+L NN + G +P   G L  L    L  NQL+GT+P ++  M+ L  L        
Sbjct: 203 LSYLNLDNNSLSGTIPHSIGSLPMLQALGLQANQLLGTVPQAIFNMSTLQLLYLGGNYNL 262

Query: 186 ------------------DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN 311
                              L  N  TG +P  L + + L  L L  NS  G +P+ L + 
Sbjct: 263 EGPIPGNKSFSLPMLQIIALQSNSFTGKLPQGLSECQYLQVLSLADNSFDGPVPTWLANL 322

Query: 312 TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
             +  + LS N   G IP V  + +  ++LDLSF  LTG +P    +   +  L +S+N 
Sbjct: 323 PELADIELSGNNLNGPIPPVLSNLTNLVILDLSFGNLTGEIPPEFGQLSQLTVLALSHNK 382

Query: 492 LCGNIP 509
           L G  P
Sbjct: 383 LTGPFP 388

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 51/152 (33%), Positives = 81/152 (53%)
 Frame = +3

Query: 54  NQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLG 233
           N + GELP+    L  L+   LS N L  +IP S++ MN+L ++ L  NR++G IP +L 
Sbjct: 480 NNLTGELPATMSNLSSLNWIDLSENHLSSSIPKSIMMMNKLLNMYLYGNRLSGPIPEQLC 539

Query: 234 KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSF 413
            +  L  L L  N ++G IP  + + + +  L+LS+N    TIP         + LDL  
Sbjct: 540 VLGSLEQLVLHDNQLSGSIPDQIGNLSELIYLDLSQNRLSSTIPASLFHLDSLVQLDLYQ 599

Query: 414 NKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           N L G +P  +   K +  +D+S+N   G++P
Sbjct: 600 NSLNGALPVQIGSLKQISIIDLSSNIFVGSLP 631

 Score = 84.7 bits (208), Expect = 5e-15
 Identities = 57/170 (33%), Positives = 86/170 (50%), Gaps = 2/170 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  ++L+N  + G +PSD G+L +L    LS N L  T+P ++  +  L  L+L  N
Sbjct: 104 LSFLAVVNLTNTGLTGSIPSDIGRLHRLRSLDLSYNTL-STLPSAMGNLTSLQILELYNN 162

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFG 377
            I+G+IP  L  +  L  +    N ++G IP +L ++T  +  LNL  N   GTIP   G
Sbjct: 163 SISGTIPEELHGLHNLRYMNFQKNFLSGSIPESLFNSTPLLSYLNLDNNSLSGTIPHSIG 222

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH-LCGNIPIGSPF 524
           S      L L  N+L G VP ++     +  L +  N+ L G IP    F
Sbjct: 223 SLPMLQALGLQANQLLGTVPQAIFNMSTLQLLYLGGNYNLEGPIPGNKSF 272

 Score = 84.7 bits (208), Expect = 5e-15
 Identities = 51/175 (29%), Positives = 91/175 (52%), Gaps = 6/175 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++  ++ L  L+L NN I G +P +   L  L      +N L G+IP+S+     L  
Sbjct: 145 PSAMGNLTSLQILELYNNSISGTIPEELHGLHNLRYMNFQKNFLSGSIPESLFNSTPLLS 204

Query: 183 -LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRN-GFEG 356
            L+L  N ++G+IP  +G + +L  L L  N + G +P  + + + + +L L  N   EG
Sbjct: 205 YLNLDNNSLSGTIPHSIGSLPMLQALGLQANQLLGTVPQAIFNMSTLQLLYLGGNYNLEG 264

Query: 357 TIPDVFGSKSY----FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            IP   G+KS+      ++ L  N  TG++P  L++ +++  L +++N   G +P
Sbjct: 265 PIP---GNKSFSLPMLQIIALQSNSFTGKLPQGLSECQYLQVLSLADNSFDGPVP 316

 Score = 84.7 bits (208), Expect = 5e-15
 Identities = 54/171 (31%), Positives = 80/171 (46%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +     L  L L++N   G +P+    L +L+   LS N L G IP  +  +  L  
Sbjct: 292 PQGLSECQYLQVLSLADNSFDGPVPTWLANLPELADIELSGNNLNGPIPPVLSNLTNLVI 351

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS   +TG IP   G++  L+ L L  N +TG  PS   + + +  + L  N   G +
Sbjct: 352 LDLSFGNLTGEIPPEFGQLSQLTVLALSHNKLTGPFPSFASNLSELSYIQLGANRLSGFL 411

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
           P   GS    + + L  N L G +    SL+  + + HLD+  NH  G IP
Sbjct: 412 PITLGSTGSLVSVVLYDNYLEGNLNFLASLSNCRQLLHLDVGLNHFTGRIP 462

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 49/158 (31%), Positives = 82/158 (51%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+L    + GE+    G L  L+   L+   L G+IP  + +++RL  LDLS N ++ ++
Sbjct: 86  LELPEIPLQGEVTPHLGNLSFLAVVNLTNTGLTGSIPSDIGRLHRLRSLDLSYNTLS-TL 144

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD-VFGSKSYFM 395
           P  +G +  L  L+L  NS++G IP  L     +  +N  +N   G+IP+ +F S     
Sbjct: 145 PSAMGNLTSLQILELYNNSISGTIPEELHGLHNLRYMNFQKNFLSGSIPESLFNSTPLLS 204

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L+L  N L+G +P+S+     +  L +  N L G +P
Sbjct: 205 YLNLDNNSLSGTIPHSIGSLPMLQALGLQANQLLGTVP 242

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 45/159 (28%), Positives = 76/159 (47%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  + L +N   G+LP    + + L    L+ N   G +P  +  +  LAD++LS N + 
Sbjct: 277 LQIIALQSNSFTGKLPQGLSECQYLQVLSLADNSFDGPVPTWLANLPELADIELSGNNLN 336

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G IP  L  +  L  L L   ++TG+IP      + + +L LS N   G  P    + S 
Sbjct: 337 GPIPPVLSNLTNLVILDLSFGNLTGEIPPEFGQLSQLTVLALSHNKLTGPFPSFASNLSE 396

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
              + L  N+L+G +P +L     +  + + +N+L GN+
Sbjct: 397 LSYIQLGANRLSGFLPITLGSTGSLVSVVLYDNYLEGNL 435

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 49/205 (23%), Positives = 85/205 (41%), Gaps = 19/205 (9%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQL------IGT------- 143
           P  ++    + HL  ++  +     +D G    LS  L  + QL      +GT       
Sbjct: 7   PCILITALSIFHLQQASIVVSAFSANDTGSATDLSALLAFKTQLSDPLDILGTNWTTKTS 66

Query: 144 ------IPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLL 305
                 +  S     R+  L+L    + G +   LG +  L+ + L    +TG IPS + 
Sbjct: 67  FCQWLGVSCSHRHWQRVVALELPEIPLQGEVTPHLGNLSFLAVVNLTNTGLTGSIPSDIG 126

Query: 306 SNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISN 485
               +  L+LS N    T+P   G+ +   +L+L  N ++G +P  L     + +++   
Sbjct: 127 RLHRLRSLDLSYNTL-STLPSAMGNLTSLQILELYNNSISGTIPEELHGLHNLRYMNFQK 185

Query: 486 NHLCGNIPIGSPFDHLDAASFSNND 560
           N L G+IP  S F+     S+ N D
Sbjct: 186 NFLSGSIP-ESLFNSTPLLSYLNLD 209

[110][TOP]
>UniRef100_B9SWC8 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus
            communis RepID=B9SWC8_RICCO
          Length = 1043

 Score =  125 bits (313), Expect = 3e-27
 Identities = 64/190 (33%), Positives = 109/190 (57%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  +  L +L L  N + G++PS  G +  L    +  N+   TIP ++ ++  + +
Sbjct: 487  PYELCDLQSLAYLYLEVNALSGQIPSCLGNVNSLRTLSMGMNKFSSTIPSTLWRLADILE 546

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N ++GS+ V +G ++ ++ + L GN ++G IPS++     +  L+L+ N  EG+I
Sbjct: 547  LNLSSNSLSGSLAVDIGNLKAVTLIDLSGNQLSGHIPSSIGGLKTLLNLSLAVNRLEGSI 606

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P +FG      +LDLS N L+G +P SL + +++ + ++S N L G IP G  F +L A 
Sbjct: 607  PQLFGDAISLQLLDLSNNNLSGEIPKSLEELRYLTYFNVSFNELQGEIPNGRAFINLSAK 666

Query: 543  SFSNNDCLCG 572
            SF  N  LCG
Sbjct: 667  SFMGNKGLCG 676

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 60/169 (35%), Positives = 90/169 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +S L  LDL  N + G +P+   KL KL    L  N+L G+ P  +  +  LA 
Sbjct: 439 PKEIGNLSSLSWLDLGANDLRGTIPTTIRKLGKLQELKLHYNRLEGSFPYELCDLQSLAY 498

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L +N ++G IP  LG +  L TL +  N  +  IPSTL     +  LNLS N   G++
Sbjct: 499 LYLEVNALSGQIPSCLGNVNSLRTLSMGMNKFSSTIPSTLWRLADILELNLSSNSLSGSL 558

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
               G+     ++DLS N+L+G +P+S+   K + +L ++ N L G+IP
Sbjct: 559 AVDIGNLKAVTLIDLSGNQLSGHIPSSIGGLKTLLNLSLAVNRLEGSIP 607

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 57/170 (33%), Positives = 94/170 (55%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHL-DLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P+S+  +S  + + ++ +  I G +P + G L  LS   L  N L GTIP ++ K+ +L 
Sbjct: 414 PISVGNLSSSLEVVEIFDCGITGTIPKEIGNLSSLSWLDLGANDLRGTIPTTIRKLGKLQ 473

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           +L L  NR+ GS P  L  ++ L+ L L+ N+++GQIPS L +   +  L++  N F  T
Sbjct: 474 ELKLHYNRLEGSFPYELCDLQSLAYLYLEVNALSGQIPSCLGNVNSLRTLSMGMNKFSST 533

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP      +  + L+LS N L+G +   +   K +  +D+S N L G+IP
Sbjct: 534 IPSTLWRLADILELNLSSNSLSGSLAVDIGNLKAVTLIDLSGNQLSGHIP 583

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 52/174 (29%), Positives = 87/174 (50%), Gaps = 7/174 (4%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  ++ L  L L  N   G +P + G L  L   +L+ N L G +P  +   +++  + L
Sbjct: 243 IGNLTMLQELYLGGNNFSGTIPDEIGDLAHLEEIILNVNGLSGLVPSGIYNASKMTAIGL 302

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
           ++N+++G +P     +  L    ++ N+ TG IP +L + + +G ++L  N F G IPD 
Sbjct: 303 ALNQLSGYLPSS-SNLPNLEFFIIEDNNFTGPIPVSLFNASKLGNIDLGWNSFYGPIPDE 361

Query: 372 FGSKSYFMVLDLSFNKLTGR-------VPNSLAKAKFMGHLDISNNHLCGNIPI 512
            G+     V     N LT +       + +SL K K +   D+SNN L GN+PI
Sbjct: 362 LGNLKSLEVFSFWVNHLTVKSSSSGLSLFSSLTKCKHLRRFDLSNNPLNGNLPI 415

 Score = 84.0 bits (206), Expect = 8e-15
 Identities = 51/169 (30%), Positives = 81/169 (47%), Gaps = 1/169 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRK-LSRALLSRNQLIGTIPDSVLKMNRLADL 185
           S+ +   L   DLSNN + G LP   G L   L    +    + GTIP  +  ++ L+ L
Sbjct: 392 SLTKCKHLRRFDLSNNPLNGNLPISVGNLSSSLEVVEIFDCGITGTIPKEIGNLSSLSWL 451

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           DL  N + G+IP  + K+  L  LKL  N + G  P  L     +  L L  N   G IP
Sbjct: 452 DLGANDLRGTIPTTIRKLGKLQELKLHYNRLEGSFPYELCDLQSLAYLYLEVNALSGQIP 511

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
              G+ +    L +  NK +  +P++L +   +  L++S+N L G++ +
Sbjct: 512 SCLGNVNSLRTLSMGMNKFSSTIPSTLWRLADILELNLSSNSLSGSLAV 560

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 50/172 (29%), Positives = 79/172 (45%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +S L  +   NN+  G LP +  KLR++    +S N   G IP  +    +L  
Sbjct: 93  PPHLGNLSFLAFISFYNNRFHGSLPDELSKLRRIKAFGMSTNYFSGEIPSWIGSFTQLQR 152

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLD--GNSMTGQIPSTLLSN-TGMGILNLSRNGFE 353
           L LS N+ TG +P  L    + S   LD   N++TG++P  + ++   +  L L+ N F 
Sbjct: 153 LSLSSNKFTGLLPAILANNTISSLWLLDFGTNNLTGRLPPNIFTHLANLRALYLNSNLFN 212

Query: 354 GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G IP    +     +L LSFN   G +   +     +  L +  N+  G IP
Sbjct: 213 GPIPSTLMACQQLKLLALSFNHFEGSIHKDIGNLTMLQELYLGGNNFSGTIP 264

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 60/214 (28%), Positives = 97/214 (45%), Gaps = 28/214 (13%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + ++  +    +S N   GE+PS  G   +L R  LS N+  G +P ++L  N ++ 
Sbjct: 117 PDELSKLRRIKAFGMSTNYFSGEIPSWIGSFTQLQRLSLSSNKFTGLLP-AILANNTISS 175

Query: 183 L---DLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           L   D   N +TG +P  +   +  L  L L+ N   G IPSTL++   + +L LS N F
Sbjct: 176 LWLLDFGTNNLTGRLPPNIFTHLANLRALYLNSNLFNGPIPSTLMACQQLKLLALSFNHF 235

Query: 351 E------------------------GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAK 458
           E                        GTIPD  G  ++   + L+ N L+G VP+ +  A 
Sbjct: 236 EGSIHKDIGNLTMLQELYLGGNNFSGTIPDEIGDLAHLEEIILNVNGLSGLVPSGIYNAS 295

Query: 459 FMGHLDISNNHLCGNIPIGSPFDHLDAASFSNND 560
            M  + ++ N L G +P  S   +L+     +N+
Sbjct: 296 KMTAIGLALNQLSGYLPSSSNLPNLEFFIIEDNN 329

 Score = 79.0 bits (193), Expect = 3e-13
 Identities = 48/159 (30%), Positives = 79/159 (49%), Gaps = 3/159 (1%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           LDLS+  + G +P   G L  L+      N+  G++PD + K+ R+    +S N  +G I
Sbjct: 81  LDLSDMGLTGTIPPHLGNLSFLAFISFYNNRFHGSLPDELSKLRRIKAFGMSTNYFSGEI 140

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT--GMGILNLSRNGFEGTI-PDVFGSKSY 389
           P  +G    L  L L  N  TG +P+ L +NT   + +L+   N   G + P++F   + 
Sbjct: 141 PSWIGSFTQLQRLSLSSNKFTGLLPAILANNTISSLWLLDFGTNNLTGRLPPNIFTHLAN 200

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
              L L+ N   G +P++L   + +  L +S NH  G+I
Sbjct: 201 LRALYLNSNLFNGPIPSTLMACQQLKLLALSFNHFEGSI 239

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 51/165 (30%), Positives = 80/165 (48%), Gaps = 1/165 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSD-FGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           IS L  LD   N + G LP + F  L  L    L+ N   G IP +++   +L  L LS 
Sbjct: 173 ISSLWLLDFGTNNLTGRLPPNIFTHLANLRALYLNSNLFNGPIPSTLMACQQLKLLALSF 232

Query: 198 NRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
           N   GSI   +G + +L  L L GN+ +G IP  +     +  + L+ NG  G +P    
Sbjct: 233 NHFEGSIHKDIGNLTMLQELYLGGNNFSGTIPDEIGDLAHLEEIILNVNGLSGLVPSGIY 292

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           + S    + L+ N+L+G +P+S +    +    I +N+  G IP+
Sbjct: 293 NASKMTAIGLALNQLSGYLPSS-SNLPNLEFFIIEDNNFTGPIPV 336

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 49/177 (27%), Positives = 80/177 (45%), Gaps = 8/177 (4%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIG-------TIPDSVL 161
           P+S+   S L ++DL  N   G +P + G L+ L       N L         ++  S+ 
Sbjct: 335 PVSLFNASKLGNIDLGWNSFYGPIPDELGNLKSLEVFSFWVNHLTVKSSSSGLSLFSSLT 394

Query: 162 KMNRLADLDLSMNRITGSIPVRLGKM-RVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLS 338
           K   L   DLS N + G++P+ +G +   L  +++    +TG IP  + + + +  L+L 
Sbjct: 395 KCKHLRRFDLSNNPLNGNLPISVGNLSSSLEVVEIFDCGITGTIPKEIGNLSSLSWLDLG 454

Query: 339 RNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            N   GTIP           L L +N+L G  P  L   + + +L +  N L G IP
Sbjct: 455 ANDLRGTIPTTIRKLGKLQELKLHYNRLEGSFPYELCDLQSLAYLYLEVNALSGQIP 511

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 43/123 (34%), Positives = 58/123 (47%), Gaps = 2/123 (1%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  LDLS   +TG+IP  LG +  L+ +    N   G +P  L     +    +S N F
Sbjct: 77  RVTALDLSDMGLTGTIPPHLGNLSFLAFISFYNNRFHGSLPDELSKLRRIKAFGMSTNYF 136

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAK--AKFMGHLDISNNHLCGNIPIGSPF 524
            G IP   GS +    L LS NK TG +P  LA      +  LD   N+L G +P  + F
Sbjct: 137 SGEIPSWIGSFTQLQRLSLSSNKFTGLLPAILANNTISSLWLLDFGTNNLTGRLP-PNIF 195

Query: 525 DHL 533
            HL
Sbjct: 196 THL 198

[111][TOP]
>UniRef100_B9FNB7 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9FNB7_ORYSJ
          Length = 908

 Score =  125 bits (313), Expect = 3e-27
 Identities = 66/190 (34%), Positives = 107/190 (56%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +   +  ++ L L +N+I G +P D   L  L   LLS N+L  TIP S+  ++++  
Sbjct: 396 PSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVR 455

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N ++G++PV +G ++ ++ + L  N  +G+IP ++     +  LNLS NGF  ++
Sbjct: 456 LDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGFYDSV 515

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           PD FG+ +    LD+S N ++G +PN LA    +  L++S N L G IP G  F ++   
Sbjct: 516 PDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQ 575

Query: 543 SFSNNDCLCG 572
               N  LCG
Sbjct: 576 YLEGNSGLCG 585

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 59/162 (36%), Positives = 84/162 (51%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L    LSNN++ G LP+    L  L    LS NQL   IP+S++ +  L  LDLS N 
Sbjct: 331 SQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNS 390

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           ++G IP     +R +  L L+ N ++G IP  + + T +  L LS N    TIP      
Sbjct: 391 LSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHL 450

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              + LDLS N L+G +P  +   K +  +D+S+NH  G IP
Sbjct: 451 DKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIP 492

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 57/162 (35%), Positives = 81/162 (50%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  L +  N I G LP   G L  +L    LS N+L GT+P ++  +  L  +DLS N++
Sbjct: 308 LSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQL 367

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
             +IP  +  +  L  L L GNS++G IPS       +  L L  N   G+IP    + +
Sbjct: 368 RNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLT 427

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               L LS NKLT  +P SL     +  LD+S N L G +P+
Sbjct: 428 NLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPV 469

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 54/193 (27%), Positives = 96/193 (49%), Gaps = 7/193 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P++I  ++ L  L+L  NQ+ G +P++   L  L    L  N L G+IPD +     L  
Sbjct: 6   PIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLT 65

Query: 183 -LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L++  N ++G IP  +G + +L  L    N++TG +P  + + + +  ++L  NG  G 
Sbjct: 66  YLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGP 125

Query: 360 IPDVFGSKSYFMVL----DLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSP 521
           IP   G+ S+ + +     +S N   G++P  LA   ++  + +  N   G +P  +G  
Sbjct: 126 IP---GNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQVIAMPYNLFEGVLPPWLGR- 181

Query: 522 FDHLDAASFSNND 560
             +LDA S   N+
Sbjct: 182 LTNLDAISLGGNN 194

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 55/197 (27%), Positives = 91/197 (46%), Gaps = 28/197 (14%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQI-IGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  + R++ L  + L  N    G +P++   L  L+   L+   L G IP  +  + +L+
Sbjct: 176 PPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLS 235

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE-- 353
            L L+MN++TG IP  LG +  L+ L L GN + G +PST+ S   +  ++++ N     
Sbjct: 236 WLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGD 295

Query: 354 ------------------------GTIPDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAK 458
                                   G +PD  G+  S      LS NKLTG +P +++   
Sbjct: 296 LNFLSTVSNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLT 355

Query: 459 FMGHLDISNNHLCGNIP 509
            +  +D+S+N L   IP
Sbjct: 356 ALEVIDLSHNQLRNAIP 372

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 43/130 (33%), Positives = 64/130 (49%), Gaps = 1/130 (0%)
 Frame = +3

Query: 138 GTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG 317
           G IP ++  + RL  L+L  N++ G IP  L  +  L ++ L  N +TG IP  L +NT 
Sbjct: 3   GGIPIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTP 62

Query: 318 -MGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHL 494
            +  LN+  N   G IP   GS      L+   N LTG VP ++     +  + + +N L
Sbjct: 63  LLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGL 122

Query: 495 CGNIPIGSPF 524
            G IP  + F
Sbjct: 123 TGPIPGNTSF 132

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 2/152 (1%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRL-GKMR 242
           G +P   G L +L    L  NQL G IP  +  ++ L  ++L  N +TGSIP  L     
Sbjct: 3   GGIPIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTP 62

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
           +L+ L +  NS++G IP  + S   +  LN   N   G +P    + S    + L  N L
Sbjct: 63  LLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGL 122

Query: 423 TGRVP-NSLAKAKFMGHLDISNNHLCGNIPIG 515
           TG +P N+      +    IS N+  G IP+G
Sbjct: 123 TGPIPGNTSFSLPVLRWFAISKNNFFGQIPLG 154

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 49/172 (28%), Positives = 80/172 (46%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSD-FGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  +  +  L  ++L +N + G +P D F     L+   +  N L G IP  +  +  L 
Sbjct: 30  PAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQ 89

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIP-STLLSNTGMGILNLSRNGFEG 356
            L+   N +TG++P  +  M  LST+ L  N +TG IP +T  S   +    +S+N F G
Sbjct: 90  HLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFG 149

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDI-SNNHLCGNIP 509
            IP    +  Y  V+ + +N   G +P  L +   +  + +  NN   G IP
Sbjct: 150 QIPLGLAACPYLQVIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNFDAGPIP 201

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 50/171 (29%), Positives = 80/171 (46%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  +S L  + L +N + G +P +    L  L    +S+N   G IP  +     L 
Sbjct: 103 PPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQ 162

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSM-TGQIPSTLLSNTGMGILNLSRNGFEG 356
            + +  N   G +P  LG++  L  + L GN+   G IP+ L + T + +L+L+     G
Sbjct: 163 VIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTG 222

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            IP   G       L L+ N+LTG +P SL     +  L +  N L G++P
Sbjct: 223 NIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLP 273

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 1/103 (0%)
 Frame = +3

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGS 380
           ++G IP+ +G +  L  L L  N + G IP+ L     +G +NL  N   G+IP D+F +
Sbjct: 1   MSGGIPIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNN 60

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                 L++  N L+G +P  +     + HL+   N+L G +P
Sbjct: 61  TPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVP 103

[112][TOP]
>UniRef100_B9EX97 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=B9EX97_ORYSJ
          Length = 1050

 Score =  125 bits (313), Expect = 3e-27
 Identities = 75/215 (34%), Positives = 105/215 (48%), Gaps = 25/215 (11%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P SI  ++ L+ LDLSNNQ+ G +P   G + +L+   LS N+L+ +IPD +  +  L D
Sbjct: 439  PFSIGNLTQLLTLDLSNNQLNGSIPKSLGSMERLTNLDLSSNRLVESIPDVIFSLPSLTD 498

Query: 183  -------------------------LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQ 287
                                     L LS N ++G IP  LG    L  L LD N  TG 
Sbjct: 499  SLLLSDNYLSGALPPKVGNLRRATTLSLSRNNLSGKIPTTLGDCASLVYLALDSNHFTGS 558

Query: 288  IPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
            IP +L +  G+ ILNL+RN   G+IP    +      L L+ N L+G +P  L K+  + 
Sbjct: 559  IPPSLGNLRGLSILNLTRNALSGSIPQQLSNIHGLQQLYLAHNNLSGTIPQFLEKSSALI 618

Query: 468  HLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
             LD+S NHL G +P    F ++   S   N  LCG
Sbjct: 619  ELDLSYNHLSGEVPSHGLFANMSGFSVLGNYALCG 653

 Score =  105 bits (262), Expect = 3e-21
 Identities = 59/170 (34%), Positives = 88/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  + G+  L+   N + G++P D G+LR L    L+ N + G IP S+  + +L  
Sbjct: 391 PPGIGSLKGIEDLEFQGNNLFGDIPGDIGRLRNLKVLWLNMNNMSGGIPFSIGNLTQLLT 450

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGM-GILNLSRNGFEGT 359
           LDLS N++ GSIP  LG M  L+ L L  N +   IP  + S   +   L LS N   G 
Sbjct: 451 LDLSNNQLNGSIPKSLGSMERLTNLDLSSNRLVESIPDVIFSLPSLTDSLLLSDNYLSGA 510

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+      L LS N L+G++P +L     + +L + +NH  G+IP
Sbjct: 511 LPPKVGNLRRATTLSLSRNNLSGKIPTTLGDCASLVYLALDSNHFTGSIP 560

 Score =  104 bits (260), Expect = 4e-21
 Identities = 63/154 (40%), Positives = 81/154 (52%)
 Frame = +3

Query: 45  LSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPV 224
           LS+N + G LP   G LR+ +   LSRN L G IP ++     L  L L  N  TGSIP 
Sbjct: 502 LSDNYLSGALPPKVGNLRRATTLSLSRNNLSGKIPTTLGDCASLVYLALDSNHFTGSIPP 561

Query: 225 RLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLD 404
            LG +R LS L L  N+++G IP  L +  G+  L L+ N   GTIP      S  + LD
Sbjct: 562 SLGNLRGLSILNLTRNALSGSIPQQLSNIHGLQQLYLAHNNLSGTIPQFLEKSSALIELD 621

Query: 405 LSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           LS+N L+G VP+    A   G   + N  LCG I
Sbjct: 622 LSYNHLSGEVPSHGLFANMSGFSVLGNYALCGGI 655

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 55/162 (33%), Positives = 89/162 (54%), Gaps = 2/162 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKL-RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  +DLS+N + G LPS    L R +    +++NQ+ G IP  +  +  + DL+   N +
Sbjct: 351 LQVIDLSDNTLGGILPSFIANLSRSIQWLSMAKNQISGIIPPGIGSLKGIEDLEFQGNNL 410

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
            G IP  +G++R L  L L+ N+M+G IP ++ + T +  L+LS N   G+IP   GS  
Sbjct: 411 FGDIPGDIGRLRNLKVLWLNMNNMSGGIPFSIGNLTQLLTLDLSNNQLNGSIPKSLGSME 470

Query: 387 YFMVLDLSFNKLTGRVPNSL-AKAKFMGHLDISNNHLCGNIP 509
               LDLS N+L   +P+ + +       L +S+N+L G +P
Sbjct: 471 RLTNLDLSSNRLVESIPDVIFSLPSLTDSLLLSDNYLSGALP 512

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 51/172 (29%), Positives = 84/172 (48%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ +   S L+ L +  N++ G +PS  G L +L    L  N L GT+P S+  +  L  
Sbjct: 142 PVGLCNCSNLVFLSVEANELHGAIPSCLGSLLQLKVLYLGENNLTGTVPPSLGNLTMLLQ 201

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           + L  N++ G+IP  L  +R L  ++   NS++G +P    + + +  L  S N   G +
Sbjct: 202 IALYQNQLEGTIPEGLSGLRYLQYIQASRNSLSGTLPPLFFNISSLQYLGFSSNKLHGRL 261

Query: 363 PDVFGSK-SYFMVLDLS--FNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G++     VL L    N  +G +P SL+ A  +  L ++ N   G IP
Sbjct: 262 PPDAGTRLPNLQVLRLGGIGNNFSGTIPASLSNATEIQVLGLARNSFEGRIP 313

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 62/204 (30%), Positives = 96/204 (47%), Gaps = 33/204 (16%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ L+ + L  NQ+ G +P     LR L     SRN L GT+P     ++ L  
Sbjct: 190 PPSLGNLTMLLQIALYQNQLEGTIPEGLSGLRYLQYIQASRNSLSGTLPPLFFNISSLQY 249

Query: 183 LDLSMNRITGSIPVRLG-KMRVLSTLKLDG--NSMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L  S N++ G +P   G ++  L  L+L G  N+ +G IP++L + T + +L L+RN FE
Sbjct: 250 LGFSSNKLHGRLPPDAGTRLPNLQVLRLGGIGNNFSGTIPASLSNATEIQVLGLARNSFE 309

Query: 354 GTIPDVFGS-----------------------KSYF------MVLDLSFNKLTGRVPNSL 446
           G IP   G                          YF       V+DLS N L G +P+ +
Sbjct: 310 GRIPPEIGKLCPVSVQMGSNKLQANDAGDWEFLRYFTNCTRLQVIDLSDNTLGGILPSFI 369

Query: 447 AK-AKFMGHLDISNNHLCGNIPIG 515
           A  ++ +  L ++ N + G IP G
Sbjct: 370 ANLSRSIQWLSMAKNQISGIIPPG 393

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 50/166 (30%), Positives = 81/166 (48%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  ++ L  LDL NN + G++     +L +L    L+ N   G +P  +   + L  L +
Sbjct: 98  IGNLTFLQSLDLFNNTLSGDVYFT-SQLHRLHYLELAYNDFSGDLPVGLCNCSNLVFLSV 156

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
             N + G+IP  LG +  L  L L  N++TG +P +L + T +  + L +N  EGTIP+ 
Sbjct: 157 EANELHGAIPSCLGSLLQLKVLYLGENNLTGTVPPSLGNLTMLLQIALYQNQLEGTIPEG 216

Query: 372 FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                Y   +  S N L+G +P        + +L  S+N L G +P
Sbjct: 217 LSGLRYLQYIQASRNSLSGTLPPLFFNISSLQYLGFSSNKLHGRLP 262

[113][TOP]
>UniRef100_Q9FL28 LRR receptor-like serine/threonine-protein kinase FLS2 n=2
            Tax=Arabidopsis thaliana RepID=FLS2_ARATH
          Length = 1173

 Score =  125 bits (313), Expect = 3e-27
 Identities = 72/194 (37%), Positives = 110/194 (56%), Gaps = 3/194 (1%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDF-GKLRKLSRAL-LSRNQLIGTIPDSVLKMNRL 176
            P S+  +S L   D+S+N + G +P +    L+ +   L  S N L GTIP  + K+  +
Sbjct: 592  PASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMV 651

Query: 177  ADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGI-LNLSRNGFE 353
             ++DLS N  +GSIP  L   + + TL    N+++G IP  +     M I LNLSRN F 
Sbjct: 652  QEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFS 711

Query: 354  GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHL 533
            G IP  FG+ ++ + LDLS N LTG +P SLA    + HL +++N+L G++P    F ++
Sbjct: 712  GEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPESGVFKNI 771

Query: 534  DAASFSNNDCLCGN 575
            +A+    N  LCG+
Sbjct: 772  NASDLMGNTDLCGS 785

 Score =  107 bits (268), Expect = 5e-22
 Identities = 61/169 (36%), Positives = 88/169 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+SI  ++ L  LDLS NQ+ G++P DFG L  L   +L+ N L G IP  +   + L  
Sbjct: 209 PVSIGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQ 268

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L  N++TG IP  LG +  L  L++  N +T  IPS+L   T +  L LS N   G I
Sbjct: 269 LELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPI 328

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +  G      VL L  N  TG  P S+   + +  L +  N++ G +P
Sbjct: 329 SEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISGELP 377

 Score =  103 bits (256), Expect = 1e-20
 Identities = 63/193 (32%), Positives = 97/193 (50%), Gaps = 24/193 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI   +GL  LDLS+NQ+ GE+P  FG++  L+   + RN   G IPD +   + L  
Sbjct: 401 PSSISNCTGLKLLDLSHNQMTGEIPRGFGRMN-LTFISIGRNHFTGEIPDDIFNCSNLET 459

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF---- 350
           L ++ N +TG++   +GK++ L  L++  NS+TG IP  + +   + IL L  NGF    
Sbjct: 460 LSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRI 519

Query: 351 --------------------EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGH 470
                               EG IP+         VLDLS NK +G++P   +K + + +
Sbjct: 520 PREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTY 579

Query: 471 LDISNNHLCGNIP 509
           L +  N   G+IP
Sbjct: 580 LSLQGNKFNGSIP 592

 Score =  102 bits (253), Expect = 3e-20
 Identities = 56/185 (30%), Positives = 95/185 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I   S L+ L+L +NQ+ G++P++ G L +L    + +N+L  +IP S+ ++ +L  
Sbjct: 257 PAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTH 316

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N + G I   +G +  L  L L  N+ TG+ P ++ +   + +L +  N   G +
Sbjct: 317 LGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISGEL 376

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P   G  +    L    N LTG +P+S++    +  LD+S+N + G IP G    +L   
Sbjct: 377 PADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMNLTFI 436

Query: 543 SFSNN 557
           S   N
Sbjct: 437 SIGRN 441

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 59/171 (34%), Positives = 87/171 (50%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I  +  L  L L +N   G +P +   L  L    +  N L G IP+ +  M  L+ 
Sbjct: 496  PREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSV 555

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N+ +G IP    K+  L+ L L GN   G IP++L S + +   ++S N   GTI
Sbjct: 556  LDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTI 615

Query: 363  PD--VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            P   +   K+  + L+ S N LTG +P  L K + +  +D+SNN   G+IP
Sbjct: 616  PGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSGSIP 666

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 58/168 (34%), Positives = 86/168 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I + S L+ +    N + G++P   G L  L   + + N L G+IP S+  +  L D
Sbjct: 161 PEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTD 220

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N++TG IP   G +  L +L L  N + G IP+ + + + +  L L  N   G I
Sbjct: 221 LDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKI 280

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P   G+      L +  NKLT  +P+SL +   + HL +S NHL G I
Sbjct: 281 PAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPI 328

 Score = 93.6 bits (231), Expect = 1e-17
 Identities = 52/167 (31%), Positives = 91/167 (54%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           +I  ++ L  LDL++N   G++P++ GKL +L++ +L  N   G+IP  + ++  +  LD
Sbjct: 91  AIANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIFYLD 150

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           L  N ++G +P  + K   L  +  D N++TG+IP  L     + +   + N   G+IP 
Sbjct: 151 LRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPV 210

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             G+ +    LDLS N+LTG++P        +  L ++ N L G+IP
Sbjct: 211 SIGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIP 257

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 57/169 (33%), Positives = 85/169 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  + +LDL NN + G++P +  K   L       N L G IP+ +  +  L  
Sbjct: 137 PSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQM 196

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
              + N +TGSIPV +G +  L+ L L GN +TG+IP    +   +  L L+ N  EG I
Sbjct: 197 FVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDI 256

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+ S  + L+L  N+LTG++P  L     +  L I  N L  +IP
Sbjct: 257 PAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIP 305

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 59/168 (35%), Positives = 83/168 (49%), Gaps = 2/168 (1%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I ++  L  L +S N + G +P + G L+ L+   L  N   G IP  +  +  L  L +
Sbjct: 475 IGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRM 534

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
             N + G IP  +  M++LS L L  N  +GQIP+       +  L+L  N F G+IP  
Sbjct: 535 YSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPAS 594

Query: 372 FGSKSYFMVLDLSFNKLTGRVPNS-LAKAKFMG-HLDISNNHLCGNIP 509
             S S     D+S N LTG +P   LA  K M  +L+ SNN L G IP
Sbjct: 595 LKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIP 642

 Score = 74.7 bits (182), Expect = 5e-12
 Identities = 41/132 (31%), Positives = 65/132 (49%)
 Frame = +3

Query: 117 LSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS 296
           L   QL G +  ++  +  L  LDL+ N  TG IP  +GK+  L+ L L  N  +G IPS
Sbjct: 79  LLEKQLEGVLSPAIANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPS 138

Query: 297 TLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLD 476
            +     +  L+L  N   G +P+     S  +++   +N LTG++P  L     +    
Sbjct: 139 GIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFV 198

Query: 477 ISNNHLCGNIPI 512
            + NHL G+IP+
Sbjct: 199 AAGNHLTGSIPV 210

[114][TOP]
>UniRef100_Q10MS0 Leucine Rich Repeat family protein, expressed n=1 Tax=Oryza sativa
           Japonica Group RepID=Q10MS0_ORYSJ
          Length = 791

 Score =  124 bits (312), Expect = 4e-27
 Identities = 72/190 (37%), Positives = 106/190 (55%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +  L+ L LS+N + GE+P   G LR L    LS N + G+IPD +  ++ L  
Sbjct: 174 PSSLTSLPFLVSLQLSSNNLSGEVPPTIGNLRMLHELSLSYNLISGSIPDGIGSLSGLHS 233

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N ++GS+P  L  +  L  LKLDGN + G IP  +     +  L+L RN  +G I
Sbjct: 234 LDLSNNLLSGSLPASLCNLTSLVELKLDGNDIGGHIPDAIDGLKNLTKLSLRRNVLDGEI 293

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P   G+ S   +LD+S N LTG +P SL+    +   ++S N+L G +P+       +A+
Sbjct: 294 PATVGNISALSLLDVSENNLTGGIPESLSGLNNLTSFNVSYNNLSGPVPVALS-SKFNAS 352

Query: 543 SFSNNDCLCG 572
           SF+ N  LCG
Sbjct: 353 SFAGNIQLCG 362

 Score = 96.3 bits (238), Expect = 2e-18
 Identities = 54/164 (32%), Positives = 86/164 (52%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           +++ L  L L +N + G+LP+  G L +L    L  N+  G +P  +     L  LDLS 
Sbjct: 83  QLTALRKLSLHDNALGGQLPASLGFLPELRGVYLFNNRFAGAVPPQLGGCALLQTLDLSG 142

Query: 198 NRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
           N ++G++P  L     L  L L  N++TG +PS+L S   +  L LS N   G +P   G
Sbjct: 143 NFLSGAVPASLANATRLLRLNLAYNNLTGAVPSSLTSLPFLVSLQLSSNNLSGEVPPTIG 202

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +      L LS+N ++G +P+ +     +  LD+SNN L G++P
Sbjct: 203 NLRMLHELSLSYNLISGSIPDGIGSLSGLHSLDLSNNLLSGSLP 246

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 59/169 (34%), Positives = 90/169 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +  L  + L NN+  G +P   G    L    LS N L G +P S+    RL  
Sbjct: 102 PASLGFLPELRGVYLFNNRFAGAVPPQLGGCALLQTLDLSGNFLSGAVPASLANATRLLR 161

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L+ N +TG++P  L  +  L +L+L  N+++G++P T+ +   +  L+LS N   G+I
Sbjct: 162 LNLAYNNLTGAVPSSLTSLPFLVSLQLSSNNLSGEVPPTIGNLRMLHELSLSYNLISGSI 221

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           PD  GS S    LDLS N L+G +P SL     +  L +  N + G+IP
Sbjct: 222 PDGIGSLSGLHSLDLSNNLLSGSLPASLCNLTSLVELKLDGNDIGGHIP 270

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 55/167 (32%), Positives = 86/167 (51%), Gaps = 1/167 (0%)
 Frame = +3

Query: 60  IIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKM 239
           + G L    G+L  L +  L  N L G +P S+  +  L  + L  NR  G++P +LG  
Sbjct: 73  LAGALSDKVGQLTALRKLSLHDNALGGQLPASLGFLPELRGVYLFNNRFAGAVPPQLGGC 132

Query: 240 RVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNK 419
            +L TL L GN ++G +P++L + T +  LNL+ N   G +P    S  + + L LS N 
Sbjct: 133 ALLQTLDLSGNFLSGAVPASLANATRLLRLNLAYNNLTGAVPSSLTSLPFLVSLQLSSNN 192

Query: 420 LTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
           L+G VP ++   + +  L +S N + G+IP G      L +   SNN
Sbjct: 193 LSGEVPPTIGNLRMLHELSLSYNLISGSIPDGIGSLSGLHSLDLSNN 239

[115][TOP]
>UniRef100_C5Z5E9 Putative uncharacterized protein Sb10g005310 n=1 Tax=Sorghum bicolor
            RepID=C5Z5E9_SORBI
          Length = 1135

 Score =  124 bits (312), Expect = 4e-27
 Identities = 75/217 (34%), Positives = 112/217 (51%), Gaps = 25/217 (11%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P SI ++  L  LDLS+N + G +P   GKL KL    LS N+L G IPDS+  +++L +
Sbjct: 507  PQSITKMKSLRGLDLSSNNLSGIIPIHIGKLTKLFGLSLSNNKLNGLIPDSIGNLSQLQE 566

Query: 183  ------------------------LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQI 290
                                    LDLS N ++GS P  +  ++ ++ L L  N + G+I
Sbjct: 567  LGLSNNQFTSSIPLGLWGLENIVKLDLSRNALSGSFPEGIENLKAITLLDLSSNKLHGKI 626

Query: 291  PSTLLSNTGMGILNLSRNGFEGTIPDVFGSK-SYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
            P +L   + +  LNLS+N  +  +P+  G+K S    LDLS+N L+G +P S A   ++ 
Sbjct: 627  PPSLGVLSTLTNLNLSKNMLQDQVPNAIGNKLSSMKTLDLSYNSLSGTIPKSFANLSYLT 686

Query: 468  HLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCGNP 578
             L++S N L G IP G  F ++   S   N  LCG P
Sbjct: 687  SLNLSFNKLYGQIPNGGVFSNITLQSLEGNTALCGLP 723

 Score =  109 bits (273), Expect = 1e-22
 Identities = 63/171 (36%), Positives = 90/171 (52%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGK--LRKLSRALLSRNQLIGTIPDSVLKMNRL 176
           P S+  +S L+ L LS N + G +P D     L  L R  LS+N+L GT+P        L
Sbjct: 242 PSSLFNMSNLIGLYLSQNDLSGSVPPDNQSFNLPMLERLYLSKNELAGTVPPGFGSCKYL 301

Query: 177 ADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEG 356
               L+ NR TG IP+ L  +  L+ + L GN + G+IPS L + TG+ +L+ + +G  G
Sbjct: 302 QQFVLAYNRFTGGIPLWLSALPELTQISLGGNDLAGEIPSVLSNITGLTVLDFTTSGLHG 361

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            IP   G  +    L+L  N LTG +P S+     +  LDIS N L G +P
Sbjct: 362 EIPPELGRLAQLQWLNLEMNSLTGIIPASIQNISMLSILDISYNSLTGPVP 412

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 63/192 (32%), Positives = 100/192 (52%), Gaps = 6/192 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLK---MNR 173
           P S   ++ L  LDL +N + GE+P + G L+ +   +LS N L G +P  +      ++
Sbjct: 143 PASFGNLTTLEILDLDSNNLTGEIPHELGNLQSVGFLILSGNDLSGPLPQGLFNGTSQSQ 202

Query: 174 LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L+  +L+ N +TG+IP  +G    L  L+L GN ++GQIPS+L + + +  L LS+N   
Sbjct: 203 LSFFNLADNSLTGNIPSAIGSFPNLQFLELSGNQLSGQIPSSLFNMSNLIGLYLSQNDLS 262

Query: 354 GTIPDVFGSKSYFMV--LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPF 524
           G++P    S +  M+  L LS N+L G VP      K++    ++ N   G IP+  S  
Sbjct: 263 GSVPPDNQSFNLPMLERLYLSKNELAGTVPPGFGSCKYLQQFVLAYNRFTGGIPLWLSAL 322

Query: 525 DHLDAASFSNND 560
             L   S   ND
Sbjct: 323 PELTQISLGGND 334

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 58/160 (36%), Positives = 85/160 (53%), Gaps = 3/160 (1%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L   ++ G L  + G L  LS   LS   L G +P S+  + RL  LDLS N +TG++
Sbjct: 83  LALPGVRLAGALAPELGNLTFLSILNLSDAALTGHVPTSLGTLPRLLSLDLSSNYLTGTV 142

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD-VFG--SKSY 389
           P   G +  L  L LD N++TG+IP  L +   +G L LS N   G +P  +F   S+S 
Sbjct: 143 PASFGNLTTLEILDLDSNNLTGEIPHELGNLQSVGFLILSGNDLSGPLPQGLFNGTSQSQ 202

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
               +L+ N LTG +P+++     +  L++S N L G IP
Sbjct: 203 LSFFNLADNSLTGNIPSAIGSFPNLQFLELSGNQLSGQIP 242

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 70/237 (29%), Positives = 106/237 (44%), Gaps = 52/237 (21%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  I+GL  LD + + + GE+P + G+L +L    L  N L G IP S+  ++ L+ 
Sbjct: 340  PSVLSNITGLTVLDFTTSGLHGEIPPELGRLAQLQWLNLEMNSLTGIIPASIQNISMLSI 399

Query: 183  LDLSMNRITGSIPVRL-------------------GKMRVLSTLK------LDGNSMTGQ 287
            LD+S N +TG +P +L                   G M  LS  K      ++ N  TG 
Sbjct: 400  LDISYNSLTGPVPRKLFGESLTELYIDENKLSGDVGFMADLSGCKSLRYIVMNNNYFTGS 459

Query: 288  IPSTLLSN-TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFM 464
             PS++++N + + I     N   G IP++  S S+   +DL  N+L+G +P S+ K K +
Sbjct: 460  FPSSMMANLSSLEIFRAFENQITGHIPNMSSSISF---VDLRNNQLSGEIPQSITKMKSL 516

Query: 465  GHLDIS------------------------NNHLCGNIP--IGSPFDHLDAASFSNN 557
              LD+S                        NN L G IP  IG+    L     SNN
Sbjct: 517  RGLDLSSNNLSGIIPIHIGKLTKLFGLSLSNNKLNGLIPDSIGN-LSQLQELGLSNN 572

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 62/236 (26%), Positives = 102/236 (43%), Gaps = 51/236 (21%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P+ +  +  L  + L  N + GE+PS    +  L+    + + L G IP  + ++ +L  
Sbjct: 316  PLWLSALPELTQISLGGNDLAGEIPSVLSNITGLTVLDFTTSGLHGEIPPELGRLAQLQW 375

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQI------------------------ 290
            L+L MN +TG IP  +  + +LS L +  NS+TG +                        
Sbjct: 376  LNLEMNSLTGIIPASIQNISMLSILDISYNSLTGPVPRKLFGESLTELYIDENKLSGDVG 435

Query: 291  -------------------------PSTLLSN-TGMGILNLSRNGFEGTIPDVFGSKSYF 392
                                     PS++++N + + I     N   G IP++  S S+ 
Sbjct: 436  FMADLSGCKSLRYIVMNNNYFTGSFPSSMMANLSSLEIFRAFENQITGHIPNMSSSISF- 494

Query: 393  MVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
              +DL  N+L+G +P S+ K K +  LD+S+N+L G IPI       L   S SNN
Sbjct: 495  --VDLRNNQLSGEIPQSITKMKSLRGLDLSSNNLSGIIPIHIGKLTKLFGLSLSNN 548

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 41/115 (35%), Positives = 64/115 (55%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  L L   R+ G++   LG +  LS L L   ++TG +P++L +   +  L+LS N  
Sbjct: 79  RVTALALPGVRLAGALAPELGNLTFLSILNLSDAALTGHVPTSLGTLPRLLSLDLSSNYL 138

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
            GT+P  FG+ +   +LDL  N LTG +P+ L   + +G L +S N L G +P G
Sbjct: 139 TGTVPASFGNLTTLEILDLDSNNLTGEIPHELGNLQSVGFLILSGNDLSGPLPQG 193

[116][TOP]
>UniRef100_C5XCR8 Putative uncharacterized protein Sb02g006240 n=1 Tax=Sorghum bicolor
            RepID=C5XCR8_SORBI
          Length = 1047

 Score =  124 bits (312), Expect = 4e-27
 Identities = 74/191 (38%), Positives = 107/191 (56%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLA 179
            P SI  +S L+ LDLS N++ G +P +  +L  +S  L LS + L G +P  V  +  L 
Sbjct: 466  PPSIGNLSKLLGLDLSYNKLTGLIPREIMELPSISIDLDLSNSMLEGALPLEVGSLVYLE 525

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
             L LS N ++G IP  +G  RV+  L +DGNS+ G IP+T  +  G+ +LNL+ N   G+
Sbjct: 526  QLFLSGNNLSGEIPDTIGNCRVMEILSMDGNSLQGSIPATFKNMVGLTVLNLTDNRLNGS 585

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
            IP    + +    L L  NKL+G +P  L  +  + HLD+S N+L G IP G  F +L  
Sbjct: 586  IPSNLATLTNLQGLYLGHNKLSGTIPEILGNSTSLLHLDLSYNNLQGEIPKGGVFKNLTG 645

Query: 540  ASFSNNDCLCG 572
             S   N+ LCG
Sbjct: 646  LSIVGNNELCG 656

 Score =  115 bits (289), Expect = 2e-24
 Identities = 66/168 (39%), Positives = 99/168 (58%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           +I  ++ L  L+LS N + GE+P+  G LR+L R  LS N + G IP ++ +   L  + 
Sbjct: 99  AIGNLTFLRLLNLSYNSLHGEIPASVGSLRRLRRLHLSGNMITGVIPSNISRCISLRGII 158

Query: 189 LSMNR-ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           +  N+ + GSIPV +G M  LS L LD NS+TG IPS+L + + + +L+L RN  EG IP
Sbjct: 159 IQDNKGLQGSIPVEIGSMPALSVLALDNNSITGTIPSSLGNLSRLAVLSLPRNFLEGPIP 218

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              G+  Y   L LS N L+G +P SL    F+    +++N L G++P
Sbjct: 219 ATIGNNPYLTWLQLSANDLSGLLPPSLYNLSFLQDFFVASNKLHGHLP 266

 Score =  108 bits (269), Expect = 4e-22
 Identities = 62/170 (36%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGL-MHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I+ +  + + LDLSN+ + G LP + G L  L +  LS N L G IPD++     + 
Sbjct: 490 PREIMELPSISIDLDLSNSMLEGALPLEVGSLVYLEQLFLSGNNLSGEIPDTIGNCRVME 549

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L +  N + GSIP     M  L+ L L  N + G IPS L + T +  L L  N   GT
Sbjct: 550 ILSMDGNSLQGSIPATFKNMVGLTVLNLTDNRLNGSIPSNLATLTNLQGLYLGHNKLSGT 609

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP++ G+ +  + LDLS+N L G +P         G   + NN LCG IP
Sbjct: 610 IPEILGNSTSLLHLDLSYNNLQGEIPKGGVFKNLTGLSIVGNNELCGGIP 659

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 57/170 (33%), Positives = 93/170 (54%), Gaps = 2/170 (1%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           S+   SGL  L +  N++ G+LP     L   L    +  N + G IP  +  +  L  L
Sbjct: 347 SLANCSGLQTLSIGRNRLAGKLPGSVANLSTNLQWLQIPYNNISGVIPSDIGNLASLQML 406

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           D  +N +TG IP  +GK+ +L  L L  NS++G++PS++ + + +   + + N F G IP
Sbjct: 407 DFRINLLTGVIPESIGKLTLLQKLGLISNSLSGRLPSSIGNLSSLLEFDANGNSFYGPIP 466

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG-HLDISNNHLCGNIPI 512
              G+ S  + LDLS+NKLTG +P  + +   +   LD+SN+ L G +P+
Sbjct: 467 PSIGNLSKLLGLDLSYNKLTGLIPREIMELPSISIDLDLSNSMLEGALPL 516

 Score = 85.1 bits (209), Expect = 4e-15
 Identities = 56/172 (32%), Positives = 85/172 (49%), Gaps = 2/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQ-LIGTIPDSVLKMNRLA 179
           P S+  +  L  L LS N I G +PS+  +   L   ++  N+ L G+IP  +  M  L+
Sbjct: 121 PASVGSLRRLRRLHLSGNMITGVIPSNISRCISLRGIIIQDNKGLQGSIPVEIGSMPALS 180

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N ITG+IP  LG +  L+ L L  N + G IP+T+ +N  +  L LS N   G 
Sbjct: 181 VLALDNNSITGTIPSSLGNLSRLAVLSLPRNFLEGPIPATIGNNPYLTWLQLSANDLSGL 240

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA-KFMGHLDISNNHLCGNIPI 512
           +P    + S+     ++ NKL G +P  L K+   +    I  N   G +P+
Sbjct: 241 LPPSLYNLSFLQDFFVASNKLHGHLPTDLGKSLPSIQQFGIGENRFTGTLPL 292

 Score = 77.8 bits (190), Expect = 6e-13
 Identities = 49/132 (37%), Positives = 67/132 (50%), Gaps = 1/132 (0%)
 Frame = +3

Query: 117 LSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS 296
           LS   L GTI  ++  +  L  L+LS N + G IP  +G +R L  L L GN +TG IPS
Sbjct: 87  LSSQGLAGTISPAIGNLTFLRLLNLSYNSLHGEIPASVGSLRRLRRLHLSGNMITGVIPS 146

Query: 297 TLLSNTGM-GILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHL 473
            +     + GI+     G +G+IP   GS     VL L  N +TG +P+SL     +  L
Sbjct: 147 NISRCISLRGIIIQDNKGLQGSIPVEIGSMPALSVLALDNNSITGTIPSSLGNLSRLAVL 206

Query: 474 DISNNHLCGNIP 509
            +  N L G IP
Sbjct: 207 SLPRNFLEGPIP 218

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 53/168 (31%), Positives = 78/168 (46%), Gaps = 1/168 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ I  +  L  L L NN I G +PS  G L +L+   L RN L G IP ++     L  
Sbjct: 170 PVEIGSMPALSVLALDNNSITGTIPSSLGNLSRLAVLSLPRNFLEGPIPATIGNNPYLTW 229

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGT 359
           L LS N ++G +P  L  +  L    +  N + G +P+ L  S   +    +  N F GT
Sbjct: 230 LQLSANDLSGLLPPSLYNLSFLQDFFVASNKLHGHLPTDLGKSLPSIQQFGIGENRFTGT 289

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGN 503
           +P    + S    L   FN  TG VP  L++ + +  L + +N L  N
Sbjct: 290 LPLSLTNLSKLQTLYAGFNSFTGIVPTGLSRLQNLESLLLDDNMLEAN 337

[117][TOP]
>UniRef100_B9S154 Leucine-rich repeat transmembrane protein kinase, putative n=1
            Tax=Ricinus communis RepID=B9S154_RICCO
          Length = 994

 Score =  124 bits (312), Expect = 4e-27
 Identities = 74/194 (38%), Positives = 112/194 (57%), Gaps = 3/194 (1%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPS-DFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRL 176
            P  + R+  L  LDLS+N + G +P      ++ +  +L LS N L G IP  + K++ +
Sbjct: 424  PTGMERLIRLSSLDLSHNHLKGSIPGLMIASMKNMQISLNLSYNLLGGNIPVELGKLDAV 483

Query: 177  ADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFE 353
              +DLS N ++G IP  +G  R L +L L GN ++G IP+   S    + ILNLSRN  +
Sbjct: 484  QGIDLSNNNLSGIIPETIGGCRNLFSLDLSGNKLSGSIPAKAFSQMSVLTILNLSRNDLD 543

Query: 354  GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHL 533
            G IP+ F    +   LDLS N+L  ++P+SLA    + HL+++ NHL G IP    F ++
Sbjct: 544  GQIPESFAELKHLTTLDLSQNQLKDKIPDSLANLSTLKHLNLTFNHLEGQIPETGIFKNI 603

Query: 534  DAASFSNNDCLCGN 575
            +A+SF  N  LCG+
Sbjct: 604  NASSFIGNPGLCGS 617

 Score =  113 bits (283), Expect = 9e-24
 Identities = 63/169 (37%), Positives = 89/169 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +S L +L LS N + G++PS+ G L  L    LSRN L G+IP S+     L  
Sbjct: 184 PRSITNLSNLTYLSLSINFLTGKIPSNIGMLYNLRNLSLSRNLLEGSIPSSITNCTGLLY 243

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL+ NRITG +P  LG++  L+ L L  N M+G+IP  L + + + +LNL+ N F G +
Sbjct: 244 LDLAFNRITGKLPWGLGQLHNLTRLSLGPNKMSGEIPDDLYNCSNLEVLNLAENNFSGLL 303

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
               G       L   FN L G +P  +     +  L ++ N   G IP
Sbjct: 304 KPGIGKLYNIQTLKAGFNSLVGPIPPEIGNLSQLITLSLAGNRFSGLIP 352

 Score =  109 bits (272), Expect = 2e-22
 Identities = 65/195 (33%), Positives = 100/195 (51%), Gaps = 24/195 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI   +GL++LDL+ N+I G+LP   G+L  L+R  L  N++ G IPD +   + L  
Sbjct: 232 PSSITNCTGLLYLDLAFNRITGKLPWGLGQLHNLTRLSLGPNKMSGEIPDDLYNCSNLEV 291

Query: 183 LDLS------------------------MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQI 290
           L+L+                         N + G IP  +G +  L TL L GN  +G I
Sbjct: 292 LNLAENNFSGLLKPGIGKLYNIQTLKAGFNSLVGPIPPEIGNLSQLITLSLAGNRFSGLI 351

Query: 291 PSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGH 470
           P TL   + +  L+L  N  EG IP+      +  VL L  N+LTG++P +++K + +  
Sbjct: 352 PPTLFKLSLLQGLSLHSNALEGAIPENIFELKHLTVLMLGVNRLTGQIPAAISKLEMLSD 411

Query: 471 LDISNNHLCGNIPIG 515
           LD+++N   G+IP G
Sbjct: 412 LDLNSNMFNGSIPTG 426

 Score =  108 bits (269), Expect = 4e-22
 Identities = 60/171 (35%), Positives = 93/171 (54%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +     L++L+L  NQ  G +PS+ G L +L    L +N+L  TIP S+ ++  L +
Sbjct: 88  PSELGSCKNLVNLELYRNQFTGAIPSELGNLIRLETLRLYKNRLNSTIPLSLFQLTLLTN 147

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N++TG +P  LG ++ L  L L  N  TGQIP ++ + + +  L+LS N   G I
Sbjct: 148 LGLSENQLTGMVPRELGSLKSLQVLTLHSNKFTGQIPRSITNLSNLTYLSLSINFLTGKI 207

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           P   G       L LS N L G +P+S+     + +LD++ N + G +P G
Sbjct: 208 PSNIGMLYNLRNLSLSRNLLEGSIPSSITNCTGLLYLDLAFNRITGKLPWG 258

 Score =  106 bits (265), Expect = 1e-21
 Identities = 61/169 (36%), Positives = 91/169 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +S L  L+L  N ++GE+PS+ G  + L    L RNQ  G IP  +  + RL  
Sbjct: 64  PREIGNLSNLEVLELYGNSLVGEIPSELGSCKNLVNLELYRNQFTGAIPSELGNLIRLET 123

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  NR+  +IP+ L ++ +L+ L L  N +TG +P  L S   + +L L  N F G I
Sbjct: 124 LRLYKNRLNSTIPLSLFQLTLLTNLGLSENQLTGMVPRELGSLKSLQVLTLHSNKFTGQI 183

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P    + S    L LS N LTG++P+++     + +L +S N L G+IP
Sbjct: 184 PRSITNLSNLTYLSLSINFLTGKIPSNIGMLYNLRNLSLSRNLLEGSIP 232

 Score =  104 bits (259), Expect = 6e-21
 Identities = 61/169 (36%), Positives = 85/169 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+SI  +  L  L +S N + G +P + G L  L    L  N L+G IP  +     L +
Sbjct: 40  PVSIGELQTLQGLHISENHLSGVIPREIGNLSNLEVLELYGNSLVGEIPSELGSCKNLVN 99

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L  N+ TG+IP  LG +  L TL+L  N +   IP +L   T +  L LS N   G +
Sbjct: 100 LELYRNQFTGAIPSELGNLIRLETLRLYKNRLNSTIPLSLFQLTLLTNLGLSENQLTGMV 159

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   GS     VL L  NK TG++P S+     + +L +S N L G IP
Sbjct: 160 PRELGSLKSLQVLTLHSNKFTGQIPRSITNLSNLTYLSLSINFLTGKIP 208

 Score =  103 bits (256), Expect = 1e-20
 Identities = 61/171 (35%), Positives = 93/171 (54%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +S L+ L L+ N+  G +P    KL  L    L  N L G IP+++ ++  L  
Sbjct: 328 PPEIGNLSQLITLSLAGNRFSGLIPPTLFKLSLLQGLSLHSNALEGAIPENIFELKHLTV 387

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L +NR+TG IP  + K+ +LS L L+ N   G IP+ +     +  L+LS N  +G+I
Sbjct: 388 LMLGVNRLTGQIPAAISKLEMLSDLDLNSNMFNGSIPTGMERLIRLSSLDLSHNHLKGSI 447

Query: 363 PD--VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   +   K+  + L+LS+N L G +P  L K   +  +D+SNN+L G IP
Sbjct: 448 PGLMIASMKNMQISLNLSYNLLGGNIPVELGKLDAVQGIDLSNNNLSGIIP 498

 Score =  100 bits (248), Expect = 1e-19
 Identities = 56/171 (32%), Positives = 92/171 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+S+ +++ L +L LS NQ+ G +P + G L+ L    L  N+  G IP S+  ++ L  
Sbjct: 136 PLSLFQLTLLTNLGLSENQLTGMVPRELGSLKSLQVLTLHSNKFTGQIPRSITNLSNLTY 195

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS+N +TG IP  +G +  L  L L  N + G IPS++ + TG+  L+L+ N   G +
Sbjct: 196 LSLSINFLTGKIPSNIGMLYNLRNLSLSRNLLEGSIPSSITNCTGLLYLDLAFNRITGKL 255

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           P   G       L L  NK++G +P+ L     +  L+++ N+  G +  G
Sbjct: 256 PWGLGQLHNLTRLSLGPNKMSGEIPDDLYNCSNLEVLNLAENNFSGLLKPG 306

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 54/156 (34%), Positives = 77/156 (49%)
 Frame = +3

Query: 42  DLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIP 221
           D++++Q  G +P   G+L+ L    +S N L G IP  +  ++ L  L+L  N + G IP
Sbjct: 30  DITSSQK-GSIPVSIGELQTLQGLHISENHLSGVIPREIGNLSNLEVLELYGNSLVGEIP 88

Query: 222 VRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVL 401
             LG  + L  L+L  N  TG IPS L +   +  L L +N    TIP      +    L
Sbjct: 89  SELGSCKNLVNLELYRNQFTGAIPSELGNLIRLETLRLYKNRLNSTIPLSLFQLTLLTNL 148

Query: 402 DLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            LS N+LTG VP  L   K +  L + +N   G IP
Sbjct: 149 GLSENQLTGMVPRELGSLKSLQVLTLHSNKFTGQIP 184

[118][TOP]
>UniRef100_A9RP08 ERL1b AtERECTA-like receptor S/T protein kinase protein n=1
           Tax=Physcomitrella patens subsp. patens
           RepID=A9RP08_PHYPA
          Length = 907

 Score =  124 bits (312), Expect = 4e-27
 Identities = 70/182 (38%), Positives = 106/182 (58%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  ++ L  L L NN I G +P +FG L +L+   LS N L G IP  +  +  L +
Sbjct: 293 PPILGNLTCLTKLYLYNNNITGHIPIEFGNLSRLNYLELSGNSLTGQIPSELSYLTGLFE 352

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N+I+GSIPV +  +  L+ L + GN + G IP  L   T +  LNLS N F G++
Sbjct: 353 LDLSENQISGSIPVNISSLTALNILNVHGNQLNGSIPPGLQQLTNLTRLNLSSNHFTGSV 412

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P+  G      +LDLS N LTG+VP+S++  + +  +D+  N+L G+IP+   F +L + 
Sbjct: 413 PEEIGMIVNLDILDLSHNNLTGQVPSSISTLEHLVSIDLHENNLNGSIPMA--FGNLKSL 470

Query: 543 SF 548
           +F
Sbjct: 471 NF 472

 Score =  122 bits (307), Expect = 2e-26
 Identities = 74/215 (34%), Positives = 111/215 (51%), Gaps = 24/215 (11%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  ++GL  LDLS NQI G +P +   L  L+   +  NQL G+IP  + ++  L  
Sbjct: 341 PSELSYLTGLFELDLSENQISGSIPVNISSLTALNILNVHGNQLNGSIPPGLQQLTNLTR 400

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LS N  TGS+P  +G +  L  L L  N++TGQ+PS++ +   +  ++L  N   G+I
Sbjct: 401 LNLSSNHFTGSVPEEIGMIVNLDILDLSHNNLTGQVPSSISTLEHLVSIDLHENNLNGSI 460

Query: 363 PDVFGS-KSY-----------------------FMVLDLSFNKLTGRVPNSLAKAKFMGH 470
           P  FG+ KS                         + LDLS+N L+G +P  L +   + H
Sbjct: 461 PMAFGNLKSLNFLDLSHNHIQGPIPLELGQLLELLHLDLSYNNLSGSIPVPLKECFGLKH 520

Query: 471 LDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCGN 575
           L++S NHL GNIP    F    A+S++ N  LC N
Sbjct: 521 LNLSYNHLSGNIPPDELFSRFPASSYAGNPLLCTN 555

 Score =  105 bits (261), Expect = 3e-21
 Identities = 66/176 (37%), Positives = 98/176 (55%), Gaps = 2/176 (1%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L  N++ G +P+  G ++ L    LS NQL G IP  +  +  L  L L  N ITG I
Sbjct: 257 LSLEGNRLSGGIPNVLGLMQALVILDLSNNQLEGEIPPILGNLTCLTKLYLYNNNITGHI 316

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P+  G +  L+ L+L GNS+TGQIPS L   TG+  L+LS N   G+IP    S +   +
Sbjct: 317 PIEFGNLSRLNYLELSGNSLTGQIPSELSYLTGLFELDLSENQISGSIPVNISSLTALNI 376

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAASFSNND 560
           L++  N+L G +P  L +   +  L++S+NH  G++P  IG    +LD    S+N+
Sbjct: 377 LNVHGNQLNGSIPPGLQQLTNLTRLNLSSNHFTGSVPEEIGM-IVNLDILDLSHNN 431

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 62/185 (33%), Positives = 93/185 (50%), Gaps = 24/185 (12%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L +L L +NQ+ G L  D  K  +L+   +  N+L G +P  +        LDLS N  +
Sbjct: 183 LQYLMLKSNQLTGGLSDDMCKSTQLAYFNVRENKLSGPLPACIGNCTSFQILDLSHNNFS 242

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV------ 371
           G IP  +G ++V STL L+GN ++G IP+ L     + IL+LS N  EG IP +      
Sbjct: 243 GEIPYNIGYLQV-STLSLEGNRLSGGIPNVLGLMQALVILDLSNNQLEGEIPPILGNLTC 301

Query: 372 ------------------FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLC 497
                             FG+ S    L+LS N LTG++P+ L+    +  LD+S N + 
Sbjct: 302 LTKLYLYNNNITGHIPIEFGNLSRLNYLELSGNSLTGQIPSELSYLTGLFELDLSENQIS 361

Query: 498 GNIPI 512
           G+IP+
Sbjct: 362 GSIPV 366

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 52/169 (30%), Positives = 83/169 (49%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ I   + L  +DLS N + GE+P    +L+ L    L  N+  G IP S   ++ L  
Sbjct: 102 PIEICNCTSLTWIDLSGNNLNGEIPYLLSQLQLLEVLNLRNNKFSGPIPSSFASLSNLRH 161

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LD+ +N ++G IP  L     L  L L  N +TG +   +  +T +   N+  N   G +
Sbjct: 162 LDMQINNLSGPIPPLLYWSETLQYLMLKSNQLTGGLSDDMCKSTQLAYFNVRENKLSGPL 221

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+ + F +LDLS N  +G +P ++   + +  L +  N L G IP
Sbjct: 222 PACIGNCTSFQILDLSHNNFSGEIPYNIGYLQ-VSTLSLEGNRLSGGIP 269

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 57/172 (33%), Positives = 86/172 (50%), Gaps = 4/172 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + +++ L  L+LS+N   G +P + G +  L    LS N L G +P S+  +  L  
Sbjct: 389 PPGLQQLTNLTRLNLSSNHFTGSVPEEIGMIVNLDILDLSHNNLTGQVPSSISTLEHLVS 448

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +DL  N + GSIP+  G ++ L+ L L  N + G IP  L     +  L+LS N   G+I
Sbjct: 449 IDLHENNLNGSIPMAFGNLKSLNFLDLSHNHIQGPIPLELGQLLELLHLDLSYNNLSGSI 508

Query: 363 P----DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P    + FG K     L+LS+N L+G +P     ++F       N  LC NI
Sbjct: 509 PVPLKECFGLKH----LNLSYNHLSGNIPPDELFSRFPASSYAGNPLLCTNI 556

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 47/157 (29%), Positives = 78/157 (49%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+LS+  + GE+    G L  L    LS+N + G +P  +     L  +DLS N + G I
Sbjct: 66  LNLSDLALSGEISPSIGLLWNLQVLDLSQNSIFGQLPIEICNCTSLTWIDLSGNNLNGEI 125

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  L ++++L  L L  N  +G IPS+  S + +  L++  N   G IP +         
Sbjct: 126 PYLLSQLQLLEVLNLRNNKFSGPIPSSFASLSNLRHLDMQINNLSGPIPPLLYWSETLQY 185

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           L L  N+LTG + + + K+  + + ++  N L G +P
Sbjct: 186 LMLKSNQLTGGLSDDMCKSTQLAYFNVRENKLSGPLP 222

[119][TOP]
>UniRef100_A7Q1E5 Chromosome chr10 scaffold_43, whole genome shotgun sequence n=1
            Tax=Vitis vinifera RepID=A7Q1E5_VITVI
          Length = 978

 Score =  124 bits (312), Expect = 4e-27
 Identities = 73/192 (38%), Positives = 104/192 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  +  L +L LS+N++ G +PS FG L  L    L  N L   IP S   +  L  
Sbjct: 459  PNDLFHLKNLGYLHLSSNKLSGSIPSCFGDLPALRELSLDSNVLAFNIPMSFWSLRDLLV 518

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L LS N +TG++P  +G M+ ++TL L  N ++G IP  +     +  L LS+N  +G+I
Sbjct: 519  LSLSSNFLTGNLPPEVGNMKSITTLDLSKNLISGYIPRRMGELQNLVNLCLSQNKLQGSI 578

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  FG       +DLS N L+G +P SL    ++ HL++S N L G IP G PF +  A 
Sbjct: 579  PVEFGDLLSLESMDLSQNNLSGTIPKSLEALIYLKHLNVSFNKLQGEIPDGGPFVNFTAE 638

Query: 543  SFSNNDCLCGNP 578
            SF  N+ LCG P
Sbjct: 639  SFIFNEALCGAP 650

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 62/170 (36%), Positives = 86/170 (50%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  +S L+++ LS N + G LP D      KL    LS N L G +P  + +  +L 
Sbjct: 90  PTTIFNMSSLLNISLSYNSLSGSLPMDICYTNLKLKELNLSSNHLSGKVPTGLGQCIKLQ 149

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            + LS N  TGSIP  +G +  L +L L  NS+TG+IP +L +   +  LNL  N  EG 
Sbjct: 150 GISLSYNDFTGSIPSGIGNLVELQSLSLQNNSLTGEIPQSLFNIYSLRFLNLEINNLEGE 209

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           I   F       VL LS N+ TG +P +L     +  L +  N L G IP
Sbjct: 210 ISS-FSHCRELRVLKLSINQFTGGIPKALGSLSDLEELYLGYNKLTGGIP 258

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 65/189 (34%), Positives = 96/189 (50%), Gaps = 3/189 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLS--RNQLIGTIPDSVLKMNRLADLDLS 194
           +S L+ LDLSNN   G LP D GK+  L   +LS   N L G+IP ++  M+ L ++ LS
Sbjct: 48  LSFLVSLDLSNNYFHGSLPKDIGKI--LINFILSFPMNNLTGSIPTTIFNMSSLLNISLS 105

Query: 195 MNRITGSIPVRLGKMRV-LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
            N ++GS+P+ +    + L  L L  N ++G++P+ L     +  ++LS N F G+IP  
Sbjct: 106 YNSLSGSLPMDICYTNLKLKELNLSSNHLSGKVPTGLGQCIKLQGISLSYNDFTGSIPSG 165

Query: 372 FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFS 551
            G+      L L  N LTG +P SL     +  L++  N+L G I   S    L     S
Sbjct: 166 IGNLVELQSLSLQNNSLTGEIPQSLFNIYSLRFLNLEINNLEGEISSFSHCRELRVLKLS 225

Query: 552 NNDCLCGNP 578
            N    G P
Sbjct: 226 INQFTGGIP 234

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 58/168 (34%), Positives = 80/168 (47%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           S+     L  L +  N + G LP+  G L   L     S     GTIP  +  +  L  L
Sbjct: 364 SLTNCKFLRTLWIDYNPLKGTLPNSLGNLSVALESFTASACHFRGTIPTGIGNLTNLIWL 423

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           DL  N +TGSIP  LG+++ L  L + GN + G IP+ L     +G L+LS N   G+IP
Sbjct: 424 DLGANDLTGSIPTTLGQLQKLQRLYIAGNRIQGSIPNDLFHLKNLGYLHLSSNKLSGSIP 483

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             FG       L L  N L   +P S    + +  L +S+N L GN+P
Sbjct: 484 SCFGDLPALRELSLDSNVLAFNIPMSFWSLRDLLVLSLSSNFLTGNLP 531

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 53/148 (35%), Positives = 75/148 (50%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRV 245
           G +P+  G L  L    L  N L G+IP ++ ++ +L  L ++ NRI GSIP  L  ++ 
Sbjct: 408 GTIPTGIGNLTNLIWLDLGANDLTGSIPTTLGQLQKLQRLYIAGNRIQGSIPNDLFHLKN 467

Query: 246 LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLT 425
           L  L L  N ++G IPS       +  L+L  N     IP  F S    +VL LS N LT
Sbjct: 468 LGYLHLSSNKLSGSIPSCFGDLPALRELSLDSNVLAFNIPMSFWSLRDLLVLSLSSNFLT 527

Query: 426 GRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G +P  +   K +  LD+S N + G IP
Sbjct: 528 GNLPPEVGNMKSITTLDLSKNLISGYIP 555

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 58/176 (32%), Positives = 81/176 (46%), Gaps = 6/176 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L  L L NN + GE+P     +  L    L  N L G I  S      L  
Sbjct: 163 PSGIGNLVELQSLSLQNNSLTGEIPQSLFNIYSLRFLNLEINNLEGEI-SSFSHCRELRV 221

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS+N+ TG IP  LG +  L  L L  N +TG IP  +   + + IL+L+ N   G+I
Sbjct: 222 LKLSINQFTGGIPKALGSLSDLEELYLGYNKLTGGIPREIGILSNLNILHLATNSLIGSI 281

Query: 363 PDVFGSKSYFMVLD-----LSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIPI 512
           P  FG+      L      L+ N L+G +P+S++     +  L I  N   G IP+
Sbjct: 282 PTSFGNLKALKFLQLGPLALAQNHLSGGLPSSISTWLPDLEGLFIGGNEFSGTIPV 337

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 50/156 (32%), Positives = 81/156 (51%), Gaps = 2/156 (1%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           +++S    S   L GTI   V  ++ L  LDLS N   GS+P  +GK+ +   L    N+
Sbjct: 25  QRVSAINSSNMGLEGTIAPQVGNLSFLVSLDLSNNYFHGSLPKDIGKILINFILSFPMNN 84

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFMVLDLSFNKLTGRVPNSLAK 452
           +TG IP+T+ + + +  ++LS N   G++P D+  +      L+LS N L+G+VP  L +
Sbjct: 85  LTGSIPTTIFNMSSLLNISLSYNSLSGSLPMDICYTNLKLKELNLSSNHLSGKVPTGLGQ 144

Query: 453 AKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
              +  + +S N   G+IP G      L + S  NN
Sbjct: 145 CIKLQGISLSYNDFTGSIPSGIGNLVELQSLSLQNN 180

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 55/174 (31%), Positives = 88/174 (50%), Gaps = 4/174 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELP--SDFGKLRKLSRALLSRNQLIGTIPDSVLKMN-R 173
           P+SI  +S L+ L +S+N  IG +   +     + L    +  N L GT+P+S+  ++  
Sbjct: 336 PVSISNMSKLIRLHISDNYFIGNVGFLTSLTNCKFLRTLWIDYNPLKGTLPNSLGNLSVA 395

Query: 174 LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L     S     G+IP  +G +  L  L L  N +TG IP+TL     +  L ++ N  +
Sbjct: 396 LESFTASACHFRGTIPTGIGNLTNLIWLDLGANDLTGSIPTTLGQLQKLQRLYIAGNRIQ 455

Query: 354 GTIP-DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           G+IP D+F  K+    L LS NKL+G +P+       +  L + +N L  NIP+
Sbjct: 456 GSIPNDLFHLKN-LGYLHLSSNKLSGSIPSCFGDLPALRELSLDSNVLAFNIPM 508

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 55/165 (33%), Positives = 78/165 (47%), Gaps = 8/165 (4%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L LS NQ  G +P   G L  L    L  N+L G IP  +  ++ L  L L+ N + GSI
Sbjct: 222 LKLSINQFTGGIPKALGSLSDLEELYLGYNKLTGGIPREIGILSNLNILHLATNSLIGSI 281

Query: 219 PVRLGKMRVLSTLKLDG-----NSMTGQIPSTLLS-NTGMGILNLSRNGFEGTIPDVFGS 380
           P   G ++ L  L+L       N ++G +PS++ +    +  L +  N F GTIP    +
Sbjct: 282 PTSFGNLKALKFLQLGPLALAQNHLSGGLPSSISTWLPDLEGLFIGGNEFSGTIPVSISN 341

Query: 381 KSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
            S  + L +S N   G V    SL   KF+  L I  N L G +P
Sbjct: 342 MSKLIRLHISDNYFIGNVGFLTSLTNCKFLRTLWIDYNPLKGTLP 386

[120][TOP]
>UniRef100_A7PVH7 Chromosome chr9 scaffold_33, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PVH7_VITVI
          Length = 691

 Score =  124 bits (312), Expect = 4e-27
 Identities = 68/192 (35%), Positives = 106/192 (55%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I ++  L+ L L+NNQ+ G +P+  G+L  L    L  N+L  TIP ++  +N +  
Sbjct: 135 PNDICQLRNLVELYLANNQLSGSIPACLGELAFLRHLYLGSNKLNSTIPLTLWSLNDILS 194

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LD+S N + G +P  +G ++VL  + L  N ++G+IPS +     +  L+L+ N  EG I
Sbjct: 195 LDMSSNFLVGYLPSDMGNLKVLVKIDLSRNQLSGEIPSNIGGLLDLTSLSLAHNRLEGPI 254

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
              F +      +DLS N L+G +P SL    ++ +L++S N L G IP   PF +  A 
Sbjct: 255 LHSFSNLKSLEFMDLSDNALSGEIPKSLEGLVYLKYLNMSFNRLYGEIPTEGPFANFSAE 314

Query: 543 SFSNNDCLCGNP 578
           SF  N  LCG+P
Sbjct: 315 SFMMNKALCGSP 326

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 64/188 (34%), Positives = 99/188 (52%), Gaps = 3/188 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHL-DLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P+SI  +S  + L   S  ++ G +P++ G L  L +  L+ N L GTIP S+ ++ +L 
Sbjct: 62  PISIGNLSTSLQLFGASTCKLKGNIPTEIGNLSNLYQLSLNNNDLTGTIPPSIGQLQKLQ 121

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N++ GSIP  + ++R L  L L  N ++G IP+ L     +  L L  N    T
Sbjct: 122 GLYLPANKLQGSIPNDICQLRNLVELYLANNQLSGSIPACLGELAFLRHLYLGSNKLNST 181

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHL 533
           IP    S +  + LD+S N L G +P+ +   K +  +D+S N L G IP  IG   D L
Sbjct: 182 IPLTLWSLNDILSLDMSSNFLVGYLPSDMGNLKVLVKIDLSRNQLSGEIPSNIGGLLD-L 240

Query: 534 DAASFSNN 557
            + S ++N
Sbjct: 241 TSLSLAHN 248

[121][TOP]
>UniRef100_A7P9R4 Chromosome chr14 scaffold_9, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7P9R4_VITVI
          Length = 547

 Score =  124 bits (312), Expect = 4e-27
 Identities = 73/191 (38%), Positives = 109/191 (57%), Gaps = 5/191 (2%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           +S L HLDL +N+  G +PS  G+ +  L    L  N   G IP  +  ++ L  LDLS 
Sbjct: 269 LSSLKHLDLGDNKFSGNIPSWVGETMPSLLILALRSNFFSGNIPSEICALSALHILDLSH 328

Query: 198 NRITGSIPVRLG---KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           N ++G IP  +     + ++++L L  N+++G+IP  L S   +G LNLS N   GTIP+
Sbjct: 329 NNVSGFIPPSIEYYHSLYLVNSLDLSCNNLSGEIPIELTSLLKLGTLNLSSNNLGGTIPE 388

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHL-DAAS 545
             G+  +   LDLS NKL+G +P S+A   F+ HL++S+N+L G IP G+    L D + 
Sbjct: 389 KIGNLQWLETLDLSRNKLSGPIPMSMASITFLAHLNLSHNNLSGKIPTGNQLQTLIDPSI 448

Query: 546 FSNNDCLCGNP 578
           +  N  LCG P
Sbjct: 449 YQGNLALCGFP 459

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 60/171 (35%), Positives = 91/171 (53%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLI-GTIPDSVLKMNRLA 179
           P  +  +S L++LDL++N + G LP  F     L    LS+N  I G  P ++     L 
Sbjct: 118 PHWLFNLSSLVYLDLNSNNLQGGLPDAFQNFTSLQLLDLSKNSNIEGEFPRTLGNFT-LE 176

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           +LDL  N++TG++P  LG ++ L  L+L  NS  G IP ++ S + +  L LS+N   G 
Sbjct: 177 NLDLGFNKLTGNLPDSLGHLKNLRYLQLRSNSFRGPIPESIGSLSSLQELYLSQNQMGGI 236

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNS-LAKAKFMGHLDISNNHLCGNIP 509
           IPD  G  S  +V +L+ N   G +  +  A    + HLD+ +N   GNIP
Sbjct: 237 IPDSLGQLSSLVVQELNENSWEGVITEAHFANLSSLKHLDLGDNKFSGNIP 287

 Score = 67.4 bits (163), Expect = 8e-10
 Identities = 46/123 (37%), Positives = 66/123 (53%), Gaps = 3/123 (2%)
 Frame = +3

Query: 159 LKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLS 338
           L    L+ LDLS N    +IP  L  +  L  L L+ N++ G +P    + T + +L+LS
Sbjct: 98  LNFTSLSVLDLSNNGFDSTIPHWLFNLSSLVYLDLNSNNLQGGLPDAFQNFTSLQLLDLS 157

Query: 339 RN-GFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP-- 509
           +N   EG  P   G+ +    LDL FNKLTG +P+SL   K + +L + +N   G IP  
Sbjct: 158 KNSNIEGEFPRTLGNFT-LENLDLGFNKLTGNLPDSLGHLKNLRYLQLRSNSFRGPIPES 216

Query: 510 IGS 518
           IGS
Sbjct: 217 IGS 219

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 45/143 (31%), Positives = 61/143 (42%), Gaps = 1/143 (0%)
 Frame = +3

Query: 84  FGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKL 263
           F     LS   LS N    TIP  +  ++ L  LDL+ N + G +P        L  L L
Sbjct: 97  FLNFTSLSVLDLSNNGFDSTIPHWLFNLSSLVYLDLNSNNLQGGLPDAFQNFTSLQLLDL 156

Query: 264 DGNS-MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPN 440
             NS + G+ P T L N  +  L+L  N   G +PD  G       L L  N   G +P 
Sbjct: 157 SKNSNIEGEFPRT-LGNFTLENLDLGFNKLTGNLPDSLGHLKNLRYLQLRSNSFRGPIPE 215

Query: 441 SLAKAKFMGHLDISNNHLCGNIP 509
           S+     +  L +S N + G IP
Sbjct: 216 SIGSLSSLQELYLSQNQMGGIIP 238

[122][TOP]
>UniRef100_A5A5Z1 Putative receptor-like protein kinase n=1 Tax=Capsicum frutescens
            RepID=A5A5Z1_CAPFR
          Length = 1126

 Score =  124 bits (312), Expect = 4e-27
 Identities = 69/194 (35%), Positives = 107/194 (55%), Gaps = 2/194 (1%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P     + G+ +L+LS+N + G +PS FG L  L    LS N + G+IP  +   + L D
Sbjct: 544  PEGFSSLLGMQYLNLSSNSLSGHIPSTFGFLTSLVVLSLSNNHINGSIPPDLANCSALED 603

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDL  N ++G IP  LG++ +LS L L  N++TG++P  + + + +  L L  N   G I
Sbjct: 604  LDLHSNSLSGQIPADLGRLSLLSVLDLGRNNLTGEVPIDISNCSSLTSLVLDLNHLSGNI 663

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI--GSPFDHLD 536
            P+     S   VLDLS N  +G +P +L     +   ++SNN+L G IP+  GS F+  +
Sbjct: 664  PESLSRLSNLTVLDLSTNNFSGEIPANLTMLSSLVSFNVSNNNLVGQIPVMLGSRFN--N 721

Query: 537  AASFSNNDCLCGNP 578
            +  ++ N  LCG P
Sbjct: 722  SLDYAGNQGLCGEP 735

 Score =  115 bits (287), Expect = 3e-24
 Identities = 63/171 (36%), Positives = 90/171 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I   S L  LDL  N++ G++P   G LR L    L RNQ  G+IP S   +  L +
Sbjct: 376 PFEITNCSSLKVLDLEGNRMTGKIPMFLGYLRSLKTLSLGRNQFSGSIPSSFRNLTNLEN 435

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L  N + GS+P  +  +  LS L L GN  +G +P  + +   + +LNLS+NGF GTI
Sbjct: 436 LNLGGNGLNGSLPEEVMSLSNLSILNLSGNKFSGSMPIGIGNLQQLSVLNLSKNGFSGTI 495

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           P   G+     V+DLS    +G +P  LA    +  + +  N L GN+P G
Sbjct: 496 PSSIGTLYKLTVVDLSGQNFSGEIPFDLAGLPNLQVISLQENKLSGNVPEG 546

 Score =  112 bits (280), Expect = 2e-23
 Identities = 63/169 (37%), Positives = 89/169 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  ++ +S L  L+LS N+  G +P   G L++LS   LS+N   GTIP S+  + +L  
Sbjct: 448 PEEVMSLSNLSILNLSGNKFSGSMPIGIGNLQQLSVLNLSKNGFSGTIPSSIGTLYKLTV 507

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +DLS    +G IP  L  +  L  + L  N ++G +P    S  GM  LNLS N   G I
Sbjct: 508 VDLSGQNFSGEIPFDLAGLPNLQVISLQENKLSGNVPEGFSSLLGMQYLNLSSNSLSGHI 567

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P  FG  +  +VL LS N + G +P  LA    +  LD+ +N L G IP
Sbjct: 568 PSTFGFLTSLVVLSLSNNHINGSIPPDLANCSALEDLDLHSNSLSGQIP 616

 Score =  109 bits (273), Expect = 1e-22
 Identities = 65/186 (34%), Positives = 99/186 (53%), Gaps = 1/186 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           PM +  +  L  L L  NQ  G +PS F  L  L    L  N L G++P+ V+ ++ L+ 
Sbjct: 400 PMFLGYLRSLKTLSLGRNQFSGSIPSSFRNLTNLENLNLGGNGLNGSLPEEVMSLSNLSI 459

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LS N+ +GS+P+ +G ++ LS L L  N  +G IPS++ +   + +++LS   F G I
Sbjct: 460 LNLSGNKFSGSMPIGIGNLQQLSVLNLSKNGFSGTIPSSIGTLYKLTVVDLSGQNFSGEI 519

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF-DHLDA 539
           P          V+ L  NKL+G VP   +    M +L++S+N L G+IP    F   L  
Sbjct: 520 PFDLAGLPNLQVISLQENKLSGNVPEGFSSLLGMQYLNLSSNSLSGHIPSTFGFLTSLVV 579

Query: 540 ASFSNN 557
            S SNN
Sbjct: 580 LSLSNN 585

 Score =  105 bits (261), Expect = 3e-21
 Identities = 60/169 (35%), Positives = 89/169 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ +   S L  LD+S N   G++PS  G L +L    +  N     +P  +   + L  
Sbjct: 328 PLILTNNSALTSLDVSWNLFSGKIPSAIGNLWRLELLRMGNNSFEAGLPFEITNCSSLKV 387

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL  NR+TG IP+ LG +R L TL L  N  +G IPS+  + T +  LNL  NG  G++
Sbjct: 388 LDLEGNRMTGKIPMFLGYLRSLKTLSLGRNQFSGSIPSSFRNLTNLENLNLGGNGLNGSL 447

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P+   S S   +L+LS NK +G +P  +   + +  L++S N   G IP
Sbjct: 448 PEEVMSLSNLSILNLSGNKFSGSMPIGIGNLQQLSVLNLSKNGFSGTIP 496

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 64/187 (34%), Positives = 87/187 (46%), Gaps = 1/187 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P SI  +  L  +DLS     GE+P D   L  L    L  N+L G +P+    +  +  
Sbjct: 496  PSSIGTLYKLTVVDLSGQNFSGEIPFDLAGLPNLQVISLQENKLSGNVPEGFSSLLGMQY 555

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N ++G IP   G +  L  L L  N + G IP  L + + +  L+L  N   G I
Sbjct: 556  LNLSSNSLSGHIPSTFGFLTSLVVLSLSNNHINGSIPPDLANCSALEDLDLHSNSLSGQI 615

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDA 539
            P   G  S   VLDL  N LTG VP  ++    +  L +  NHL GNIP   S   +L  
Sbjct: 616  PADLGRLSLLSVLDLGRNNLTGEVPIDISNCSSLTSLVLDLNHLSGNIPESLSRLSNLTV 675

Query: 540  ASFSNND 560
               S N+
Sbjct: 676  LDLSTNN 682

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 55/164 (33%), Positives = 79/164 (48%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L  LDL +NQI GE P        L+   +S N   G IP ++  + RL  L +  N 
Sbjct: 311 SSLQILDLQHNQIHGEFPLILTNNSALTSLDVSWNLFSGKIPSAIGNLWRLELLRMGNNS 370

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
               +P  +     L  L L+GN MTG+IP  L     +  L+L RN F G+IP  F + 
Sbjct: 371 FEAGLPFEITNCSSLKVLDLEGNRMTGKIPMFLGYLRSLKTLSLGRNQFSGSIPSSFRNL 430

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           +    L+L  N L G +P  +     +  L++S N   G++PIG
Sbjct: 431 TNLENLNLGGNGLNGSLPEEVMSLSNLSILNLSGNKFSGSMPIG 474

 Score = 84.0 bits (206), Expect = 8e-15
 Identities = 58/200 (29%), Positives = 94/200 (47%), Gaps = 8/200 (4%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +S L+ ++LS N+  GE+P+  G+L++L    L+ N L+GT+  ++     L  
Sbjct: 178 PRYLSDLSQLLLINLSYNRFSGEIPASIGRLQQLQYLWLAYNDLVGTLSSAIANCLSLVH 237

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT-----GMGILNLSRNG 347
           L    N I G IP  +  +  L  + L  N+++G +P++L  N       + I+ L  NG
Sbjct: 238 LSAEGNAIRGVIPAAIAALPKLQVISLSRNNLSGSLPASLFCNVSIYPPSLRIVQLGFNG 297

Query: 348 FEGTIPDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS 518
           F   +        S   +LDL  N++ G  P  L     +  LD+S N   G IP  IG+
Sbjct: 298 FTDIVKQESAKCFSSLQILDLQHNQIHGEFPLILTNNSALTSLDVSWNLFSGKIPSAIGN 357

Query: 519 PFDHLDAASFSNNDCLCGNP 578
            +  L+     NN    G P
Sbjct: 358 LW-RLELLRMGNNSFEAGLP 376

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 57/197 (28%), Positives = 86/197 (43%), Gaps = 30/197 (15%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSV---------- 158
           +I     L+HL    N I G +P+    L KL    LSRN L G++P S+          
Sbjct: 228 AIANCLSLVHLSAEGNAIRGVIPAAIAALPKLQVISLSRNNLSGSLPASLFCNVSIYPPS 287

Query: 159 -----LKMNRLAD---------------LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSM 278
                L  N   D               LDL  N+I G  P+ L     L++L +  N  
Sbjct: 288 LRIVQLGFNGFTDIVKQESAKCFSSLQILDLQHNQIHGEFPLILTNNSALTSLDVSWNLF 347

Query: 279 TGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAK 458
           +G+IPS + +   + +L +  N FE  +P    + S   VLDL  N++TG++P  L   +
Sbjct: 348 SGKIPSAIGNLWRLELLRMGNNSFEAGLPFEITNCSSLKVLDLEGNRMTGKIPMFLGYLR 407

Query: 459 FMGHLDISNNHLCGNIP 509
            +  L +  N   G+IP
Sbjct: 408 SLKTLSLGRNQFSGSIP 424

 Score = 77.8 bits (190), Expect = 6e-13
 Identities = 45/156 (28%), Positives = 79/156 (50%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L + Q+ G L +  G LR L +  L  N   GT+P S+ K   L  + L  N  +G +
Sbjct: 72  LRLPHLQLTGPLTNQIGNLRTLRKLSLRSNSFNGTVPASLSKCTLLHSVFLQGNAFSGKL 131

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           PV +  +  L    + GN ++G+IP  +     +   +LS   F G IP      S  ++
Sbjct: 132 PVEIFNLADLQVFNVAGNQLSGEIPGEV--PRSLRYFDLSSILFTGDIPRYLSDLSQLLL 189

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           ++LS+N+ +G +P S+ + + + +L ++ N L G +
Sbjct: 190 INLSYNRFSGEIPASIGRLQQLQYLWLAYNDLVGTL 225

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 47/167 (28%), Positives = 84/167 (50%), Gaps = 6/167 (3%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L + DLS+    G++P     L +L    LS N+  G IP S+ ++ +L  L L+ N + 
Sbjct: 163 LRYFDLSSILFTGDIPRYLSDLSQLLLINLSYNRFSGEIPASIGRLQQLQYLWLAYNDLV 222

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKS 386
           G++   +     L  L  +GN++ G IP+ + +   + +++LSRN   G++P  +F + S
Sbjct: 223 GTLSSAIANCLSLVHLSAEGNAIRGVIPAAIAALPKLQVISLSRNNLSGSLPASLFCNVS 282

Query: 387 YF----MVLDLSFNKLTGRVPNSLAKA-KFMGHLDISNNHLCGNIPI 512
            +     ++ L FN  T  V    AK    +  LD+ +N + G  P+
Sbjct: 283 IYPPSLRIVQLGFNGFTDIVKQESAKCFSSLQILDLQHNQIHGEFPL 329

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 48/170 (28%), Positives = 73/170 (42%), Gaps = 22/170 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+ + + L  + L  N   G+LP +   L  L    ++ NQL G IP  V +  R  D
Sbjct: 108 PASLSKCTLLHSVFLQGNAFSGKLPVEIFNLADLQVFNVAGNQLSGEIPGEVPRSLRYFD 167

Query: 183 L----------------------DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS 296
           L                      +LS NR +G IP  +G+++ L  L L  N + G + S
Sbjct: 168 LSSILFTGDIPRYLSDLSQLLLINLSYNRFSGEIPASIGRLQQLQYLWLAYNDLVGTLSS 227

Query: 297 TLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSL 446
            + +   +  L+   N   G IP    +     V+ LS N L+G +P SL
Sbjct: 228 AIANCLSLVHLSAEGNAIRGVIPAAIAALPKLQVISLSRNNLSGSLPASL 277

[123][TOP]
>UniRef100_A3AH11 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A3AH11_ORYSJ
          Length = 791

 Score =  124 bits (312), Expect = 4e-27
 Identities = 72/190 (37%), Positives = 106/190 (55%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +  L+ L LS+N + GE+P   G LR L    LS N + G+IPD +  ++ L  
Sbjct: 174 PSSLTSLPFLVSLQLSSNNLSGEVPPTIGNLRMLHELSLSYNLISGSIPDGIGSLSGLHS 233

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N ++GS+P  L  +  L  LKLDGN + G IP  +     +  L+L RN  +G I
Sbjct: 234 LDLSNNLLSGSLPASLCNLTSLVELKLDGNDIGGHIPDAIDGLKNLTKLSLRRNVLDGEI 293

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P   G+ S   +LD+S N LTG +P SL+    +   ++S N+L G +P+       +A+
Sbjct: 294 PATVGNISALSLLDVSENNLTGGIPESLSGLNNLTSFNVSYNNLSGPVPVALS-SKFNAS 352

Query: 543 SFSNNDCLCG 572
           SF+ N  LCG
Sbjct: 353 SFAGNIQLCG 362

 Score = 96.3 bits (238), Expect = 2e-18
 Identities = 54/164 (32%), Positives = 86/164 (52%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           +++ L  L L +N + G+LP+  G L +L    L  N+  G +P  +     L  LDLS 
Sbjct: 83  QLTALRKLSLHDNALGGQLPASLGFLPELRGVYLFNNRFAGAVPPQLGGCALLQTLDLSG 142

Query: 198 NRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
           N ++G++P  L     L  L L  N++TG +PS+L S   +  L LS N   G +P   G
Sbjct: 143 NFLSGAVPASLANATRLLRLNLAYNNLTGAVPSSLTSLPFLVSLQLSSNNLSGEVPPTIG 202

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +      L LS+N ++G +P+ +     +  LD+SNN L G++P
Sbjct: 203 NLRMLHELSLSYNLISGSIPDGIGSLSGLHSLDLSNNLLSGSLP 246

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 59/169 (34%), Positives = 90/169 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +  L  + L NN+  G +P   G    L    LS N L G +P S+    RL  
Sbjct: 102 PASLGFLPELRGVYLFNNRFAGAVPPQLGGCALLQTLDLSGNFLSGAVPASLANATRLLR 161

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L+ N +TG++P  L  +  L +L+L  N+++G++P T+ +   +  L+LS N   G+I
Sbjct: 162 LNLAYNNLTGAVPSSLTSLPFLVSLQLSSNNLSGEVPPTIGNLRMLHELSLSYNLISGSI 221

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           PD  GS S    LDLS N L+G +P SL     +  L +  N + G+IP
Sbjct: 222 PDGIGSLSGLHSLDLSNNLLSGSLPASLCNLTSLVELKLDGNDIGGHIP 270

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 55/167 (32%), Positives = 86/167 (51%), Gaps = 1/167 (0%)
 Frame = +3

Query: 60  IIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKM 239
           + G L    G+L  L +  L  N L G +P S+  +  L  + L  NR  G++P +LG  
Sbjct: 73  LAGALSDKVGQLTALRKLSLHDNALGGQLPASLGFLPELRGVYLFNNRFAGAVPPQLGGC 132

Query: 240 RVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNK 419
            +L TL L GN ++G +P++L + T +  LNL+ N   G +P    S  + + L LS N 
Sbjct: 133 ALLQTLDLSGNFLSGAVPASLANATRLLRLNLAYNNLTGAVPSSLTSLPFLVSLQLSSNN 192

Query: 420 LTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
           L+G VP ++   + +  L +S N + G+IP G      L +   SNN
Sbjct: 193 LSGEVPPTIGNLRMLHELSLSYNLISGSIPDGIGSLSGLHSLDLSNN 239

[124][TOP]
>UniRef100_A2XFM5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2XFM5_ORYSI
          Length = 791

 Score =  124 bits (312), Expect = 4e-27
 Identities = 72/190 (37%), Positives = 106/190 (55%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +  L+ L LS+N + GE+P   G LR L    LS N + G+IPD +  ++ L  
Sbjct: 174 PSSLTSLPFLVSLQLSSNNLSGEVPPTIGNLRMLHELSLSYNLISGSIPDGIGSLSGLHS 233

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N ++GS+P  L  +  L  LKLDGN + G IP  +     +  L+L RN  +G I
Sbjct: 234 LDLSNNLLSGSLPASLCNLTSLVELKLDGNDIGGHIPDAIDGLKNLTKLSLRRNVLDGEI 293

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P   G+ S   +LD+S N LTG +P SL+    +   ++S N+L G +P+       +A+
Sbjct: 294 PATVGNISALSLLDVSENNLTGGIPESLSGLNNLTSFNVSYNNLSGPVPVALS-SKFNAS 352

Query: 543 SFSNNDCLCG 572
           SF+ N  LCG
Sbjct: 353 SFAGNIQLCG 362

 Score = 96.3 bits (238), Expect = 2e-18
 Identities = 54/164 (32%), Positives = 86/164 (52%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           +++ L  L L +N + G+LP+  G L +L    L  N+  G +P  +     L  LDLS 
Sbjct: 83  QLTALRKLSLHDNALGGQLPASLGFLPELRGVYLFNNRFAGAVPPQLGGCALLQTLDLSG 142

Query: 198 NRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
           N ++G++P  L     L  L L  N++TG +PS+L S   +  L LS N   G +P   G
Sbjct: 143 NFLSGAVPTSLANATRLLRLNLAYNNLTGAVPSSLTSLPFLVSLQLSSNNLSGEVPPTIG 202

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +      L LS+N ++G +P+ +     +  LD+SNN L G++P
Sbjct: 203 NLRMLHELSLSYNLISGSIPDGIGSLSGLHSLDLSNNLLSGSLP 246

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 59/169 (34%), Positives = 90/169 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +  L  + L NN+  G +P   G    L    LS N L G +P S+    RL  
Sbjct: 102 PASLGFLPELRGVYLFNNRFAGAVPPQLGGCALLQTLDLSGNFLSGAVPTSLANATRLLR 161

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L+ N +TG++P  L  +  L +L+L  N+++G++P T+ +   +  L+LS N   G+I
Sbjct: 162 LNLAYNNLTGAVPSSLTSLPFLVSLQLSSNNLSGEVPPTIGNLRMLHELSLSYNLISGSI 221

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           PD  GS S    LDLS N L+G +P SL     +  L +  N + G+IP
Sbjct: 222 PDGIGSLSGLHSLDLSNNLLSGSLPASLCNLTSLVELKLDGNDIGGHIP 270

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 55/167 (32%), Positives = 86/167 (51%), Gaps = 1/167 (0%)
 Frame = +3

Query: 60  IIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKM 239
           + G L    G+L  L +  L  N L G +P S+  +  L  + L  NR  G++P +LG  
Sbjct: 73  LAGALSDKVGQLTALRKLSLHDNALGGQLPASLGFLPELRGVYLFNNRFAGAVPPQLGGC 132

Query: 240 RVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNK 419
            +L TL L GN ++G +P++L + T +  LNL+ N   G +P    S  + + L LS N 
Sbjct: 133 ALLQTLDLSGNFLSGAVPTSLANATRLLRLNLAYNNLTGAVPSSLTSLPFLVSLQLSSNN 192

Query: 420 LTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
           L+G VP ++   + +  L +S N + G+IP G      L +   SNN
Sbjct: 193 LSGEVPPTIGNLRMLHELSLSYNLISGSIPDGIGSLSGLHSLDLSNN 239

[125][TOP]
>UniRef100_UPI00019848CC PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019848CC
          Length = 969

 Score =  124 bits (311), Expect = 5e-27
 Identities = 72/183 (39%), Positives = 100/183 (54%)
 Frame = +3

Query: 27  GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           GL  LDLS N++ G+  S  G  R L    +SRN L+G IP S+  +  L  LDLS N++
Sbjct: 388 GLQVLDLSYNELSGDFTSSIGVFRSLQFLNISRNSLVGAIPASIGDLKALDVLDLSENQL 447

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
            GSIP+ +G    L  L+L  N + G+IP +L + + +  L LS N   G IP      S
Sbjct: 448 NGSIPLEIGGAFSLKDLRLKNNFLAGKIPVSLENCSSLTTLILSHNNLSGPIPMGISKLS 507

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCL 566
               +DLS NKLTG +P  LA    +   +IS+N L G +P G  F+ +  +S S N  L
Sbjct: 508 NLENVDLSLNKLTGSLPKQLANLPHLISFNISHNQLQGELPAGGFFNTISPSSVSGNPSL 567

Query: 567 CGN 575
           CG+
Sbjct: 568 CGS 570

 Score =  104 bits (259), Expect = 6e-21
 Identities = 61/169 (36%), Positives = 86/169 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+   S L  +D S+NQ  G LPS    L  L    LS N L G IP  +  +  L  
Sbjct: 160 PESVGSCSTLAAIDFSSNQFSGPLPSGIWSLNGLRSLDLSDNLLEGDIPKGIDSLYNLRA 219

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           ++LS NR +G +P  +G   +L  +    NS++G +P T+   T    +NL  N FEG +
Sbjct: 220 INLSKNRFSGPLPDGIGGCLLLRLIDFSENSLSGSLPGTMQKLTLCNYMNLHGNSFEGEV 279

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P+  G       LDLS NK +GRVP S+   K +  L+ S N   G++P
Sbjct: 280 PEWIGEMKSLETLDLSANKFSGRVPTSIGNLKSLKVLNFSVNVFSGSLP 328

 Score =  101 bits (252), Expect = 4e-20
 Identities = 55/169 (32%), Positives = 90/169 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++GL  LDLS+N + G++P     L  L    LS+N+  G +PD +     L  
Sbjct: 184 PSGIWSLNGLRSLDLSDNLLEGDIPKGIDSLYNLRAINLSKNRFSGPLPDGIGGCLLLRL 243

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +D S N ++GS+P  + K+ + + + L GNS  G++P  +     +  L+LS N F G +
Sbjct: 244 IDFSENSLSGSLPGTMQKLTLCNYMNLHGNSFEGEVPEWIGEMKSLETLDLSANKFSGRV 303

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+     VL+ S N  +G +P S+   + +  LD+S N L G++P
Sbjct: 304 PTSIGNLKSLKVLNFSVNVFSGSLPESMINCEQLLVLDVSQNSLLGDLP 352

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 53/168 (31%), Positives = 88/168 (52%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           ++ R+  L  +DLS N + G +P DF K    L    L++N+  G IP+SV   + LA +
Sbjct: 113 NLARLQNLRFIDLSENSLSGTIPDDFFKQCGSLHAISLAKNKFSGKIPESVGSCSTLAAI 172

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           D S N+ +G +P  +  +  L +L L  N + G IP  + S   +  +NLS+N F G +P
Sbjct: 173 DFSSNQFSGPLPSGIWSLNGLRSLDLSDNLLEGDIPKGIDSLYNLRAINLSKNRFSGPLP 232

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           D  G      ++D S N L+G +P ++ K     ++++  N   G +P
Sbjct: 233 DGIGGCLLLRLIDFSENSLSGSLPGTMQKLTLCNYMNLHGNSFEGEVP 280

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 52/167 (31%), Positives = 84/167 (50%), Gaps = 1/167 (0%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKM-NRLADLD 188
           ++++  L  L L+ N I G +  +  +L+ L    LS N L GTIPD   K    L  + 
Sbjct: 90  LLQLQFLRKLSLAKNNITGSIGPNLARLQNLRFIDLSENSLSGTIPDDFFKQCGSLHAIS 149

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           L+ N+ +G IP  +G    L+ +    N  +G +PS + S  G+  L+LS N  EG IP 
Sbjct: 150 LAKNKFSGKIPESVGSCSTLAAIDFSSNQFSGPLPSGIWSLNGLRSLDLSDNLLEGDIPK 209

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              S      ++LS N+ +G +P+ +     +  +D S N L G++P
Sbjct: 210 GIDSLYNLRAINLSKNRFSGPLPDGIGGCLLLRLIDFSENSLSGSLP 256

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 60/185 (32%), Positives = 91/185 (49%), Gaps = 7/185 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L  LDLS N+  G +P+  G L+ L     S N   G++P+S++   +L  
Sbjct: 280 PEWIGEMKSLETLDLSANKFSGRVPTSIGNLKSLKVLNFSVNVFSGSLPESMINCEQLLV 339

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT-----GMGILNLSRNG 347
           LD+S N + G +P  + K+ +   L L  NS++G + S   S+      G+ +L+LS N 
Sbjct: 340 LDVSQNSLLGDLPAWIFKLGLQKVL-LSKNSLSGNMDSPFSSSVEKSRQGLQVLDLSYNE 398

Query: 348 FEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSP 521
             G      G       L++S N L G +P S+   K +  LD+S N L G+IP  IG  
Sbjct: 399 LSGDFTSSIGVFRSLQFLNISRNSLVGAIPASIGDLKALDVLDLSENQLNGSIPLEIGGA 458

Query: 522 FDHLD 536
           F   D
Sbjct: 459 FSLKD 463

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 55/191 (28%), Positives = 94/191 (49%), Gaps = 6/191 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++ +++   +++L  N   GE+P   G+++ L    LS N+  G +P S+  +  L  
Sbjct: 256 PGTMQKLTLCNYMNLHGNSFEGEVPEWIGEMKSLETLDLSANKFSGRVPTSIGNLKSLKV 315

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+ S+N  +GS+P  +     L  L +  NS+ G +P+ +    G+  + LS+N   G +
Sbjct: 316 LNFSVNVFSGSLPESMINCEQLLVLDVSQNSLLGDLPAWIF-KLGLQKVLLSKNSLSGNM 374

Query: 363 PDVFG-----SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPF 524
              F      S+    VLDLS+N+L+G   +S+   + +  L+IS N L G IP      
Sbjct: 375 DSPFSSSVEKSRQGLQVLDLSYNELSGDFTSSIGVFRSLQFLNISRNSLVGAIPASIGDL 434

Query: 525 DHLDAASFSNN 557
             LD    S N
Sbjct: 435 KALDVLDLSEN 445

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 42/121 (34%), Positives = 61/121 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +  L  LDLS NQ+ G +P + G    L    L  N L G IP S+   + L  
Sbjct: 428 PASIGDLKALDVLDLSENQLNGSIPLEIGGAFSLKDLRLKNNFLAGKIPVSLENCSSLTT 487

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N ++G IP+ + K+  L  + L  N +TG +P  L +   +   N+S N  +G +
Sbjct: 488 LILSHNNLSGPIPMGISKLSNLENVDLSLNKLTGSLPKQLANLPHLISFNISHNQLQGEL 547

Query: 363 P 365
           P
Sbjct: 548 P 548

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 45/167 (26%), Positives = 83/167 (49%), Gaps = 1/167 (0%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           R + +  L L    + G++     +L+ L +  L++N + G+I  ++ ++  L  +DLS 
Sbjct: 68  RSNRVTDLVLDGFSLSGKIGRGLLQLQFLRKLSLAKNNITGSIGPNLARLQNLRFIDLSE 127

Query: 198 NRITGSIPVRLGKM-RVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVF 374
           N ++G+IP    K    L  + L  N  +G+IP ++ S + +  ++ S N F G +P   
Sbjct: 128 NSLSGTIPDDFFKQCGSLHAISLAKNKFSGKIPESVGSCSTLAAIDFSSNQFSGPLPSGI 187

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
            S +    LDLS N L G +P  +     +  +++S N   G +P G
Sbjct: 188 WSLNGLRSLDLSDNLLEGDIPKGIDSLYNLRAINLSKNRFSGPLPDG 234

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 45/159 (28%), Positives = 78/159 (49%), Gaps = 5/159 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ I     L  L L NN + G++P        L+  +LS N L G IP  + K++ L +
Sbjct: 452 PLEIGGAFSLKDLRLKNNFLAGKIPVSLENCSSLTTLILSHNNLSGPIPMGISKLSNLEN 511

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIP-----STLLSNTGMGILNLSRNG 347
           +DLS+N++TGS+P +L  +  L +  +  N + G++P     +T+  ++  G  +L  + 
Sbjct: 512 VDLSLNKLTGSLPKQLANLPHLISFNISHNQLQGELPAGGFFNTISPSSVSGNPSLCGSA 571

Query: 348 FEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFM 464
              + P V   K   +  + S +   G  P SLA  K +
Sbjct: 572 ANKSCPAVL-PKPIVLNPNSSSDTTAGAFPRSLAHKKII 609

[126][TOP]
>UniRef100_UPI0001983F66 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
            RepID=UPI0001983F66
          Length = 1185

 Score =  124 bits (311), Expect = 5e-27
 Identities = 69/192 (35%), Positives = 104/192 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I ++  L  L L+NNQ+ G +P+  G+L  L    L  N+L  TIP ++  +  +  
Sbjct: 632  PNDICQLRNLGELFLTNNQLSGSIPACLGELTFLRHLYLGSNKLNSTIPSTLWSLIHILS 691

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LD+S N + G +P  +G ++VL  + L  N ++G+IPS +     +  L+L+ N FEG I
Sbjct: 692  LDMSSNFLVGYLPSDMGNLKVLVKIDLSRNQLSGEIPSNIGGLQDLTSLSLAHNRFEGPI 751

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
               F +      +DLS N L G +P SL    ++ +LD+S N L G IP   PF +  A 
Sbjct: 752  LHSFSNLKSLEFMDLSDNALFGEIPKSLEGLVYLKYLDVSFNGLYGEIPPEGPFANFSAE 811

Query: 543  SFSNNDCLCGNP 578
            SF  N  LCG+P
Sbjct: 812  SFMMNKALCGSP 823

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 58/170 (34%), Positives = 90/170 (52%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3    PMSIVRIS-GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
            P+SI  +S  L   + +  ++ G +P++ G L  L    L+ N L GTIP S+ ++ +L 
Sbjct: 559  PISIGNLSTSLQRFEANTCKLKGNIPTEIGNLSNLYLLSLNNNDLTGTIPPSIGQLQKLQ 618

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
             L L  N++ GSIP  + ++R L  L L  N ++G IP+ L   T +  L L  N    T
Sbjct: 619  GLYLPSNKLQGSIPNDICQLRNLGELFLTNNQLSGSIPACLGELTFLRHLYLGSNKLNST 678

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            IP    S  + + LD+S N L G +P+ +   K +  +D+S N L G IP
Sbjct: 679  IPSTLWSLIHILSLDMSSNFLVGYLPSDMGNLKVLVKIDLSRNQLSGEIP 728

 Score = 97.1 bits (240), Expect = 9e-19
 Identities = 60/171 (35%), Positives = 88/171 (51%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +S L+ LDLS+N   G +P + G+L  L    L  N L G IP S   +NRL  
Sbjct: 91  PPDLGNLSFLVSLDLSSNNFHGPVPVEVGQLTSLLSMNLQYNLLSGQIPPSFGNLNRLQS 150

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N  TG+IP  +G M +L TL L GN + G IP  +   + M IL++  N   G I
Sbjct: 151 LFLGNNSFTGTIPPSIGNMSMLETLGLGGNHLQGNIPEEIGKLSTMKILDIQSNQLVGAI 210

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF--MGHLDISNNHLCGNIP 509
           P    + S    + L++N L+G +P+S+   +   +  + +S N   G IP
Sbjct: 211 PSAIFNISSLQEIALTYNSLSGDLPSSMCNHELSALRGIRLSANRFTGPIP 261

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 60/174 (34%), Positives = 89/174 (51%), Gaps = 5/174 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRAL--LSRNQLIGTIPDSVLKMNRL 176
           P +I +IS L  +DL  N   G +P D     + S  L  L  N+  GTI   +     L
Sbjct: 333 PSAIFKISTLKAIDLGKNGFSGSMPLDIMCAHRPSLQLIGLDSNRFTGTIHGGIGNCTSL 392

Query: 177 ADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEG 356
            +L LS N +TG +P  +G +  L+ L ++ NS+TG IP  + + + M   +L+RN   G
Sbjct: 393 RELYLSSNDLTGEVPCEIGSLCTLNVLNIEDNSLTGHIPFQIFNISSMVSGSLTRNNLSG 452

Query: 357 TIPDVFGSKSYFMVLD---LSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +P  FG  SY   L+   L  N L+G +P+S+  A  +  LD   N L G+IP
Sbjct: 453 NLPPNFG--SYLPNLENLILEINWLSGIIPSSIGNASKLRSLDFGYNMLTGSIP 504

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 51/157 (32%), Positives = 82/157 (52%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           LDLSN  + G +P D G L  L    LS N   G +P  V ++  L  ++L  N ++G I
Sbjct: 79  LDLSNLGLRGTIPPDLGNLSFLVSLDLSSNNFHGPVPVEVGQLTSLLSMNLQYNLLSGQI 138

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P   G +  L +L L  NS TG IP ++ + + +  L L  N  +G IP+  G  S   +
Sbjct: 139 PPSFGNLNRLQSLFLGNNSFTGTIPPSIGNMSMLETLGLGGNHLQGNIPEEIGKLSTMKI 198

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           LD+  N+L G +P+++     +  + ++ N L G++P
Sbjct: 199 LDIQSNQLVGAIPSAIFNISSLQEIALTYNSLSGDLP 235

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 53/170 (31%), Positives = 88/170 (51%), Gaps = 4/170 (2%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  + LS N+  G +PS+  K  +L    LS N+  G IP S+  + +L  L L+ N
Sbjct: 243 LSALRGIRLSANRFTGPIPSNLSKCGELQTLYLSFNKFTGGIPRSIDSLTKLTMLSLAAN 302

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVF- 374
            ++G+IP  +  +  L  L L  NS T  IPS +   + +  ++L +NGF G++P D+  
Sbjct: 303 SLSGTIPEEISFLPSLEYLYLRSNSFTSPIPSAIFKISTLKAIDLGKNGFSGSMPLDIMC 362

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS 518
             +    ++ L  N+ TG +   +     +  L +S+N L G +P  IGS
Sbjct: 363 AHRPSLQLIGLDSNRFTGTIHGGIGNCTSLRELYLSSNDLTGEVPCEIGS 412

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 58/178 (32%), Positives = 86/178 (48%), Gaps = 9/178 (5%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  IS ++   L+ N + G LP +FG  L  L   +L  N L G IP S+   ++L 
Sbjct: 431 PFQIFNISSMVSGSLTRNNLSGNLPPNFGSYLPNLENLILEINWLSGIIPSSIGNASKLR 490

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQ-------IPSTLLSNTGMGILNLS 338
            LD   N +TGSIP  LG +R L  L L  N++ G+         ++L +   + IL LS
Sbjct: 491 SLDFGYNMLTGSIPHALGSLRFLERLNLGVNNLKGESYIQELSFLTSLTNCKRLRILYLS 550

Query: 339 RNGFEGTIPDVFGSKSYFMV-LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            N   G +P   G+ S  +   + +  KL G +P  +     +  L ++NN L G IP
Sbjct: 551 FNPLIGILPISIGNLSTSLQRFEANTCKLKGNIPTEIGNLSNLYLLSLNNNDLTGTIP 608

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 52/171 (30%), Positives = 79/171 (46%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  ++ L  L L+ N + G +P +   L  L    L  N     IP ++ K++ L  
Sbjct: 285 PRSIDSLTKLTMLSLAANSLSGTIPEEISFLPSLEYLYLRSNSFTSPIPSAIFKISTLKA 344

Query: 183 LDLSMNRITGSIP--VRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEG 356
           +DL  N  +GS+P  +       L  + LD N  TG I   + + T +  L LS N   G
Sbjct: 345 IDLGKNGFSGSMPLDIMCAHRPSLQLIGLDSNRFTGTIHGGIGNCTSLRELYLSSNDLTG 404

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +P   GS     VL++  N LTG +P  +     M    ++ N+L GN+P
Sbjct: 405 EVPCEIGSLCTLNVLNIEDNSLTGHIPFQIFNISSMVSGSLTRNNLSGNLP 455

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 40/116 (34%), Positives = 57/116 (49%)
 Frame = +3

Query: 162 KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
           +  R+  LDLS   + G+IP  LG +  L +L L  N+  G +P  +   T +  +NL  
Sbjct: 72  QQQRVIALDLSNLGLRGTIPPDLGNLSFLVSLDLSSNNFHGPVPVEVGQLTSLLSMNLQY 131

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           N   G IP  FG+ +    L L  N  TG +P S+     +  L +  NHL GNIP
Sbjct: 132 NLLSGQIPPSFGNLNRLQSLFLGNNSFTGTIPPSIGNMSMLETLGLGGNHLQGNIP 187

[127][TOP]
>UniRef100_B9HLG0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HLG0_POPTR
          Length = 1032

 Score =  124 bits (311), Expect = 5e-27
 Identities = 72/191 (37%), Positives = 109/191 (57%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P S+   + L++L+L  N + G +PS     + L   LLSRN L G IP  +++++ L+ 
Sbjct: 435  PSSLGNCTSLINLELHANNLNGSIPSSLENCQNLLSLLLSRNNLSGPIPKELMRISSLSR 494

Query: 183  -LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
             LDLS N++TGS+P+ + K+  L  L +  N ++G+IP TL S   +  L L+ N F G+
Sbjct: 495  YLDLSENQLTGSLPMEVDKLVNLGYLTVSYNRLSGEIPRTLGSCVSLEYLYLADNSFHGS 554

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
            IP+   S     VL LS N LTG++P SL + K +  LD+S N L G +P+   F +   
Sbjct: 555  IPESLSSLRALQVLYLSRNNLTGKIPKSLGEFKLLTILDLSFNDLEGEVPVQGVFANASG 614

Query: 540  ASFSNNDCLCG 572
             S   N+ LCG
Sbjct: 615  FSVLGNEELCG 625

 Score =  113 bits (283), Expect = 9e-24
 Identities = 68/161 (42%), Positives = 90/161 (55%), Gaps = 1/161 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L+H+    NQI G +P+D G L  L    L  NQL GTIP S+ K+  L  L L  N+I+
Sbjct: 372 LIHMTFGRNQIRGIIPTDIGNLVNLQTLGLEMNQLTGTIPSSIGKLRNLRVLSLRSNKIS 431

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKS 386
           GSIP  LG    L  L+L  N++ G IPS+L +   +  L LSRN   G IP ++    S
Sbjct: 432 GSIPSSLGNCTSLINLELHANNLNGSIPSSLENCQNLLSLLLSRNNLSGPIPKELMRISS 491

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
               LDLS N+LTG +P  + K   +G+L +S N L G IP
Sbjct: 492 LSRYLDLSENQLTGSLPMEVDKLVNLGYLTVSYNRLSGEIP 532

 Score =  110 bits (276), Expect = 6e-23
 Identities = 69/170 (40%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLA 179
           P S+     L+ L LS N + G +P +  ++  LSR L LS NQL G++P  V K+  L 
Sbjct: 459 PSSLENCQNLLSLLLSRNNLSGPIPKELMRISSLSRYLDLSENQLTGSLPMEVDKLVNLG 518

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L +S NR++G IP  LG    L  L L  NS  G IP +L S   + +L LSRN   G 
Sbjct: 519 YLTVSYNRLSGEIPRTLGSCVSLEYLYLADNSFHGSIPESLSSLRALQVLYLSRNNLTGK 578

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G      +LDLSFN L G VP     A   G   + N  LCG IP
Sbjct: 579 IPKSLGEFKLLTILDLSFNDLEGEVPVQGVFANASGFSVLGNEELCGGIP 628

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 57/165 (34%), Positives = 87/165 (52%), Gaps = 2/165 (1%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           + L  L +++N + G LP        KL      RNQ+ G IP  +  +  L  L L MN
Sbjct: 345 TNLQVLGINDNNLGGALPEKISNFSIKLIHMTFGRNQIRGIIPTDIGNLVNLQTLGLEMN 404

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           ++TG+IP  +GK+R L  L L  N ++G IPS+L + T +  L L  N   G+IP    +
Sbjct: 405 QLTGTIPSSIGKLRNLRVLSLRSNKISGSIPSSLGNCTSLINLELHANNLNGSIPSSLEN 464

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMG-HLDISNNHLCGNIPI 512
               + L LS N L+G +P  L +   +  +LD+S N L G++P+
Sbjct: 465 CQNLLSLLLSRNNLSGPIPKELMRISSLSRYLDLSENQLTGSLPM 509

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 52/170 (30%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P++I R S L+HL L  N++ G LP + G L K+   +   N L+G IP S   ++ +  
Sbjct: 140 PVNISRCSNLLHLYLGGNELTGGLPGELGSLSKMQWFVFEINNLVGEIPISFGNLSSVEA 199

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +    N + G IP   G+++ L  L  + N+++G IP ++ + + +  L+LS N   G++
Sbjct: 200 IFGGANNLRGGIPKNFGQLKRLKNLVFNINNLSGTIPPSIYNLSSLTTLSLSSNQLHGSL 259

Query: 363 PDVFG-SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G +      L L  N  +G +P SL  A  +  +D+S+N   G +P
Sbjct: 260 PSDLGLTLPNLETLGLHTNHFSGLIPASLFNASNITVIDLSSNKFTGKVP 309

 Score = 84.0 bits (206), Expect = 8e-15
 Identities = 51/184 (27%), Positives = 88/184 (47%), Gaps = 2/184 (1%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  +S L  L+L+NN     +P + G+L +L + LL  N   G IP ++ + + L  L L
Sbjct: 95  IGNLSFLRILNLNNNSFSHTIPQEIGRLFRLQKLLLRNNTFTGEIPVNISRCSNLLHLYL 154

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
             N +TG +P  LG +  +     + N++ G+IP +  + + +  +    N   G IP  
Sbjct: 155 GGNELTGGLPGELGSLSKMQWFVFEINNLVGEIPISFGNLSSVEAIFGGANNLRGGIPKN 214

Query: 372 FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAAS 545
           FG       L  + N L+G +P S+     +  L +S+N L G++P  +G    +L+   
Sbjct: 215 FGQLKRLKNLVFNINNLSGTIPPSIYNLSSLTTLSLSSNQLHGSLPSDLGLTLPNLETLG 274

Query: 546 FSNN 557
              N
Sbjct: 275 LHTN 278

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 55/176 (31%), Positives = 92/176 (52%), Gaps = 7/176 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+S   +S +  +    N + G +P +FG+L++L   + + N L GTIP S+  ++ L  
Sbjct: 188 PISFGNLSSVEAIFGGANNLRGGIPKNFGQLKRLKNLVFNINNLSGTIPPSIYNLSSLTT 247

Query: 183 LDLSMNRITGSIPVRLG-KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           L LS N++ GS+P  LG  +  L TL L  N  +G IP++L + + + +++LS N F G 
Sbjct: 248 LSLSSNQLHGSLPSDLGLTLPNLETLGLHTNHFSGLIPASLFNASNITVIDLSSNKFTGK 307

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNS------LAKAKFMGHLDISNNHLCGNIP 509
           +PD+ G       L +  N L     +       LA    +  L I++N+L G +P
Sbjct: 308 VPDL-GHMPKLRRLVIQTNDLGNNEDDDLGFLYPLANNTNLQVLGINDNNLGGALP 362

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 52/160 (32%), Positives = 77/160 (48%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           ++ LDL++ +++G L    G L  L    L+ N    TIP  + ++ RL  L L  N  T
Sbjct: 77  VVELDLNSCKLVGSLSPHIGNLSFLRILNLNNNSFSHTIPQEIGRLFRLQKLLLRNNTFT 136

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G IPV + +   L  L L GN +TG +P  L S + M       N   G IP  FG+ S 
Sbjct: 137 GEIPVNISRCSNLLHLYLGGNELTGGLPGELGSLSKMQWFVFEINNLVGEIPISFGNLSS 196

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              +    N L G +P +  + K + +L  + N+L G IP
Sbjct: 197 VEAIFGGANNLRGGIPKNFGQLKRLKNLVFNINNLSGTIP 236

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 39/123 (31%), Positives = 62/123 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           PM + ++  L +L +S N++ GE+P   G    L    L+ N   G+IP+S+  +  L  
Sbjct: 508 PMEVDKLVNLGYLTVSYNRLSGEIPRTLGSCVSLEYLYLADNSFHGSIPESLSSLRALQV 567

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N +TG IP  LG+ ++L+ L L  N + G++P   +     G   L      G I
Sbjct: 568 LYLSRNNLTGKIPKSLGEFKLLTILDLSFNDLEGEVPVQGVFANASGFSVLGNEELCGGI 627

Query: 363 PDV 371
           P +
Sbjct: 628 PQL 630

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 37/114 (32%), Positives = 53/114 (46%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+ +LDL+  ++ GS+   +G +  L  L L+ NS +  IP  +     +  L L  N F
Sbjct: 76  RVVELDLNSCKLVGSLSPHIGNLSFLRILNLNNNSFSHTIPQEIGRLFRLQKLLLRNNTF 135

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
            G IP      S  + L L  N+LTG +P  L     M       N+L G IPI
Sbjct: 136 TGEIPVNISRCSNLLHLYLGGNELTGGLPGELGSLSKMQWFVFEINNLVGEIPI 189

[128][TOP]
>UniRef100_B8BG47 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
            RepID=B8BG47_ORYSI
          Length = 1094

 Score =  124 bits (311), Expect = 5e-27
 Identities = 65/190 (34%), Positives = 102/190 (53%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P +   +  ++ L L NN+  G +  D G L KL    LS NQL  T+P S+  ++ L +
Sbjct: 532  PSNTAMLKNVVMLFLQNNEFSGSIIEDIGNLTKLEHLRLSNNQLSSTVPPSLFHLDSLIE 591

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N  +G++PV +G ++ +  + L  N   G +P ++     +  LNLS N F  +I
Sbjct: 592  LDLSRNLFSGALPVDIGHLKQIYKMDLSSNHFLGSLPDSIGQIQMITYLNLSLNSFNDSI 651

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P+ FG+ +    LDLS N ++G +P  L+    +  L++S N+L G IP G  F ++   
Sbjct: 652  PNSFGNLTSLQTLDLSHNNISGTIPKYLSSFTMLASLNLSFNNLHGQIPGGGVFSNITLQ 711

Query: 543  SFSNNDCLCG 572
            S   N  LCG
Sbjct: 712  SLVGNSGLCG 721

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 59/172 (34%), Positives = 88/172 (51%), Gaps = 1/172 (0%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  +S L  L+LSN  ++G +P D G+L +L    L  N ++G +P ++  + RL  LDL
Sbjct: 97  IGNLSFLSVLNLSNTGLMGSVPDDIGRLHRLKILDLGHNDMLGGVPATIGNLTRLDVLDL 156

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT-GMGILNLSRNGFEGTIPD 368
             N ++G IPV L     L ++ +  N +TG IP+ L +NT  +  L +  N   G IP 
Sbjct: 157 EFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNGLFNNTPSLKHLIIGNNSLSGPIPS 216

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF 524
             GS      L L  N LTG VP S+     +  + +++N L G IP    F
Sbjct: 217 CIGSLPLLERLVLQCNNLTGPVPPSIFNMSRLHVIALASNGLTGPIPGNKSF 268

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 60/179 (33%), Positives = 87/179 (48%), Gaps = 3/179 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L HL + NN + G +PS  G L  L R +L  N L G +P S+  M+RL  + L+ N +T
Sbjct: 200 LKHLIIGNNSLSGPIPSCIGSLPLLERLVLQCNNLTGPVPPSIFNMSRLHVIALASNGLT 259

Query: 210 GSIPVRLGK-MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           G IP      + +L    LD N  TGQIP  L +   + + +L  N FEG +P   G  +
Sbjct: 260 GPIPGNKSFILPILQFFSLDYNYFTGQIPLGLAACRHLKVFSLLDNLFEGPLPSWLGKLT 319

Query: 387 YFMVLDLSFNKL-TGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
              V+ L  N L  G + ++L+    +  LD++  +L G IP       HL     S N
Sbjct: 320 KLNVISLGENLLVVGPIRDALSNLTMLNFLDLAMCNLTGAIPADLGQIGHLSVLRLSTN 378

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 50/154 (32%), Positives = 78/154 (50%)
 Frame = +3

Query: 48  SNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVR 227
           S  ++ G+LP+    L  L    LS NQL   +P+S+++M  L  LDLS N + GSIP  
Sbjct: 475 SRIKLSGKLPATISNLTGLKLLDLSENQLFSALPESIMEMENLHMLDLSGNNLAGSIPSN 534

Query: 228 LGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDL 407
              ++ +  L L  N  +G I   + + T +  L LS N    T+P         + LDL
Sbjct: 535 TAMLKNVVMLFLQNNEFSGSIIEDIGNLTKLEHLRLSNNQLSSTVPPSLFHLDSLIELDL 594

Query: 408 SFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           S N  +G +P  +   K +  +D+S+NH  G++P
Sbjct: 595 SRNLFSGALPVDIGHLKQIYKMDLSSNHFLGSLP 628

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 55/172 (31%), Positives = 91/172 (52%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLI-GTIPDSVLKMNRLA 179
           P+ +     L    L +N   G LPS  GKL KL+   L  N L+ G I D++  +  L 
Sbjct: 288 PLGLAACRHLKVFSLLDNLFEGPLPSWLGKLTKLNVISLGENLLVVGPIRDALSNLTMLN 347

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            LDL+M  +TG+IP  LG++  LS L+L  N +T  IP++L + + + +L L  N  +G 
Sbjct: 348 FLDLAMCNLTGAIPADLGQIGHLSVLRLSTNQLTRPIPASLGNLSALSVLLLDDNHLDGL 407

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+ +    L +S N L G +   ++++  + +  L I++N   G +P
Sbjct: 408 LPTTIGNMNSLTELIISENGLQGDLNFLSAVSNCRKLSVLCINSNRFTGILP 459

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 48/158 (30%), Positives = 82/158 (51%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           ++L +  + GEL    G L  LS   LS   L+G++PD + +++RL  LDL  N + G +
Sbjct: 82  VELPDVPLQGELSPHIGNLSFLSVLNLSNTGLMGSVPDDIGRLHRLKILDLGHNDMLGGV 141

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD-VFGSKSYFM 395
           P  +G +  L  L L+ NS++G IP  L  +  +  +N+  N   G IP+ +F +     
Sbjct: 142 PATIGNLTRLDVLDLEFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNGLFNNTPSLK 201

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L +  N L+G +P+ +     +  L +  N+L G +P
Sbjct: 202 HLIIGNNSLSGPIPSCIGSLPLLERLVLQCNNLTGPVP 239

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 53/159 (33%), Positives = 82/159 (51%), Gaps = 1/159 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRK-LSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGS 215
           L +++N+  G LP   G L   L   L SR +L G +P ++  +  L  LDLS N++  +
Sbjct: 447 LCINSNRFTGILPDYLGNLSSTLESFLASRIKLSGKLPATISNLTGLKLLDLSENQLFSA 506

Query: 216 IPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFM 395
           +P  + +M  L  L L GN++ G IPS       + +L L  N F G+I +  G+ +   
Sbjct: 507 LPESIMEMENLHMLDLSGNNLAGSIPSNTAMLKNVVMLFLQNNEFSGSIIEDIGNLTKLE 566

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
            L LS N+L+  VP SL     +  LD+S N   G +P+
Sbjct: 567 HLRLSNNQLSSTVPPSLFHLDSLIELDLSRNLFSGALPV 605

 Score = 74.7 bits (182), Expect = 5e-12
 Identities = 48/174 (27%), Positives = 86/174 (49%), Gaps = 5/174 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMN-RLA 179
           P +I  ++ L  LDL  N + G +P +      L    +  N L G IP+ +      L 
Sbjct: 142 PATIGNLTRLDVLDLEFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNGLFNNTPSLK 201

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L +  N ++G IP  +G + +L  L L  N++TG +P ++ + + + ++ L+ NG  G 
Sbjct: 202 HLIIGNNSLSGPIPSCIGSLPLLERLVLQCNNLTGPVPPSIFNMSRLHVIALASNGLTGP 261

Query: 360 IPDVFGSKSYFMVL----DLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G+KS+ + +     L +N  TG++P  LA  + +    + +N   G +P
Sbjct: 262 IP---GNKSFILPILQFFSLDYNYFTGQIPLGLAACRHLKVFSLLDNLFEGPLP 312

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 34/115 (29%), Positives = 56/115 (48%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  ++L    + G +   +G +  LS L L    + G +P  +     + IL+L  N  
Sbjct: 78  RVTAVELPDVPLQGELSPHIGNLSFLSVLNLSNTGLMGSVPDDIGRLHRLKILDLGHNDM 137

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
            G +P   G+ +   VLDL FN L+G +P  L  +  +  ++I  N+L G IP G
Sbjct: 138 LGGVPATIGNLTRLDVLDLEFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNG 192

[129][TOP]
>UniRef100_A7Q3X5 Chromosome chr13 scaffold_48, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7Q3X5_VITVI
          Length = 913

 Score =  124 bits (311), Expect = 5e-27
 Identities = 72/183 (39%), Positives = 100/183 (54%)
 Frame = +3

Query: 27  GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           GL  LDLS N++ G+  S  G  R L    +SRN L+G IP S+  +  L  LDLS N++
Sbjct: 332 GLQVLDLSYNELSGDFTSSIGVFRSLQFLNISRNSLVGAIPASIGDLKALDVLDLSENQL 391

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
            GSIP+ +G    L  L+L  N + G+IP +L + + +  L LS N   G IP      S
Sbjct: 392 NGSIPLEIGGAFSLKDLRLKNNFLAGKIPVSLENCSSLTTLILSHNNLSGPIPMGISKLS 451

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCL 566
               +DLS NKLTG +P  LA    +   +IS+N L G +P G  F+ +  +S S N  L
Sbjct: 452 NLENVDLSLNKLTGSLPKQLANLPHLISFNISHNQLQGELPAGGFFNTISPSSVSGNPSL 511

Query: 567 CGN 575
           CG+
Sbjct: 512 CGS 514

 Score =  105 bits (262), Expect = 3e-21
 Identities = 63/170 (37%), Positives = 88/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+   S L  +D S+NQ  G LPS    L  L    LS N L G IP  +  +  L  
Sbjct: 138 PESVGSCSTLAAIDFSSNQFSGPLPSGIWSLNGLRSLDLSDNLLEGDIPKGIDSLYNLRA 197

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           ++LS NR +G +P  +G   +L  +    NS++G +P T+   T    +NL  N FEG +
Sbjct: 198 INLSKNRFSGPLPDGIGGCLLLRLIDFSENSLSGSLPGTMQKLTLCNYMNLHGNSFEGEV 257

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDIS-NNHLCGNIP 509
           P+  G       LDLS NK +GRVP S+   K +  L+ S NN L G++P
Sbjct: 258 PEWIGEMKSLETLDLSANKFSGRVPTSIGNLKSLKVLNFSVNNSLLGDLP 307

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 51/160 (31%), Positives = 84/160 (52%), Gaps = 1/160 (0%)
 Frame = +3

Query: 33  MHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           + +DLS N + G +P DF K    L    L++N+  G IP+SV   + LA +D S N+ +
Sbjct: 99  LFIDLSENSLSGTIPDDFFKQCGSLHAISLAKNKFSGKIPESVGSCSTLAAIDFSSNQFS 158

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G +P  +  +  L +L L  N + G IP  + S   +  +NLS+N F G +PD  G    
Sbjct: 159 GPLPSGIWSLNGLRSLDLSDNLLEGDIPKGIDSLYNLRAINLSKNRFSGPLPDGIGGCLL 218

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             ++D S N L+G +P ++ K     ++++  N   G +P
Sbjct: 219 LRLIDFSENSLSGSLPGTMQKLTLCNYMNLHGNSFEGEVP 258

 Score = 84.3 bits (207), Expect = 6e-15
 Identities = 56/186 (30%), Positives = 83/186 (44%), Gaps = 20/186 (10%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           +D S N + G LP    KL   +   L  N   G +P+ + +M  L  LDLS N+ +G +
Sbjct: 222 IDFSENSLSGSLPGTMQKLTLCNYMNLHGNSFEGEVPEWIGEMKSLETLDLSANKFSGRV 281

Query: 219 PVRLGKMRVLSTLKLD-GNSMTGQIPSTLL-----------------SNTGMGILNLSRN 344
           P  +G ++ L  L     NS+ G +P+ +                  S  G+ +L+LS N
Sbjct: 282 PTSIGNLKSLKVLNFSVNNSLLGDLPAWIFKLGLQKVLLSKNSLMEKSRQGLQVLDLSYN 341

Query: 345 GFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS 518
              G      G       L++S N L G +P S+   K +  LD+S N L G+IP  IG 
Sbjct: 342 ELSGDFTSSIGVFRSLQFLNISRNSLVGAIPASIGDLKALDVLDLSENQLNGSIPLEIGG 401

Query: 519 PFDHLD 536
            F   D
Sbjct: 402 AFSLKD 407

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 42/121 (34%), Positives = 61/121 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +  L  LDLS NQ+ G +P + G    L    L  N L G IP S+   + L  
Sbjct: 372 PASIGDLKALDVLDLSENQLNGSIPLEIGGAFSLKDLRLKNNFLAGKIPVSLENCSSLTT 431

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N ++G IP+ + K+  L  + L  N +TG +P  L +   +   N+S N  +G +
Sbjct: 432 LILSHNNLSGPIPMGISKLSNLENVDLSLNKLTGSLPKQLANLPHLISFNISHNQLQGEL 491

Query: 363 P 365
           P
Sbjct: 492 P 492

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 45/159 (28%), Positives = 78/159 (49%), Gaps = 5/159 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ I     L  L L NN + G++P        L+  +LS N L G IP  + K++ L +
Sbjct: 396 PLEIGGAFSLKDLRLKNNFLAGKIPVSLENCSSLTTLILSHNNLSGPIPMGISKLSNLEN 455

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIP-----STLLSNTGMGILNLSRNG 347
           +DLS+N++TGS+P +L  +  L +  +  N + G++P     +T+  ++  G  +L  + 
Sbjct: 456 VDLSLNKLTGSLPKQLANLPHLISFNISHNQLQGELPAGGFFNTISPSSVSGNPSLCGSA 515

Query: 348 FEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFM 464
              + P V   K   +  + S +   G  P SLA  K +
Sbjct: 516 ANKSCPAVL-PKPIVLNPNSSSDTTAGAFPRSLAHKKII 553

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 41/142 (28%), Positives = 69/142 (48%), Gaps = 3/142 (2%)
 Frame = +3

Query: 99  KLSRALLSRNQLIGTIPDSVLKMNRLADL--DLSMNRITGSIPVRLGKM-RVLSTLKLDG 269
           +++  +L    L G I   +L++  L  L  DLS N ++G+IP    K    L  + L  
Sbjct: 71  RVTDLVLDGFSLSGKIGRGLLQLQFLRKLFIDLSENSLSGTIPDDFFKQCGSLHAISLAK 130

Query: 270 NSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLA 449
           N  +G+IP ++ S + +  ++ S N F G +P    S +    LDLS N L G +P  + 
Sbjct: 131 NKFSGKIPESVGSCSTLAAIDFSSNQFSGPLPSGIWSLNGLRSLDLSDNLLEGDIPKGID 190

Query: 450 KAKFMGHLDISNNHLCGNIPIG 515
               +  +++S N   G +P G
Sbjct: 191 SLYNLRAINLSKNRFSGPLPDG 212

[130][TOP]
>UniRef100_A7PVH8 Chromosome chr9 scaffold_33, whole genome shotgun sequence n=1
            Tax=Vitis vinifera RepID=A7PVH8_VITVI
          Length = 2202

 Score =  124 bits (311), Expect = 5e-27
 Identities = 69/192 (35%), Positives = 104/192 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I ++  L  L L+NNQ+ G +P+  G+L  L    L  N+L  TIP ++  +  +  
Sbjct: 1649 PNDICQLRNLGELFLTNNQLSGSIPACLGELTFLRHLYLGSNKLNSTIPSTLWSLIHILS 1708

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LD+S N + G +P  +G ++VL  + L  N ++G+IPS +     +  L+L+ N FEG I
Sbjct: 1709 LDMSSNFLVGYLPSDMGNLKVLVKIDLSRNQLSGEIPSNIGGLQDLTSLSLAHNRFEGPI 1768

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
               F +      +DLS N L G +P SL    ++ +LD+S N L G IP   PF +  A 
Sbjct: 1769 LHSFSNLKSLEFMDLSDNALFGEIPKSLEGLVYLKYLDVSFNGLYGEIPPEGPFANFSAE 1828

Query: 543  SFSNNDCLCGNP 578
            SF  N  LCG+P
Sbjct: 1829 SFMMNKALCGSP 1840

 Score =  120 bits (301), Expect = 8e-26
 Identities = 67/192 (34%), Positives = 105/192 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I ++  L+ L L NNQ+ G +P+  G+L  L +  L  N+L  TIP ++  +  +  
Sbjct: 447  PNDICQLRNLVELFLENNQLSGSIPACLGELTFLRQVDLGSNKLNSTIPLTLWSLKDILT 506

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N +   +P  +G ++VL  + L  N ++ +IPS  +    +  L+L+ N FEG I
Sbjct: 507  LDLSSNFLVSYLPSDMGNLKVLVKIDLSRNQLSCEIPSNAVDLRDLISLSLAHNRFEGPI 566

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
               F +      +DLS N L+G +P SL    ++ +L++S N L G IP   PF +  A 
Sbjct: 567  LHSFSNLKSLEFMDLSDNALSGEIPKSLEGLVYLKYLNVSFNRLYGEIPTEGPFANFSAE 626

Query: 543  SFSNNDCLCGNP 578
            SF  N+ LCG+P
Sbjct: 627  SFMMNEALCGSP 638

 Score =  104 bits (260), Expect = 4e-21
 Identities = 61/176 (34%), Positives = 92/176 (52%), Gaps = 4/176 (2%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  +S L+ LDLS+N   G +P  FG L +L    L  N   GTIP S+  M+ L  
Sbjct: 1254 PPDLGNLSFLVSLDLSSNNFHGPIPPSFGNLNRLQSLFLGNNSFTGTIPPSIGNMSMLET 1313

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN--TGMGILNLSRNGFEG 356
            LD+  N++ G+IP  +  +  L  + L  NS++G +PS++ ++  + +  + LS N F G
Sbjct: 1314 LDIQSNQLVGAIPSAIFNISSLQEIALTYNSLSGDLPSSMCNHELSALRGIRLSANRFTG 1373

Query: 357  TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS 518
             IP           L LSFNK TG +P S+     +  L ++ N L G +P  IGS
Sbjct: 1374 PIPSNLSKCGELQTLYLSFNKFTGGIPRSIDSLTKLTMLSLAANSLSGTVPCEIGS 1429

 Score =  103 bits (258), Expect = 7e-21
 Identities = 62/171 (36%), Positives = 91/171 (53%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVL--KMNRL 176
            P SI  +S L  LD+ +NQ++G +PS    +  L    L+ N L G +P S+   +++ L
Sbjct: 1302 PPSIGNMSMLETLDIQSNQLVGAIPSAIFNISSLQEIALTYNSLSGDLPSSMCNHELSAL 1361

Query: 177  ADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEG 356
              + LS NR TG IP  L K   L TL L  N  TG IP ++ S T + +L+L+ N   G
Sbjct: 1362 RGIRLSANRFTGPIPSNLSKCGELQTLYLSFNKFTGGIPRSIDSLTKLTMLSLAANSLSG 1421

Query: 357  TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            T+P   GS     VL++  N LTG +P  +     M    ++ N+L GN+P
Sbjct: 1422 TVPCEIGSLCTLNVLNIEDNSLTGHIPFQIFNISSMVSGSLTRNNLSGNLP 1472

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 57/166 (34%), Positives = 91/166 (54%), Gaps = 3/166 (1%)
 Frame = +3

Query: 21   ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
            +S L  + LS N+  G +PS+  K  +L    LS N+  G IP S+  + +L  L L+ N
Sbjct: 1358 LSALRGIRLSANRFTGPIPSNLSKCGELQTLYLSFNKFTGGIPRSIDSLTKLTMLSLAAN 1417

Query: 201  RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
             ++G++P  +G +  L+ L ++ NS+TG IP  + + + M   +L+RN   G +P  FG 
Sbjct: 1418 SLSGTVPCEIGSLCTLNVLNIEDNSLTGHIPFQIFNISSMVSGSLTRNNLSGNLPPNFG- 1476

Query: 381  KSYFMVLD---LSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             SY   L+   L  N L+G +P+S+  A  +  LD   N L G+IP
Sbjct: 1477 -SYLPNLENLILEINWLSGIIPSSIGNASKLRSLDFGYNMLTGSIP 1521

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 58/170 (34%), Positives = 90/170 (52%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3    PMSIVRIS-GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
            P+SI  +S  L   + +  ++ G +P++ G L  L    L+ N L GTIP S+ ++ +L 
Sbjct: 1576 PISIGNLSTSLQRFEANTCKLKGNIPTEIGNLSNLYLLSLNNNDLTGTIPPSIGQLQKLQ 1635

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
             L L  N++ GSIP  + ++R L  L L  N ++G IP+ L   T +  L L  N    T
Sbjct: 1636 GLYLPSNKLQGSIPNDICQLRNLGELFLTNNQLSGSIPACLGELTFLRHLYLGSNKLNST 1695

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            IP    S  + + LD+S N L G +P+ +   K +  +D+S N L G IP
Sbjct: 1696 IPSTLWSLIHILSLDMSSNFLVGYLPSDMGNLKVLVKIDLSRNQLSGEIP 1745

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 55/173 (31%), Positives = 92/173 (53%), Gaps = 4/173 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+SI  +S L  L L+ N + G +     KL  L    +  N L+  IP ++  +  L +
Sbjct: 149 PLSIGNMSMLETLGLAGNHLQGNIREKIVKLSNLKILEIQSNHLVSAIPLAIFNIFSLQE 208

Query: 183 LDLSMNRI-TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           + L+ N + TG +P  +G +  L+ L+++ N +TG IPS + + + M   +L RN F G 
Sbjct: 209 IALTYNSLSTGEVPCEIGSLHTLNVLRIEDNRLTGYIPSQIFNISSMVSASLGRNNFSGN 268

Query: 360 IPDVFGSKSYFMVLD---LSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P  F   S+   LD   L  N+L+G +P+S++ A  +  LD+  N   G+IP
Sbjct: 269 LPPNFA--SHLPNLDELLLGINRLSGIIPSSISNASKLTRLDVGGNAFTGSIP 319

 Score = 91.7 bits (226), Expect = 4e-17
 Identities = 57/159 (35%), Positives = 81/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query: 39   LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
            LDLSN  + G +P D G L  L    LS N   G IP S   +NRL  L L  N  TG+I
Sbjct: 1242 LDLSNLGLRGTIPPDLGNLSFLVSLDLSSNNFHGPIPPSFGNLNRLQSLFLGNNSFTGTI 1301

Query: 219  PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK--SYF 392
            P  +G M +L TL +  N + G IPS + + + +  + L+ N   G +P    +   S  
Sbjct: 1302 PPSIGNMSMLETLDIQSNQLVGAIPSAIFNISSLQEIALTYNSLSGDLPSSMCNHELSAL 1361

Query: 393  MVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              + LS N+ TG +P++L+K   +  L +S N   G IP
Sbjct: 1362 RGIRLSANRFTGPIPSNLSKCGELQTLYLSFNKFTGGIP 1400

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 58/170 (34%), Positives = 86/170 (50%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRIS-GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P SI  +S  L     S   + G +P++ G L  L    L  N LIGTIP S+ ++ +L 
Sbjct: 374 PTSIGNLSTSLERFRASACNLKGNIPTEIGNLGSLYLLFLDHNDLIGTIPPSIGQLQKLQ 433

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L LS N++ G IP  + ++R L  L L+ N ++G IP+ L   T +  ++L  N    T
Sbjct: 434 GLHLSDNKLQGFIPNDICQLRNLVELFLENNQLSGSIPACLGELTFLRQVDLGSNKLNST 493

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP    S    + LDLS N L   +P+ +   K +  +D+S N L   IP
Sbjct: 494 IPLTLWSLKDILTLDLSSNFLVSYLPSDMGNLKVLVKIDLSRNQLSCEIP 543

 Score = 85.1 bits (209), Expect = 4e-15
 Identities = 66/226 (29%), Positives = 92/226 (40%), Gaps = 57/226 (25%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  IS ++   L  N   G LP +F   L  L   LL  N+L G IP S+   ++L 
Sbjct: 246 PSQIFNISSMVSASLGRNNFSGNLPPNFASHLPNLDELLLGINRLSGIIPSSISNASKLT 305

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQ------------------------ 287
            LD+  N  TGSIP  LG +R L  L L GN++TG+                        
Sbjct: 306 RLDVGGNAFTGSIPHTLGSIRFLENLHLGGNNLTGESSIQELSFLTSLTNCKWLSTLDIT 365

Query: 288 -------IPSTL------------------------LSNTG-MGILNLSRNGFEGTIPDV 371
                  +P+++                        + N G + +L L  N   GTIP  
Sbjct: 366 LNPLSGILPTSIGNLSTSLERFRASACNLKGNIPTEIGNLGSLYLLFLDHNDLIGTIPPS 425

Query: 372 FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G       L LS NKL G +PN + + + +  L + NN L G+IP
Sbjct: 426 IGQLQKLQGLHLSDNKLQGFIPNDICQLRNLVELFLENNQLSGSIP 471

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 58/178 (32%), Positives = 86/178 (48%), Gaps = 9/178 (5%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
            P  I  IS ++   L+ N + G LP +FG  L  L   +L  N L G IP S+   ++L 
Sbjct: 1448 PFQIFNISSMVSGSLTRNNLSGNLPPNFGSYLPNLENLILEINWLSGIIPSSIGNASKLR 1507

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQ-------IPSTLLSNTGMGILNLS 338
             LD   N +TGSIP  LG +R L  L L  N++ G+         ++L +   + IL LS
Sbjct: 1508 SLDFGYNMLTGSIPHALGSLRFLERLNLGVNNLKGESYIQELSFLTSLTNCKRLRILYLS 1567

Query: 339  RNGFEGTIPDVFGSKSYFMV-LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             N   G +P   G+ S  +   + +  KL G +P  +     +  L ++NN L G IP
Sbjct: 1568 FNPLIGILPISIGNLSTSLQRFEANTCKLKGNIPTEIGNLSNLYLLSLNNNDLTGTIP 1625

 Score = 80.5 bits (197), Expect = 9e-14
 Identities = 55/170 (32%), Positives = 79/170 (46%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +S L+ LDLS N   G +  +  +L  L    L  N   G IP S   +NRL  
Sbjct: 77  PPDLGNLSFLVSLDLSRNNFHGLVLVEVDQLTSLQSINLQYNLFSGQIPPSFGNLNRLQS 136

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N  T +IP+ +G M +L TL L GN + G I   ++  + + IL +  N     I
Sbjct: 137 LFLGNNSFTRTIPLSIGNMSMLETLGLAGNHLQGNIREKIVKLSNLKILEIQSNHLVSAI 196

Query: 363 PDVFGSKSYFMVLDLSFNKL-TGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P    +      + L++N L TG VP  +     +  L I +N L G IP
Sbjct: 197 PLAIFNIFSLQEIALTYNSLSTGEVPCEIGSLHTLNVLRIEDNRLTGYIP 246

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 44/132 (33%), Positives = 65/132 (49%)
 Frame = +3

Query: 117 LSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS 296
           LS   L GTIP  +  ++ L  LDLS N   G + V + ++  L ++ L  N  +GQIP 
Sbjct: 67  LSNLGLRGTIPPDLGNLSFLVSLDLSRNNFHGLVLVEVDQLTSLQSINLQYNLFSGQIPP 126

Query: 297 TLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLD 476
           +  +   +  L L  N F  TIP   G+ S    L L+ N L G +   + K   +  L+
Sbjct: 127 SFGNLNRLQSLFLGNNSFTRTIPLSIGNMSMLETLGLAGNHLQGNIREKIVKLSNLKILE 186

Query: 477 ISNNHLCGNIPI 512
           I +NHL   IP+
Sbjct: 187 IQSNHLVSAIPL 198

 Score = 67.4 bits (163), Expect = 8e-10
 Identities = 37/116 (31%), Positives = 60/116 (51%)
 Frame = +3

Query: 162  KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
            +  R+  LDLS   + G+IP  LG +  L +L L  N+  G IP +  +   +  L L  
Sbjct: 1235 QQQRVIALDLSNLGLRGTIPPDLGNLSFLVSLDLSSNNFHGPIPPSFGNLNRLQSLFLGN 1294

Query: 342  NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            N F GTIP   G+ S    LD+  N+L G +P+++     +  + ++ N L G++P
Sbjct: 1295 NSFTGTIPPSIGNMSMLETLDIQSNQLVGAIPSAIFNISSLQEIALTYNSLSGDLP 1350

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 50/162 (30%), Positives = 71/162 (43%), Gaps = 3/162 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQL---IGTIPDSVLKMNRLADLDLSMN 200
           L+ LDLS       +  + G L  L    +  NQ      T   SV+       LDLS  
Sbjct: 17  LIALDLSKKIFHIPVIDEVGHLHCLKATNIQFNQFKVSCNTQQQSVIA------LDLSNL 70

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
            + G+IP  LG +  L +L L  N+  G +   +   T +  +NL  N F G IP  FG+
Sbjct: 71  GLRGTIPPDLGNLSFLVSLDLSRNNFHGLVLVEVDQLTSLQSINLQYNLFSGQIPPSFGN 130

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
            +    L L  N  T  +P S+     +  L ++ NHL GNI
Sbjct: 131 LNRLQSLFLGNNSFTRTIPLSIGNMSMLETLGLAGNHLQGNI 172

[131][TOP]
>UniRef100_A5B5R9 Putative uncharacterized protein n=1 Tax=Vitis vinifera
            RepID=A5B5R9_VITVI
          Length = 1205

 Score =  124 bits (311), Expect = 5e-27
 Identities = 73/192 (38%), Positives = 104/192 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  +  L +L LS+N++ G  PS FG L  L    L  N L   IP S+  +  L  
Sbjct: 655  PNDLCHLKNLGYLGLSSNKLSGSTPSCFGDLLALRELFLDSNALAFNIPTSLWSLRDLLV 714

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N +TG++P  +G M+ ++TL L  N ++G IPS +     +  L+LS+N  +G I
Sbjct: 715  LNLSSNFLTGNLPPEVGNMKSITTLDLSKNLVSGYIPSRMGKLQYLITLSLSQNRLQGPI 774

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
               FG       LDLS N L+G +P SL    ++ +L++S N L G IP G PF    A 
Sbjct: 775  XVEFGDLVSLESLDLSHNNLSGTIPKSLEALIYLKYLNVSFNKLQGEIPNGGPFVKFTAE 834

Query: 543  SFSNNDCLCGNP 578
            SF  N+ LCG P
Sbjct: 835  SFMFNEALCGAP 846

 Score =  102 bits (253), Expect = 3e-20
 Identities = 54/166 (32%), Positives = 96/166 (57%), Gaps = 1/166 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L+ LDLSNN     LP D GK ++L +  L  N+L+G IP+++  +++L +L L  N
Sbjct: 74  LSFLVSLDLSNNYFHDSLPKDIGKCKELQQLNLFNNKLVGGIPEAICNLSKLEELYLGNN 133

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFG 377
           ++ G IP ++  ++ L  L    N++T  IP+T+ S + +  ++LS N   G++P D+  
Sbjct: 134 QLIGEIPKKMNXLQNLKVLSFPMNNLTSSIPATIFSISSLLNISLSNNNLSGSLPMDMCY 193

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           +      L+LS N L+G++P  L +   +  + ++ N   G+IP G
Sbjct: 194 ANPKLKELNLSSNHLSGKIPTGLGQCIKLQVISLAYNDFTGSIPNG 239

 Score =  101 bits (252), Expect = 4e-20
 Identities = 57/170 (33%), Positives = 83/170 (48%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I +   L  L+L NN+++G +P     L KL    L  NQLIG IP  +  +  L  
Sbjct: 92  PKDIGKCKELQQLNLFNNKLVGGIPEAICNLSKLEELYLGNNQLIGEIPKKMNXLQNLKV 151

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGT 359
           L   MN +T SIP  +  +  L  + L  N+++G +P  +  +N  +  LNLS N   G 
Sbjct: 152 LSFPMNNLTSSIPATIFSISSLLNISLSNNNLSGSLPMDMCYANPKLKELNLSSNHLSGK 211

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G      V+ L++N  TG +PN +     +  L + NN L G IP
Sbjct: 212 IPTGLGQCIKLQVISLAYNDFTGSIPNGIGNLVELQRLSLRNNSLTGEIP 261

 Score =  100 bits (249), Expect = 8e-20
 Identities = 68/196 (34%), Positives = 93/196 (47%), Gaps = 25/196 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  IS L+++ LSNN + G LP D      KL    LS N L G IP  + +  +L 
Sbjct: 164 PATIFSISSLLNISLSNNNLSGSLPMDMCYANPKLKELNLSSNHLSGKIPTGLGQCIKLQ 223

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            + L+ N  TGSIP  +G +  L  L L  NS+TG+IPS L     + +L+ S N F G 
Sbjct: 224 VISLAYNDFTGSIPNGIGNLVELQRLSLRNNSLTGEIPSNLSHCRELRVLSSSFNQFTGG 283

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHL---------------------- 473
           IP   GS      L L+FNKLTG +P  +     +  L                      
Sbjct: 284 IPQAIGSLCNLEELYLAFNKLTGGIPREIGNLSNLNILQLGSNGISGPIPAEIFNISSLQ 343

Query: 474 --DISNNHLCGNIPIG 515
             D +NN L G++P+G
Sbjct: 344 VIDFTNNSLSGSLPMG 359

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 58/168 (34%), Positives = 81/168 (48%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9    SIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADL 185
            S+     L +L +  N + G LP+  G L   L        Q  GTIP  +  +  L  L
Sbjct: 560  SLTNCKFLRYLWIGYNPLKGTLPNSLGNLPIALESFTAYACQFRGTIPTGIGNLTNLIWL 619

Query: 186  DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
            DL  N +TGSIP  LG+++ L  L + GN + G IP+ L     +G L LS N   G+ P
Sbjct: 620  DLGANDLTGSIPTTLGRLQKLQRLHIAGNRIRGSIPNDLCHLKNLGYLGLSSNKLSGSTP 679

Query: 366  DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              FG       L L  N L   +P SL   + +  L++S+N L GN+P
Sbjct: 680  SCFGDLLALRELFLDSNALAFNIPTSLWSLRDLLVLNLSSNFLTGNLP 727

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 55/170 (32%), Positives = 82/170 (48%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + +   L  + L+ N   G +P+  G L +L R  L  N L G IP ++     L  
Sbjct: 213 PTGLGQCIKLQVISLAYNDFTGSIPNGIGNLVELQRLSLRNNSLTGEIPSNLSHCRELRV 272

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L  S N+ TG IP  +G +  L  L L  N +TG IP  + + + + IL L  NG  G I
Sbjct: 273 LSSSFNQFTGGIPQAIGSLCNLEELYLAFNKLTGGIPREIGNLSNLNILQLGSNGISGPI 332

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIP 509
           P    + S   V+D + N L+G +P  + K    +  L ++ NHL G +P
Sbjct: 333 PAEIFNISSLQVIDFTNNSLSGSLPMGICKHLPNLQGLYLAQNHLSGQLP 382

 Score = 83.6 bits (205), Expect = 1e-14
 Identities = 64/250 (25%), Positives = 102/250 (40%), Gaps = 81/250 (32%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I  +S L H+DL +N ++G +P+ FG L+ L    L  N L GT+P+++  ++ L +
Sbjct: 406  PREIGNLSKLEHIDLRSNSLVGSIPTSFGNLKALKFLNLGINFLTGTVPEAIFNISELQN 465

Query: 183  LDLSMNRITGSIPVRLG-------------------------KMRVLSTLKLDGNSMTGQ 287
            L L  N ++GS+P  +G                          M  L+ L L  NS TG 
Sbjct: 466  LALVQNHLSGSLPSSIGTWLPDLEGLYIGANEFSGTIPMSISNMSKLTVLSLSDNSFTGN 525

Query: 288  IPSTLLSNTGMGILNLSRN-----------GF--------------------EGTIPDV- 371
            +P  L + T +  LNL+ N           GF                    +GT+P+  
Sbjct: 526  VPKDLCNLTKLKFLNLAHNQLTDEHLASGVGFLTSLTNCKFLRYLWIGYNPLKGTLPNSL 585

Query: 372  ------------------------FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDI 479
                                     G+ +  + LDL  N LTG +P +L + + +  L I
Sbjct: 586  GNLPIALESFTAYACQFRGTIPTGIGNLTNLIWLDLGANDLTGSIPTTLGRLQKLQRLHI 645

Query: 480  SNNHLCGNIP 509
            + N + G+IP
Sbjct: 646  AGNRIRGSIP 655

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 50/171 (29%), Positives = 87/171 (50%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVR-ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           PM I + +  L  L L+ N + G+LP+      +L    LS N+  G+IP  +  +++L 
Sbjct: 357 PMGICKHLPNLQGLYLAQNHLSGQLPTTLSLCGELLFLSLSFNKFRGSIPREIGNLSKLE 416

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            +DL  N + GSIP   G ++ L  L L  N +TG +P  + + + +  L L +N   G+
Sbjct: 417 HIDLRSNSLVGSIPTSFGNLKALKFLNLGINFLTGTVPEAIFNISELQNLALVQNHLSGS 476

Query: 360 IPDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+       L +  N+ +G +P S++    +  L +S+N   GN+P
Sbjct: 477 LPSSIGTWLPDLEGLYIGANEFSGTIPMSISNMSKLTVLSLSDNSFTGNVP 527

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 43/139 (30%), Positives = 67/139 (48%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           +++S   LS   L GTI   V  ++ L  LDLS N    S+P  +GK + L  L L  N 
Sbjct: 51  QRVSXINLSNMGLEGTIAPQVGNLSFLVSLDLSNNYFHDSLPKDIGKCKELQQLNLFNNK 110

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA 455
           + G IP  + + + +  L L  N   G IP          VL    N LT  +P ++   
Sbjct: 111 LVGGIPEAICNLSKLEELYLGNNQLIGEIPKKMNXLQNLKVLSFPMNNLTSSIPATIFSI 170

Query: 456 KFMGHLDISNNHLCGNIPI 512
             + ++ +SNN+L G++P+
Sbjct: 171 SSLLNISLSNNNLSGSLPM 189

[132][TOP]
>UniRef100_Q8RV02 Leucine Rich Repeat family protein, expressed n=1 Tax=Oryza sativa
            Japonica Group RepID=Q8RV02_ORYSJ
          Length = 1066

 Score =  124 bits (310), Expect = 7e-27
 Identities = 65/190 (34%), Positives = 102/190 (53%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P +   +  ++ L L NN+  G +  D G L KL    LS NQL  T+P S+  ++ L +
Sbjct: 504  PSNTAMLKNVVMLFLQNNEFSGSIIEDIGNLTKLEHLRLSNNQLSSTVPPSLFHLDSLIE 563

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N  +G++PV +G ++ +  + L  N   G +P ++     +  LNLS N F  +I
Sbjct: 564  LDLSRNLFSGALPVDIGHLKQIYKMDLSSNHFLGSLPDSIGQIQMITYLNLSINSFNDSI 623

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P+ FG+ +    LDLS N ++G +P  L+    +  L++S N+L G IP G  F ++   
Sbjct: 624  PNSFGNLTSLQTLDLSHNNISGTIPKYLSSFTMLASLNLSFNNLHGQIPGGGVFSNITLQ 683

Query: 543  SFSNNDCLCG 572
            S   N  LCG
Sbjct: 684  SLVGNSGLCG 693

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 59/172 (34%), Positives = 88/172 (51%), Gaps = 1/172 (0%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  +S L  L+LSN  ++G +P D G+L +L    L  N ++G +P ++  + RL  LDL
Sbjct: 97  IGNLSFLSVLNLSNTGLMGSVPDDIGRLHRLKILDLGHNDMLGGVPATIGNLTRLDVLDL 156

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT-GMGILNLSRNGFEGTIPD 368
             N ++G IPV L     L ++ +  N +TG IP+ L +NT  +  L +  N   G IP 
Sbjct: 157 EFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNGLFNNTPSLKHLIIGNNSLSGPIPS 216

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF 524
             GS      L L  N LTG VP S+     +  + +++N L G IP    F
Sbjct: 217 CIGSLPLLERLVLQCNNLTGPVPPSIFNMSRLHVIALASNGLTGPIPGNKSF 268

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 57/172 (33%), Positives = 93/172 (54%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLI-GTIPDSVLKMNRLA 179
           P+ +     L    L +N I G LPS  GKL KL+   L  N L+ G I D++  +  L 
Sbjct: 288 PLGLAACRHLKVFSLLDNLIEGPLPSWLGKLTKLNVISLGENLLVVGPIRDALSNLTMLN 347

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            LDL+M  +TG+IP  LG++  LS L+L  N +TG IP++L + + + +L L  N  +G 
Sbjct: 348 FLDLAMCNLTGAIPADLGQIGHLSVLRLSTNQLTGPIPASLGNLSALSVLLLDDNHLDGL 407

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+ +    L +S N L G +   ++++  + +  L I++N   G +P
Sbjct: 408 LPTTIGNMNSLTELIISENGLQGDLNFLSAVSNCRKLSVLCINSNRFTGILP 459

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 48/158 (30%), Positives = 82/158 (51%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           ++L +  + GEL    G L  LS   LS   L+G++PD + +++RL  LDL  N + G +
Sbjct: 82  VELPDVPLQGELSPHIGNLSFLSVLNLSNTGLMGSVPDDIGRLHRLKILDLGHNDMLGGV 141

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD-VFGSKSYFM 395
           P  +G +  L  L L+ NS++G IP  L  +  +  +N+  N   G IP+ +F +     
Sbjct: 142 PATIGNLTRLDVLDLEFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNGLFNNTPSLK 201

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L +  N L+G +P+ +     +  L +  N+L G +P
Sbjct: 202 HLIIGNNSLSGPIPSCIGSLPLLERLVLQCNNLTGPVP 239

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 57/186 (30%), Positives = 81/186 (43%), Gaps = 26/186 (13%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI- 206
           L HL + NN + G +PS  G L  L R +L  N L G +P S+  M+RL  + L+ N + 
Sbjct: 200 LKHLIIGNNSLSGPIPSCIGSLPLLERLVLQCNNLTGPVPPSIFNMSRLHVIALASNGLT 259

Query: 207 ------------------------TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT 314
                                   TG IP+ L   R L    L  N + G +PS L   T
Sbjct: 260 GPIPGNKSFILPILQFFSLDYNYFTGQIPLGLAACRHLKVFSLLDNLIEGPLPSWLGKLT 319

Query: 315 GMGILNLSRNGF-EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
            + +++L  N    G I D   + +    LDL+   LTG +P  L +   +  L +S N 
Sbjct: 320 KLNVISLGENLLVVGPIRDALSNLTMLNFLDLAMCNLTGAIPADLGQIGHLSVLRLSTNQ 379

Query: 492 LCGNIP 509
           L G IP
Sbjct: 380 LTGPIP 385

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 64/217 (29%), Positives = 90/217 (41%), Gaps = 47/217 (21%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  + +I  L  L LS NQ+ G +P+  G L  LS  LL  N L G +P ++  MN L +
Sbjct: 361  PADLGQIGHLSVLRLSTNQLTGPIPASLGNLSALSVLLLDDNHLDGLLPTTIGNMNSLTE 420

Query: 183  LDLS--------------------------MNRITGSIPVRLG----------------- 233
            L +S                           NR TG +P  LG                 
Sbjct: 421  LIISENGLQGDLNFLSAVSNCRKLSVLCINSNRFTGILPDYLGNLSSTLESFLASRIKLS 480

Query: 234  ----KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVL 401
                +M  L  L L GN++ G IPS       + +L L  N F G+I +  G+ +    L
Sbjct: 481  ESIMEMENLHMLDLSGNNLAGSIPSNTAMLKNVVMLFLQNNEFSGSIIEDIGNLTKLEHL 540

Query: 402  DLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
             LS N+L+  VP SL     +  LD+S N   G +P+
Sbjct: 541  RLSNNQLSSTVPPSLFHLDSLIELDLSRNLFSGALPV 577

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 48/174 (27%), Positives = 87/174 (50%), Gaps = 5/174 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMN-RLA 179
           P +I  ++ L  LDL  N + G +P +      L    +  N L G IP+ +      L 
Sbjct: 142 PATIGNLTRLDVLDLEFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNGLFNNTPSLK 201

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L +  N ++G IP  +G + +L  L L  N++TG +P ++ + + + ++ L+ NG  G 
Sbjct: 202 HLIIGNNSLSGPIPSCIGSLPLLERLVLQCNNLTGPVPPSIFNMSRLHVIALASNGLTGP 261

Query: 360 IPDVFGSKSYFMVL----DLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G+KS+ + +     L +N  TG++P  LA  + +    + +N + G +P
Sbjct: 262 IP---GNKSFILPILQFFSLDYNYFTGQIPLGLAACRHLKVFSLLDNLIEGPLP 312

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 34/115 (29%), Positives = 56/115 (48%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  ++L    + G +   +G +  LS L L    + G +P  +     + IL+L  N  
Sbjct: 78  RVTAVELPDVPLQGELSPHIGNLSFLSVLNLSNTGLMGSVPDDIGRLHRLKILDLGHNDM 137

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
            G +P   G+ +   VLDL FN L+G +P  L  +  +  ++I  N+L G IP G
Sbjct: 138 LGGVPATIGNLTRLDVLDLEFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNG 192

[133][TOP]
>UniRef100_Q7XH57 Putative uncharacterized protein n=2 Tax=Oryza sativa
            RepID=Q7XH57_ORYSJ
          Length = 1098

 Score =  124 bits (310), Expect = 7e-27
 Identities = 69/192 (35%), Positives = 108/192 (56%), Gaps = 1/192 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P ++ ++  L+ L LS+N + G +P + G L  L    LS N+L G+IP  +  +  L  
Sbjct: 535  PPALSKLPNLVELKLSSNHVNGVIPPEIGNLINLYSLNLSFNKLSGSIPSQLGNLRDLEY 594

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGI-LNLSRNGFEGT 359
            LD+S N ++G IP  LG+   L  L+++ N  +G +P+T+ +   + I L++S N  +G 
Sbjct: 595  LDVSRNSLSGPIPEELGRCTKLQLLRINNNHFSGNLPATIGNLASIQIMLDVSNNKLDGL 654

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
            +P  FG     + L+LS N+ TGR+P S A    +  LD S N+L G +P G  F +  A
Sbjct: 655  LPQDFGRMQMLVFLNLSHNQFTGRIPTSFASMVSLSTLDASYNNLEGPLPAGRLFQNASA 714

Query: 540  ASFSNNDCLCGN 575
            + F NN  LCGN
Sbjct: 715  SWFLNNKGLCGN 726

 Score =  108 bits (270), Expect = 3e-22
 Identities = 60/187 (32%), Positives = 103/187 (55%), Gaps = 2/187 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + +++ L +L L +N++ GE+P+  G L K+ +  L RNQ+IG+IP  +  +  L D
Sbjct: 223 PPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIKLYLFRNQIIGSIPPEIGNLAMLTD 282

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L+ N++ GS+P  LG + +L+ L L  N +TG IP  L   + +  L L  N   G+I
Sbjct: 283 LVLNENKLKGSLPTELGNLTMLNNLFLHENQITGSIPPGLGIISNLQNLILHSNQISGSI 342

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLD 536
           P    + +  + LDLS N++ G +P        +  L +  N + G+IP  +G+ F ++ 
Sbjct: 343 PGTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQLLSLEENQISGSIPKSLGN-FQNMQ 401

Query: 537 AASFSNN 557
             +F +N
Sbjct: 402 NLNFRSN 408

 Score =  108 bits (270), Expect = 3e-22
 Identities = 61/169 (36%), Positives = 97/169 (57%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++ ++ L L  NQIIG +P + G L  L+  +L+ N+L G++P  +  +  L +
Sbjct: 247 PTCIGNLTKMIKLYLFRNQIIGSIPPEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNN 306

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+ITGSIP  LG +  L  L L  N ++G IP TL + T +  L+LS+N   G+I
Sbjct: 307 LFLHENQITGSIPPGLGIISNLQNLILHSNQISGSIPGTLANLTKLIALDLSKNQINGSI 366

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P  FG+     +L L  N+++G +P SL   + M +L+  +N L  ++P
Sbjct: 367 PQEFGNLVNLQLLSLEENQISGSIPKSLGNFQNMQNLNFRSNQLSNSLP 415

 Score =  105 bits (261), Expect = 3e-21
 Identities = 57/169 (33%), Positives = 89/169 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +S L +LDL  NQ+ G +P +  +L++L+   LS N L G IP SV  +  + +
Sbjct: 103 PSSISSLSALTYLDLQLNQLTGRMPDEISELQRLTMLDLSYNNLTGHIPASVGNLTMITE 162

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L +  N ++G IP  +G +  L  L+L  N+++G+IP+TL + T +    L  N   G +
Sbjct: 163 LSIHRNMVSGPIPKEIGMLANLQLLQLSNNTLSGEIPTTLANLTNLDTFYLDGNELSGPV 222

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P      +    L L  NKLTG +P  +     M  L +  N + G+IP
Sbjct: 223 PPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIKLYLFRNQIIGSIP 271

 Score =  102 bits (255), Expect = 2e-20
 Identities = 55/160 (34%), Positives = 85/160 (53%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L ++DLS+N + G +PS    L  L+   L  NQL G +PD + ++ RL  LDLS N +T
Sbjct: 88  LTYIDLSSNSVYGPIPSSISSLSALTYLDLQLNQLTGRMPDEISELQRLTMLDLSYNNLT 147

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G IP  +G + +++ L +  N ++G IP  +     + +L LS N   G IP    + + 
Sbjct: 148 GHIPASVGNLTMITELSIHRNMVSGPIPKEIGMLANLQLLQLSNNTLSGEIPTTLANLTN 207

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                L  N+L+G VP  L K   + +L + +N L G IP
Sbjct: 208 LDTFYLDGNELSGPVPPKLCKLTNLQYLALGDNKLTGEIP 247

 Score =  100 bits (248), Expect = 1e-19
 Identities = 61/169 (36%), Positives = 87/169 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+   + L+ L L  NQ+ G++   FG   KL +  L  N+L G I         LA 
Sbjct: 463 PRSLKTCTSLVRLFLDGNQLTGDISKHFGVYPKLKKMSLMSNRLSGQISPKWGACPELAI 522

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+++ N ITG+IP  L K+  L  LKL  N + G IP  + +   +  LNLS N   G+I
Sbjct: 523 LNIAENMITGTIPPALSKLPNLVELKLSSNHVNGVIPPEIGNLINLYSLNLSFNKLSGSI 582

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+      LD+S N L+G +P  L +   +  L I+NNH  GN+P
Sbjct: 583 PSQLGNLRDLEYLDVSRNSLSGPIPEELGRCTKLQLLRINNNHFSGNLP 631

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 56/169 (33%), Positives = 90/169 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  ++ L +L L  NQI G +P   G +  L   +L  NQ+ G+IP ++  + +L  
Sbjct: 295 PTELGNLTMLNNLFLHENQITGSIPPGLGIISNLQNLILHSNQISGSIPGTLANLTKLIA 354

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N+I GSIP   G +  L  L L+ N ++G IP +L +   M  LN   N    ++
Sbjct: 355 LDLSKNQINGSIPQEFGNLVNLQLLSLEENQISGSIPKSLGNFQNMQNLNFRSNQLSNSL 414

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P  FG+ +  + LDL+ N L+G++P ++     +  L +S N   G +P
Sbjct: 415 PQEFGNITNMVELDLASNSLSGQLPANICAGTSLKLLFLSLNMFNGPVP 463

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 52/168 (30%), Positives = 89/168 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++  ++ L+ LDLS NQI G +P +FG L  L    L  NQ+ G+IP S+     + +
Sbjct: 343 PGTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQLLSLEENQISGSIPKSLGNFQNMQN 402

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+   N+++ S+P   G +  +  L L  NS++GQ+P+ + + T + +L LS N F G +
Sbjct: 403 LNFRSNQLSNSLPQEFGNITNMVELDLASNSLSGQLPANICAGTSLKLLFLSLNMFNGPV 462

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P    + +  + L L  N+LTG +         +  + + +N L G I
Sbjct: 463 PRSLKTCTSLVRLFLDGNQLTGDISKHFGVYPKLKKMSLMSNRLSGQI 510

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 55/171 (32%), Positives = 86/171 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ +  L +  N + G +P + G L  L    LS N L G IP ++  +  L  
Sbjct: 151 PASVGNLTMITELSIHRNMVSGPIPKEIGMLANLQLLQLSNNTLSGEIPTTLANLTNLDT 210

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
             L  N ++G +P +L K+  L  L L  N +TG+IP+ + + T M  L L RN   G+I
Sbjct: 211 FYLDGNELSGPVPPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIKLYLFRNQIIGSI 270

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           P   G+ +    L L+ NKL G +P  L     + +L +  N + G+IP G
Sbjct: 271 PPEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNNLFLHENQITGSIPPG 321

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 53/169 (31%), Positives = 85/169 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++ L  L L+ N++ G LP++ G L  L+   L  NQ+ G+IP  +  ++ L +
Sbjct: 271 PPEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNNLFLHENQITGSIPPGLGIISNLQN 330

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+I+GSIP  L  +  L  L L  N + G IP    +   + +L+L  N   G+I
Sbjct: 331 LILHSNQISGSIPGTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQLLSLEENQISGSI 390

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+      L+   N+L+  +P        M  LD+++N L G +P
Sbjct: 391 PKSLGNFQNMQNLNFRSNQLSNSLPQEFGNITNMVELDLASNSLSGQLP 439

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 54/169 (31%), Positives = 87/169 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++  ++ L    L  N++ G +P    KL  L    L  N+L G IP  +  + ++  
Sbjct: 199 PTTLANLTNLDTFYLDGNELSGPVPPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIK 258

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+I GSIP  +G + +L+ L L+ N + G +P+ L + T +  L L  N   G+I
Sbjct: 259 LYLFRNQIIGSIPPEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNNLFLHENQITGSI 318

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G  S    L L  N+++G +P +LA    +  LD+S N + G+IP
Sbjct: 319 PPGLGIISNLQNLILHSNQISGSIPGTLANLTKLIALDLSKNQINGSIP 367

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 56/168 (33%), Positives = 81/168 (48%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  IS L +L L +NQI G +P     L KL    LS+NQ+ G+IP     +  L  
Sbjct: 319 PPGLGIISNLQNLILHSNQISGSIPGTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQL 378

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+I+GSIP  LG  + +  L    N ++  +P    + T M  L+L+ N   G +
Sbjct: 379 LSLEENQISGSIPKSLGNFQNMQNLNFRSNQLSNSLPQEFGNITNMVELDLASNSLSGQL 438

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P    + +   +L LS N   G VP SL     +  L +  N L G+I
Sbjct: 439 PANICAGTSLKLLFLSLNMFNGPVPRSLKTCTSLVRLFLDGNQLTGDI 486

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 58/169 (34%), Positives = 79/169 (46%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I   + L  L LS N   G +P        L R  L  NQL G I        +L  
Sbjct: 439 PANICAGTSLKLLFLSLNMFNGPVPRSLKTCTSLVRLFLDGNQLTGDISKHFGVYPKLKK 498

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           + L  NR++G I  + G    L+ L +  N +TG IP  L     +  L LS N   G I
Sbjct: 499 MSLMSNRLSGQISPKWGACPELAILNIAENMITGTIPPALSKLPNLVELKLSSNHVNGVI 558

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+      L+LSFNKL+G +P+ L   + + +LD+S N L G IP
Sbjct: 559 PPEIGNLINLYSLNLSFNKLSGSIPSQLGNLRDLEYLDVSRNSLSGPIP 607

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 50/149 (33%), Positives = 83/149 (55%)
 Frame = +3

Query: 63  IGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           +GEL  +F  L  L+   LS N + G IP S+  ++ L  LDL +N++TG +P  + +++
Sbjct: 77  LGEL--NFSSLPFLTYIDLSSNSVYGPIPSSISSLSALTYLDLQLNQLTGRMPDEISELQ 134

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L+ L L  N++TG IP+++ + T +  L++ RN   G IP   G  +   +L LS N L
Sbjct: 135 RLTMLDLSYNNLTGHIPASVGNLTMITELSIHRNMVSGPIPKEIGMLANLQLLQLSNNTL 194

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +G +P +LA    +    +  N L G +P
Sbjct: 195 SGEIPTTLANLTNLDTFYLDGNELSGPVP 223

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 45/169 (26%), Positives = 72/169 (42%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P     +  L  L L  NQI G +P   G  + +       NQL  ++P     +  + +
Sbjct: 367 PQEFGNLVNLQLLSLEENQISGSIPKSLGNFQNMQNLNFRSNQLSNSLPQEFGNITNMVE 426

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL+ N ++G +P  +     L  L L  N   G +P +L + T +  L L  N   G I
Sbjct: 427 LDLASNSLSGQLPANICAGTSLKLLFLSLNMFNGPVPRSLKTCTSLVRLFLDGNQLTGDI 486

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              FG       + L  N+L+G++         +  L+I+ N + G IP
Sbjct: 487 SKHFGVYPKLKKMSLMSNRLSGQISPKWGACPELAILNIAENMITGTIP 535

[134][TOP]
>UniRef100_Q53PE1 Os11g0172400 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q53PE1_ORYSJ
          Length = 666

 Score =  124 bits (310), Expect = 7e-27
 Identities = 68/192 (35%), Positives = 106/192 (55%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  +S L+ L L  N++ G++PS   +L+ L    +  N L G IP+++  +  L  
Sbjct: 84  PSSLSNLSQLVALTLQFNKLDGQIPSLGNQLQMLQIFNVLYNNLHGVIPNAIFSLPSLIQ 143

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +DLS N + G +P+ +G  + L +LKL  N ++G I + L     + ++ L RN F G+I
Sbjct: 144 VDLSYNNLHGQLPIDIGNAKQLVSLKLSSNKLSGDILNALGDCESLEVIRLDRNNFSGSI 203

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P   G+ S   VL+LS N LTG +P SL+  +++  L++S NHL G IP    F +  A 
Sbjct: 204 PISLGNISSLRVLNLSLNNLTGSIPVSLSNLQYLEKLNLSFNHLKGEIPAKGIFKNATAF 263

Query: 543 SFSNNDCLCGNP 578
               N  LCG P
Sbjct: 264 QIDGNQGLCGGP 275

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 51/170 (30%), Positives = 86/170 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +S L+ L +  N   G LP   G L++L    L  N   G IP S+  +++L  
Sbjct: 36  PSGIEHLSNLIALSVGTNDFTGTLPEWLGNLKQLQILSLYDNYFTGFIPSSLSNLSQLVA 95

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N++ G IP    ++++L    +  N++ G IP+ + S   +  ++LS N   G +
Sbjct: 96  LTLQFNKLDGQIPSLGNQLQMLQIFNVLYNNLHGVIPNAIFSLPSLIQVDLSYNNLHGQL 155

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           P   G+    + L LS NKL+G + N+L   + +  + +  N+  G+IPI
Sbjct: 156 PIDIGNAKQLVSLKLSSNKLSGDILNALGDCESLEVIRLDRNNFSGSIPI 205

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 56/169 (33%), Positives = 78/169 (46%), Gaps = 1/169 (0%)
 Frame = +3

Query: 3   PMSIVRISG-LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P S+   S  L  L L  N I    PS    L  L    +  N   GT+P+ +  + +L 
Sbjct: 11  PSSLSNFSAHLQRLHLGGNAISESFPSGIEHLSNLIALSVGTNDFTGTLPEWLGNLKQLQ 70

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N  TG IP  L  +  L  L L  N + GQIPS       + I N+  N   G 
Sbjct: 71  ILSLYDNYFTGFIPSSLSNLSQLVALTLQFNKLDGQIPSLGNQLQMLQIFNVLYNNLHGV 130

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           IP+   S    + +DLS+N L G++P  +  AK +  L +S+N L G+I
Sbjct: 131 IPNAIFSLPSLIQVDLSYNNLHGQLPIDIGNAKQLVSLKLSSNKLSGDI 179

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 46/157 (29%), Positives = 78/157 (49%), Gaps = 1/157 (0%)
 Frame = +3

Query: 45  LSNNQIIGELPSDFGKLRK-LSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIP 221
           ++ N++ G LPS        L R  L  N +  + P  +  ++ L  L +  N  TG++P
Sbjct: 1   MAYNRLEGHLPSSLSNFSAHLQRLHLGGNAISESFPSGIEHLSNLIALSVGTNDFTGTLP 60

Query: 222 VRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVL 401
             LG ++ L  L L  N  TG IPS+L + + +  L L  N  +G IP +        + 
Sbjct: 61  EWLGNLKQLQILSLYDNYFTGFIPSSLSNLSQLVALTLQFNKLDGQIPSLGNQLQMLQIF 120

Query: 402 DLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           ++ +N L G +PN++     +  +D+S N+L G +PI
Sbjct: 121 NVLYNNLHGVIPNAIFSLPSLIQVDLSYNNLHGQLPI 157

[135][TOP]
>UniRef100_Q0IZ89 Os10g0119200 protein n=1 Tax=Oryza sativa Japonica Group
            RepID=Q0IZ89_ORYSJ
          Length = 1092

 Score =  124 bits (310), Expect = 7e-27
 Identities = 69/192 (35%), Positives = 108/192 (56%), Gaps = 1/192 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P ++ ++  L+ L LS+N + G +P + G L  L    LS N+L G+IP  +  +  L  
Sbjct: 535  PPALSKLPNLVELKLSSNHVNGVIPPEIGNLINLYSLNLSFNKLSGSIPSQLGNLRDLEY 594

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGI-LNLSRNGFEGT 359
            LD+S N ++G IP  LG+   L  L+++ N  +G +P+T+ +   + I L++S N  +G 
Sbjct: 595  LDVSRNSLSGPIPEELGRCTKLQLLRINNNHFSGNLPATIGNLASIQIMLDVSNNKLDGL 654

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
            +P  FG     + L+LS N+ TGR+P S A    +  LD S N+L G +P G  F +  A
Sbjct: 655  LPQDFGRMQMLVFLNLSHNQFTGRIPTSFASMVSLSTLDASYNNLEGPLPAGRLFQNASA 714

Query: 540  ASFSNNDCLCGN 575
            + F NN  LCGN
Sbjct: 715  SWFLNNKGLCGN 726

 Score =  108 bits (270), Expect = 3e-22
 Identities = 60/187 (32%), Positives = 103/187 (55%), Gaps = 2/187 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + +++ L +L L +N++ GE+P+  G L K+ +  L RNQ+IG+IP  +  +  L D
Sbjct: 223 PPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIKLYLFRNQIIGSIPPEIGNLAMLTD 282

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L+ N++ GS+P  LG + +L+ L L  N +TG IP  L   + +  L L  N   G+I
Sbjct: 283 LVLNENKLKGSLPTELGNLTMLNNLFLHENQITGSIPPGLGIISNLQNLILHSNQISGSI 342

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLD 536
           P    + +  + LDLS N++ G +P        +  L +  N + G+IP  +G+ F ++ 
Sbjct: 343 PGTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQLLSLEENQISGSIPKSLGN-FQNMQ 401

Query: 537 AASFSNN 557
             +F +N
Sbjct: 402 NLNFRSN 408

 Score =  108 bits (270), Expect = 3e-22
 Identities = 61/169 (36%), Positives = 97/169 (57%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++ ++ L L  NQIIG +P + G L  L+  +L+ N+L G++P  +  +  L +
Sbjct: 247 PTCIGNLTKMIKLYLFRNQIIGSIPPEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNN 306

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+ITGSIP  LG +  L  L L  N ++G IP TL + T +  L+LS+N   G+I
Sbjct: 307 LFLHENQITGSIPPGLGIISNLQNLILHSNQISGSIPGTLANLTKLIALDLSKNQINGSI 366

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P  FG+     +L L  N+++G +P SL   + M +L+  +N L  ++P
Sbjct: 367 PQEFGNLVNLQLLSLEENQISGSIPKSLGNFQNMQNLNFRSNQLSNSLP 415

 Score =  105 bits (261), Expect = 3e-21
 Identities = 57/169 (33%), Positives = 89/169 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +S L +LDL  NQ+ G +P +  +L++L+   LS N L G IP SV  +  + +
Sbjct: 103 PSSISSLSALTYLDLQLNQLTGRMPDEISELQRLTMLDLSYNNLTGHIPASVGNLTMITE 162

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L +  N ++G IP  +G +  L  L+L  N+++G+IP+TL + T +    L  N   G +
Sbjct: 163 LSIHRNMVSGPIPKEIGMLANLQLLQLSNNTLSGEIPTTLANLTNLDTFYLDGNELSGPV 222

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P      +    L L  NKLTG +P  +     M  L +  N + G+IP
Sbjct: 223 PPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIKLYLFRNQIIGSIP 271

 Score =  102 bits (255), Expect = 2e-20
 Identities = 55/160 (34%), Positives = 85/160 (53%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L ++DLS+N + G +PS    L  L+   L  NQL G +PD + ++ RL  LDLS N +T
Sbjct: 88  LTYIDLSSNSVYGPIPSSISSLSALTYLDLQLNQLTGRMPDEISELQRLTMLDLSYNNLT 147

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G IP  +G + +++ L +  N ++G IP  +     + +L LS N   G IP    + + 
Sbjct: 148 GHIPASVGNLTMITELSIHRNMVSGPIPKEIGMLANLQLLQLSNNTLSGEIPTTLANLTN 207

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                L  N+L+G VP  L K   + +L + +N L G IP
Sbjct: 208 LDTFYLDGNELSGPVPPKLCKLTNLQYLALGDNKLTGEIP 247

 Score =  100 bits (248), Expect = 1e-19
 Identities = 61/169 (36%), Positives = 87/169 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+   + L+ L L  NQ+ G++   FG   KL +  L  N+L G I         LA 
Sbjct: 463 PRSLKTCTSLVRLFLDGNQLTGDISKHFGVYPKLKKMSLMSNRLSGQISPKWGACPELAI 522

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+++ N ITG+IP  L K+  L  LKL  N + G IP  + +   +  LNLS N   G+I
Sbjct: 523 LNIAENMITGTIPPALSKLPNLVELKLSSNHVNGVIPPEIGNLINLYSLNLSFNKLSGSI 582

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+      LD+S N L+G +P  L +   +  L I+NNH  GN+P
Sbjct: 583 PSQLGNLRDLEYLDVSRNSLSGPIPEELGRCTKLQLLRINNNHFSGNLP 631

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 56/169 (33%), Positives = 90/169 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  ++ L +L L  NQI G +P   G +  L   +L  NQ+ G+IP ++  + +L  
Sbjct: 295 PTELGNLTMLNNLFLHENQITGSIPPGLGIISNLQNLILHSNQISGSIPGTLANLTKLIA 354

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N+I GSIP   G +  L  L L+ N ++G IP +L +   M  LN   N    ++
Sbjct: 355 LDLSKNQINGSIPQEFGNLVNLQLLSLEENQISGSIPKSLGNFQNMQNLNFRSNQLSNSL 414

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P  FG+ +  + LDL+ N L+G++P ++     +  L +S N   G +P
Sbjct: 415 PQEFGNITNMVELDLASNSLSGQLPANICAGTSLKLLFLSLNMFNGPVP 463

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 52/168 (30%), Positives = 89/168 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++  ++ L+ LDLS NQI G +P +FG L  L    L  NQ+ G+IP S+     + +
Sbjct: 343 PGTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQLLSLEENQISGSIPKSLGNFQNMQN 402

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+   N+++ S+P   G +  +  L L  NS++GQ+P+ + + T + +L LS N F G +
Sbjct: 403 LNFRSNQLSNSLPQEFGNITNMVELDLASNSLSGQLPANICAGTSLKLLFLSLNMFNGPV 462

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P    + +  + L L  N+LTG +         +  + + +N L G I
Sbjct: 463 PRSLKTCTSLVRLFLDGNQLTGDISKHFGVYPKLKKMSLMSNRLSGQI 510

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 55/171 (32%), Positives = 86/171 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ +  L +  N + G +P + G L  L    LS N L G IP ++  +  L  
Sbjct: 151 PASVGNLTMITELSIHRNMVSGPIPKEIGMLANLQLLQLSNNTLSGEIPTTLANLTNLDT 210

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
             L  N ++G +P +L K+  L  L L  N +TG+IP+ + + T M  L L RN   G+I
Sbjct: 211 FYLDGNELSGPVPPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIKLYLFRNQIIGSI 270

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           P   G+ +    L L+ NKL G +P  L     + +L +  N + G+IP G
Sbjct: 271 PPEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNNLFLHENQITGSIPPG 321

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 53/169 (31%), Positives = 85/169 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++ L  L L+ N++ G LP++ G L  L+   L  NQ+ G+IP  +  ++ L +
Sbjct: 271 PPEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNNLFLHENQITGSIPPGLGIISNLQN 330

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+I+GSIP  L  +  L  L L  N + G IP    +   + +L+L  N   G+I
Sbjct: 331 LILHSNQISGSIPGTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQLLSLEENQISGSI 390

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+      L+   N+L+  +P        M  LD+++N L G +P
Sbjct: 391 PKSLGNFQNMQNLNFRSNQLSNSLPQEFGNITNMVELDLASNSLSGQLP 439

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 54/169 (31%), Positives = 87/169 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++  ++ L    L  N++ G +P    KL  L    L  N+L G IP  +  + ++  
Sbjct: 199 PTTLANLTNLDTFYLDGNELSGPVPPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIK 258

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+I GSIP  +G + +L+ L L+ N + G +P+ L + T +  L L  N   G+I
Sbjct: 259 LYLFRNQIIGSIPPEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNNLFLHENQITGSI 318

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G  S    L L  N+++G +P +LA    +  LD+S N + G+IP
Sbjct: 319 PPGLGIISNLQNLILHSNQISGSIPGTLANLTKLIALDLSKNQINGSIP 367

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 56/168 (33%), Positives = 81/168 (48%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  IS L +L L +NQI G +P     L KL    LS+NQ+ G+IP     +  L  
Sbjct: 319 PPGLGIISNLQNLILHSNQISGSIPGTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQL 378

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+I+GSIP  LG  + +  L    N ++  +P    + T M  L+L+ N   G +
Sbjct: 379 LSLEENQISGSIPKSLGNFQNMQNLNFRSNQLSNSLPQEFGNITNMVELDLASNSLSGQL 438

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P    + +   +L LS N   G VP SL     +  L +  N L G+I
Sbjct: 439 PANICAGTSLKLLFLSLNMFNGPVPRSLKTCTSLVRLFLDGNQLTGDI 486

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 58/169 (34%), Positives = 79/169 (46%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I   + L  L LS N   G +P        L R  L  NQL G I        +L  
Sbjct: 439 PANICAGTSLKLLFLSLNMFNGPVPRSLKTCTSLVRLFLDGNQLTGDISKHFGVYPKLKK 498

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           + L  NR++G I  + G    L+ L +  N +TG IP  L     +  L LS N   G I
Sbjct: 499 MSLMSNRLSGQISPKWGACPELAILNIAENMITGTIPPALSKLPNLVELKLSSNHVNGVI 558

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+      L+LSFNKL+G +P+ L   + + +LD+S N L G IP
Sbjct: 559 PPEIGNLINLYSLNLSFNKLSGSIPSQLGNLRDLEYLDVSRNSLSGPIP 607

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 50/149 (33%), Positives = 83/149 (55%)
 Frame = +3

Query: 63  IGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMR 242
           +GEL  +F  L  L+   LS N + G IP S+  ++ L  LDL +N++TG +P  + +++
Sbjct: 77  LGEL--NFSSLPFLTYIDLSSNSVYGPIPSSISSLSALTYLDLQLNQLTGRMPDEISELQ 134

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L+ L L  N++TG IP+++ + T +  L++ RN   G IP   G  +   +L LS N L
Sbjct: 135 RLTMLDLSYNNLTGHIPASVGNLTMITELSIHRNMVSGPIPKEIGMLANLQLLQLSNNTL 194

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +G +P +LA    +    +  N L G +P
Sbjct: 195 SGEIPTTLANLTNLDTFYLDGNELSGPVP 223

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 45/169 (26%), Positives = 72/169 (42%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P     +  L  L L  NQI G +P   G  + +       NQL  ++P     +  + +
Sbjct: 367 PQEFGNLVNLQLLSLEENQISGSIPKSLGNFQNMQNLNFRSNQLSNSLPQEFGNITNMVE 426

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL+ N ++G +P  +     L  L L  N   G +P +L + T +  L L  N   G I
Sbjct: 427 LDLASNSLSGQLPANICAGTSLKLLFLSLNMFNGPVPRSLKTCTSLVRLFLDGNQLTGDI 486

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              FG       + L  N+L+G++         +  L+I+ N + G IP
Sbjct: 487 SKHFGVYPKLKKMSLMSNRLSGQISPKWGACPELAILNIAENMITGTIP 535

[136][TOP]
>UniRef100_Q00KZ7 Bacterial blight resistance protein xa26 n=1 Tax=Oryza sativa Indica
            Group RepID=Q00KZ7_ORYSI
          Length = 1100

 Score =  124 bits (310), Expect = 7e-27
 Identities = 66/190 (34%), Positives = 106/190 (55%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P +   +  ++ L L +N+I G +P D   L  L   LLS NQL  T+P S+  ++++  
Sbjct: 541  PSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNQLTSTVPPSLFHLDKIIR 600

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N ++G++PV +G ++ ++ + L  NS +G IP ++     +  LNLS N F  ++
Sbjct: 601  LDLSRNFLSGALPVDVGYLKQITIIDLSDNSFSGSIPDSIGELQMLTHLNLSANEFYDSV 660

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            PD FG+ +    LD+S N ++G +PN LA    +  L++S N L G IP G  F ++   
Sbjct: 661  PDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGIFANITLQ 720

Query: 543  SFSNNDCLCG 572
                N  LCG
Sbjct: 721  YLVGNSGLCG 730

 Score =  104 bits (260), Expect = 4e-21
 Identities = 59/173 (34%), Positives = 94/173 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  ++ L HL LS+NQ+   +P     L K+ R  LSRN L G +P  V  + ++  
Sbjct: 565  PKDMRNLTNLEHLLLSDNQLTSTVPPSLFHLDKIIRLDLSRNFLSGALPVDVGYLKQITI 624

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            +DLS N  +GSIP  +G++++L+ L L  N     +P +  + TG+  L++S N   GTI
Sbjct: 625  IDLSDNSFSGSIPDSIGELQMLTHLNLSANEFYDSVPDSFGNLTGLQTLDISHNSISGTI 684

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSP 521
            P+   + +  + L+LSFNKL G++P     A       + N+ LCG   +G P
Sbjct: 685  PNYLANFTTLVSLNLSFNKLHGQIPEGGIFANITLQYLVGNSGLCGAARLGFP 737

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 53/169 (31%), Positives = 86/169 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  ++GL  +DLS+NQ+   +P     +  L    LS N L G IP +   +  +  
Sbjct: 493 PATISNLTGLEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVK 552

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N I+GSIP  +  +  L  L L  N +T  +P +L     +  L+LSRN   G +
Sbjct: 553 LFLESNEISGSIPKDMRNLTNLEHLLLSDNQLTSTVPPSLFHLDKIIRLDLSRNFLSGAL 612

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G      ++DLS N  +G +P+S+ + + + HL++S N    ++P
Sbjct: 613 PVDVGYLKQITIIDLSDNSFSGSIPDSIGELQMLTHLNLSANEFYDSVP 661

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 56/169 (33%), Positives = 86/169 (50%), Gaps = 1/169 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           IS L  L+L+N  + G +P++ G+LR+L    L  N + G I  ++  + RL  L+L  N
Sbjct: 109 ISFLFILNLTNTGLAGSVPNEIGRLRRLELLDLGHNAMSGGILIAIGNLTRLQLLNLQFN 168

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFG 377
           ++ G IP  L  +  L ++ L  N +TG IP  L +NT  +  LN+  N   G IP   G
Sbjct: 169 QLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIG 228

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF 524
           S      L+   N LTG VP ++     +  + + +N L G IP  + F
Sbjct: 229 SLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIPGNTSF 277

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 57/162 (35%), Positives = 84/162 (51%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L    LSNN++ G LP+    L  L    LS NQL   IP+S++ +  L  LDLS N 
Sbjct: 476 SQLKWFTLSNNKLTGTLPATISNLTGLEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNS 535

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           ++G IP     +R +  L L+ N ++G IP  + + T +  L LS N    T+P      
Sbjct: 536 LSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNQLTSTVPPSLFHL 595

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              + LDLS N L+G +P  +   K +  +D+S+N   G+IP
Sbjct: 596 DKIIRLDLSRNFLSGALPVDVGYLKQITIIDLSDNSFSGSIP 637

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 63/196 (32%), Positives = 96/196 (48%), Gaps = 27/196 (13%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  ++ L  LDLS   + G +P+D G L +LS   L+RNQL G IP S+  ++ LA 
Sbjct: 346 PTELSNLTMLAVLDLSTCNLTGNIPADIGHLGQLSWLHLARNQLTGPIPASLGNLSSLAI 405

Query: 183 LDLSMNRITGSIPVRLGKM--------------------------RVLSTLKLDGNSMTG 284
           L L  N + GS+P  +  M                          R LSTL++D N +TG
Sbjct: 406 LLLKGNLLDGSLPATVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQMDFNYITG 465

Query: 285 QIPSTLLS-NTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF 461
            +P  + + ++ +    LS N   GT+P    + +   V+DLS N+L   +P S+   + 
Sbjct: 466 SLPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTGLEVIDLSHNQLRNAIPESIMTIEN 525

Query: 462 MGHLDISNNHLCGNIP 509
           +  LD+S N L G IP
Sbjct: 526 LQWLDLSGNSLSGFIP 541

 Score = 87.0 bits (214), Expect = 9e-16
 Identities = 50/158 (31%), Positives = 81/158 (51%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+L N  + GEL S  G +  L    L+   L G++P+ + ++ RL  LDL  N ++G I
Sbjct: 91  LELPNVPLQGELSSHLGNISFLFILNLTNTGLAGSVPNEIGRLRRLELLDLGHNAMSGGI 150

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFM 395
            + +G +  L  L L  N + G IP+ L     +G +NL  N   G+IP D+F +     
Sbjct: 151 LIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLT 210

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L++  N L+G +P  +     + HL+   N+L G +P
Sbjct: 211 YLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVP 248

 Score = 80.9 bits (198), Expect = 7e-14
 Identities = 57/162 (35%), Positives = 81/162 (50%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  L +  N I G LP   G L  +L    LS N+L GT+P ++  +  L  +DLS N++
Sbjct: 453 LSTLQMDFNYITGSLPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTGLEVIDLSHNQL 512

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
             +IP  +  +  L  L L GNS++G IPS       +  L L  N   G+IP    + +
Sbjct: 513 RNAIPESIMTIENLQWLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLT 572

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
               L LS N+LT  VP SL     +  LD+S N L G +P+
Sbjct: 573 NLEHLLLSDNQLTSTVPPSLFHLDKIIRLDLSRNFLSGALPV 614

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 56/173 (32%), Positives = 82/173 (47%), Gaps = 2/173 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I R+  L  LDL +N + G +    G L +L    L  NQL G IP  +  ++ L  
Sbjct: 127 PNEIGRLRRLELLDLGHNAMSGGILIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGS 186

Query: 183 LDLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           ++L  N +TGSIP  L     +L+ L +  NS++G IP  + S   +  LN   N   G 
Sbjct: 187 MNLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGA 246

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP-NSLAKAKFMGHLDISNNHLCGNIPIG 515
           +P    + S    + L  N LTG +P N+      +    IS N+  G IP+G
Sbjct: 247 VPPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRMFAISKNNFFGQIPLG 299

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 45/156 (28%), Positives = 78/156 (50%), Gaps = 3/156 (1%)
 Frame = +3

Query: 51  NNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRL 230
           NN   G +P++   L  L+   LS   L G IP  +  + +L+ L L+ N++TG IP  L
Sbjct: 338 NNLDAGPIPTELSNLTMLAVLDLSTCNLTGNIPADIGHLGQLSWLHLARNQLTGPIPASL 397

Query: 231 GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP--DVFGSKSYFMVLD 404
           G +  L+ L L GN + G +P+T+ S   +  ++++ N   G +       +      L 
Sbjct: 398 GNLSSLAILLLKGNLLDGSLPATVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQ 457

Query: 405 LSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIP 509
           + FN +TG +P+ +   +  +    +SNN L G +P
Sbjct: 458 MDFNYITGSLPDYVGNLSSQLKWFTLSNNKLTGTLP 493

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 51/171 (29%), Positives = 81/171 (47%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  +S L  + L +N + G +P +    L  L    +S+N   G IP  +     L 
Sbjct: 248 PPAIFNMSKLSTISLISNGLTGPIPGNTSFSLPVLRMFAISKNNFFGQIPLGLAACPYLQ 307

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSM-TGQIPSTLLSNTGMGILNLSRNGFEG 356
            + +  N   G +P  LGK+  L+ + L  N++  G IP+ L + T + +L+LS     G
Sbjct: 308 VIAMPYNLFEGVLPPWLGKLTSLNAISLGWNNLDAGPIPTELSNLTMLAVLDLSTCNLTG 367

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            IP   G       L L+ N+LTG +P SL     +  L +  N L G++P
Sbjct: 368 NIPADIGHLGQLSWLHLARNQLTGPIPASLGNLSSLAILLLKGNLLDGSLP 418

 Score = 57.4 bits (137), Expect = 8e-07
 Identities = 31/116 (26%), Positives = 57/116 (49%)
 Frame = +3

Query: 162 KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
           +  R+  L+L    + G +   LG +  L  L L    + G +P+ +     + +L+L  
Sbjct: 84  RRQRVTALELPNVPLQGELSSHLGNISFLFILNLTNTGLAGSVPNEIGRLRRLELLDLGH 143

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           N   G I    G+ +   +L+L FN+L G +P  L     +G +++ +N+L G+IP
Sbjct: 144 NAMSGGILIAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIP 199

[137][TOP]
>UniRef100_C7J7S1 Os10g0207100 protein n=1 Tax=Oryza sativa Japonica Group
            RepID=C7J7S1_ORYSJ
          Length = 1100

 Score =  124 bits (310), Expect = 7e-27
 Identities = 65/190 (34%), Positives = 102/190 (53%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P +   +  ++ L L NN+  G +  D G L KL    LS NQL  T+P S+  ++ L +
Sbjct: 538  PSNTAMLKNVVMLFLQNNEFSGSIIEDIGNLTKLEHLRLSNNQLSSTVPPSLFHLDSLIE 597

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N  +G++PV +G ++ +  + L  N   G +P ++     +  LNLS N F  +I
Sbjct: 598  LDLSRNLFSGALPVDIGHLKQIYKMDLSSNHFLGSLPDSIGQIQMITYLNLSINSFNDSI 657

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P+ FG+ +    LDLS N ++G +P  L+    +  L++S N+L G IP G  F ++   
Sbjct: 658  PNSFGNLTSLQTLDLSHNNISGTIPKYLSSFTMLASLNLSFNNLHGQIPGGGVFSNITLQ 717

Query: 543  SFSNNDCLCG 572
            S   N  LCG
Sbjct: 718  SLVGNSGLCG 727

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 59/172 (34%), Positives = 88/172 (51%), Gaps = 1/172 (0%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  +S L  L+LSN  ++G +P D G+L +L    L  N ++G +P ++  + RL  LDL
Sbjct: 131 IGNLSFLSVLNLSNTGLMGSVPDDIGRLHRLKILDLGHNDMLGGVPATIGNLTRLDVLDL 190

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT-GMGILNLSRNGFEGTIPD 368
             N ++G IPV L     L ++ +  N +TG IP+ L +NT  +  L +  N   G IP 
Sbjct: 191 EFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNGLFNNTPSLKHLIIGNNSLSGPIPS 250

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF 524
             GS      L L  N LTG VP S+     +  + +++N L G IP    F
Sbjct: 251 CIGSLPLLERLVLQCNNLTGPVPPSIFNMSRLHVIALASNGLTGPIPGNKSF 302

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 57/172 (33%), Positives = 93/172 (54%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLI-GTIPDSVLKMNRLA 179
           P+ +     L    L +N I G LPS  GKL KL+   L  N L+ G I D++  +  L 
Sbjct: 322 PLGLAACRHLKVFSLLDNLIEGPLPSWLGKLTKLNVISLGENLLVVGPIRDALSNLTMLN 381

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            LDL+M  +TG+IP  LG++  LS L+L  N +TG IP++L + + + +L L  N  +G 
Sbjct: 382 FLDLAMCNLTGAIPADLGQIGHLSVLRLSTNQLTGPIPASLGNLSALSVLLLDDNHLDGL 441

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+ +    L +S N L G +   ++++  + +  L I++N   G +P
Sbjct: 442 LPTTIGNMNSLTELIISENGLQGDLNFLSAVSNCRKLSVLCINSNRFTGILP 493

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 48/158 (30%), Positives = 82/158 (51%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           ++L +  + GEL    G L  LS   LS   L+G++PD + +++RL  LDL  N + G +
Sbjct: 116 VELPDVPLQGELSPHIGNLSFLSVLNLSNTGLMGSVPDDIGRLHRLKILDLGHNDMLGGV 175

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD-VFGSKSYFM 395
           P  +G +  L  L L+ NS++G IP  L  +  +  +N+  N   G IP+ +F +     
Sbjct: 176 PATIGNLTRLDVLDLEFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNGLFNNTPSLK 235

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L +  N L+G +P+ +     +  L +  N+L G +P
Sbjct: 236 HLIIGNNSLSGPIPSCIGSLPLLERLVLQCNNLTGPVP 273

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 57/186 (30%), Positives = 81/186 (43%), Gaps = 26/186 (13%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI- 206
           L HL + NN + G +PS  G L  L R +L  N L G +P S+  M+RL  + L+ N + 
Sbjct: 234 LKHLIIGNNSLSGPIPSCIGSLPLLERLVLQCNNLTGPVPPSIFNMSRLHVIALASNGLT 293

Query: 207 ------------------------TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT 314
                                   TG IP+ L   R L    L  N + G +PS L   T
Sbjct: 294 GPIPGNKSFILPILQFFSLDYNYFTGQIPLGLAACRHLKVFSLLDNLIEGPLPSWLGKLT 353

Query: 315 GMGILNLSRNGF-EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
            + +++L  N    G I D   + +    LDL+   LTG +P  L +   +  L +S N 
Sbjct: 354 KLNVISLGENLLVVGPIRDALSNLTMLNFLDLAMCNLTGAIPADLGQIGHLSVLRLSTNQ 413

Query: 492 LCGNIP 509
           L G IP
Sbjct: 414 LTGPIP 419

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 64/217 (29%), Positives = 90/217 (41%), Gaps = 47/217 (21%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  + +I  L  L LS NQ+ G +P+  G L  LS  LL  N L G +P ++  MN L +
Sbjct: 395  PADLGQIGHLSVLRLSTNQLTGPIPASLGNLSALSVLLLDDNHLDGLLPTTIGNMNSLTE 454

Query: 183  LDLS--------------------------MNRITGSIPVRLG----------------- 233
            L +S                           NR TG +P  LG                 
Sbjct: 455  LIISENGLQGDLNFLSAVSNCRKLSVLCINSNRFTGILPDYLGNLSSTLESFLASRIKLS 514

Query: 234  ----KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVL 401
                +M  L  L L GN++ G IPS       + +L L  N F G+I +  G+ +    L
Sbjct: 515  ESIMEMENLHMLDLSGNNLAGSIPSNTAMLKNVVMLFLQNNEFSGSIIEDIGNLTKLEHL 574

Query: 402  DLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
             LS N+L+  VP SL     +  LD+S N   G +P+
Sbjct: 575  RLSNNQLSSTVPPSLFHLDSLIELDLSRNLFSGALPV 611

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 48/174 (27%), Positives = 87/174 (50%), Gaps = 5/174 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMN-RLA 179
           P +I  ++ L  LDL  N + G +P +      L    +  N L G IP+ +      L 
Sbjct: 176 PATIGNLTRLDVLDLEFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNGLFNNTPSLK 235

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L +  N ++G IP  +G + +L  L L  N++TG +P ++ + + + ++ L+ NG  G 
Sbjct: 236 HLIIGNNSLSGPIPSCIGSLPLLERLVLQCNNLTGPVPPSIFNMSRLHVIALASNGLTGP 295

Query: 360 IPDVFGSKSYFMVL----DLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G+KS+ + +     L +N  TG++P  LA  + +    + +N + G +P
Sbjct: 296 IP---GNKSFILPILQFFSLDYNYFTGQIPLGLAACRHLKVFSLLDNLIEGPLP 346

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 34/115 (29%), Positives = 56/115 (48%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  ++L    + G +   +G +  LS L L    + G +P  +     + IL+L  N  
Sbjct: 112 RVTAVELPDVPLQGELSPHIGNLSFLSVLNLSNTGLMGSVPDDIGRLHRLKILDLGHNDM 171

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
            G +P   G+ +   VLDL FN L+G +P  L  +  +  ++I  N+L G IP G
Sbjct: 172 LGGVPATIGNLTRLDVLDLEFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNG 226

[138][TOP]
>UniRef100_C6FF63 Leucine-rich repeat protein n=1 Tax=Glycine max RepID=C6FF63_SOYBN
          Length = 339

 Score =  124 bits (310), Expect = 7e-27
 Identities = 76/215 (35%), Positives = 112/215 (52%), Gaps = 25/215 (11%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           +I +++ L +LDLSNN + G +P  F +L+ L    +S N L G IP S+ K+ +LA LD
Sbjct: 115 AIAKLTKLKYLDLSNNNLSGPIPDFFAQLKNLDDIDISFNNLSGPIPSSLGKLPKLAYLD 174

Query: 189 LSMNRITGSIPVRLGKMRVLS-TLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           LS N++TGSIP   G  +     + L  N ++G++P++ L+N     ++LSRN  EG   
Sbjct: 175 LSRNKLTGSIPASFGSFQKPGPAIMLSKNQLSGRLPAS-LANLDSDRIDLSRNKLEGDAS 233

Query: 366 DVFGSKSYFMVLDLS------------------------FNKLTGRVPNSLAKAKFMGHL 473
            +FGS      LDLS                         NK+ G +P  L K +     
Sbjct: 234 MLFGSNKRTWSLDLSRNNFAFDLSRVEIPHKTLARLDLNHNKIYGSLPVGLTKVEHFQLF 293

Query: 474 DISNNHLCGNIPIGSPFDHLDAASFSNNDCLCGNP 578
           D+S N LCG IP G     +D + +S+N CLCG+P
Sbjct: 294 DVSYNQLCGLIPKGGELQKIDKSLYSHNKCLCGSP 328

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 52/163 (31%), Positives = 87/163 (53%), Gaps = 2/163 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSR-NQLIGTIPDSVLKMNRLADLDLSM 197
           IS  +     +  +  ++P   G L  L   +  +  +L+G I  ++ K+ +L  LDLS 
Sbjct: 70  ISVALSSPFPDTNLSAQIPPSVGDLPYLESLVFHKFPKLVGPIQPAIAKLTKLKYLDLSN 129

Query: 198 NRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
           N ++G IP    +++ L  + +  N+++G IPS+L     +  L+LSRN   G+IP  FG
Sbjct: 130 NNLSGPIPDFFAQLKNLDDIDISFNNLSGPIPSSLGKLPKLAYLDLSRNKLTGSIPASFG 189

Query: 378 S-KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGN 503
           S +     + LS N+L+GR+P SLA       +D+S N L G+
Sbjct: 190 SFQKPGPAIMLSKNQLSGRLPASLANLD-SDRIDLSRNKLEGD 231

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 40/121 (33%), Positives = 60/121 (49%), Gaps = 5/121 (4%)
 Frame = +3

Query: 162 KMNRLADLDLSM----NRITGSIPVRLGKMRVLSTLKLDG-NSMTGQIPSTLLSNTGMGI 326
           K NR+  + LS       ++  IP  +G +  L +L       + G I   +   T +  
Sbjct: 65  KTNRVISVALSSPFPDTNLSAQIPPSVGDLPYLESLVFHKFPKLVGPIQPAIAKLTKLKY 124

Query: 327 LNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           L+LS N   G IPD F        +D+SFN L+G +P+SL K   + +LD+S N L G+I
Sbjct: 125 LDLSNNNLSGPIPDFFAQLKNLDDIDISFNNLSGPIPSSLGKLPKLAYLDLSRNKLTGSI 184

Query: 507 P 509
           P
Sbjct: 185 P 185

[139][TOP]
>UniRef100_B8A9A8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
            RepID=B8A9A8_ORYSI
          Length = 1323

 Score =  124 bits (310), Expect = 7e-27
 Identities = 75/215 (34%), Positives = 105/215 (48%), Gaps = 25/215 (11%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P SI  ++ L+ LDLSNNQ+ G +P   G + +L+   LS N+L+ +IPD +  +  L D
Sbjct: 439  PFSIGNLTQLLTLDLSNNQLNGSIPKSLGSMERLTNLDLSSNRLVESIPDVIFSLPSLTD 498

Query: 183  -------------------------LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQ 287
                                     L LS N ++G IP  LG    L  L LD N  TG 
Sbjct: 499  SLLLSDNYLSGALPPKVGNLRRATTLSLSRNNLSGKIPTTLGDCASLVYLALDSNHFTGS 558

Query: 288  IPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
            IP +L +  G+ ILNL+RN   G+IP    +      L L+ N L+G +P  L K+  + 
Sbjct: 559  IPPSLGNLRGLSILNLTRNALSGSIPQQLSNIHGLQQLYLAHNNLSGTIPQFLEKSSALI 618

Query: 468  HLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
             LD+S NHL G +P    F ++   S   N  LCG
Sbjct: 619  ELDLSYNHLSGEVPSHGLFANMSGFSVLGNYGLCG 653

 Score =  105 bits (262), Expect = 3e-21
 Identities = 59/170 (34%), Positives = 88/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  + G+  L+   N + G++P D G+LR L    L+ N + G IP S+  + +L  
Sbjct: 391 PPGIGSLKGIEDLEFQGNNLFGDIPGDIGRLRNLKVLWLNMNNMSGGIPFSIGNLTQLLT 450

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGM-GILNLSRNGFEGT 359
           LDLS N++ GSIP  LG M  L+ L L  N +   IP  + S   +   L LS N   G 
Sbjct: 451 LDLSNNQLNGSIPKSLGSMERLTNLDLSSNRLVESIPDVIFSLPSLTDSLLLSDNYLSGA 510

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+      L LS N L+G++P +L     + +L + +NH  G+IP
Sbjct: 511 LPPKVGNLRRATTLSLSRNNLSGKIPTTLGDCASLVYLALDSNHFTGSIP 560

 Score =  104 bits (260), Expect = 4e-21
 Identities = 63/154 (40%), Positives = 81/154 (52%)
 Frame = +3

Query: 45  LSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPV 224
           LS+N + G LP   G LR+ +   LSRN L G IP ++     L  L L  N  TGSIP 
Sbjct: 502 LSDNYLSGALPPKVGNLRRATTLSLSRNNLSGKIPTTLGDCASLVYLALDSNHFTGSIPP 561

Query: 225 RLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLD 404
            LG +R LS L L  N+++G IP  L +  G+  L L+ N   GTIP      S  + LD
Sbjct: 562 SLGNLRGLSILNLTRNALSGSIPQQLSNIHGLQQLYLAHNNLSGTIPQFLEKSSALIELD 621

Query: 405 LSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           LS+N L+G VP+    A   G   + N  LCG I
Sbjct: 622 LSYNHLSGEVPSHGLFANMSGFSVLGNYGLCGGI 655

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 55/162 (33%), Positives = 89/162 (54%), Gaps = 2/162 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKL-RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  +DLS+N + G LPS    L R +    +++NQ+ G IP  +  +  + DL+   N +
Sbjct: 351 LQVIDLSDNTLGGILPSFIANLSRSIQWLSMAKNQISGIIPPGIGSLKGIEDLEFQGNNL 410

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
            G IP  +G++R L  L L+ N+M+G IP ++ + T +  L+LS N   G+IP   GS  
Sbjct: 411 FGDIPGDIGRLRNLKVLWLNMNNMSGGIPFSIGNLTQLLTLDLSNNQLNGSIPKSLGSME 470

Query: 387 YFMVLDLSFNKLTGRVPNSL-AKAKFMGHLDISNNHLCGNIP 509
               LDLS N+L   +P+ + +       L +S+N+L G +P
Sbjct: 471 RLTNLDLSSNRLVESIPDVIFSLPSLTDSLLLSDNYLSGALP 512

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 51/172 (29%), Positives = 84/172 (48%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ +   S L+ L +  N++ G +PS  G L +L    L  N L GT+P S+  +  L  
Sbjct: 142 PVGLCNCSNLVFLSVEANELHGAIPSCLGSLLQLKVLYLGENNLTGTVPPSLGNLTMLLQ 201

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           + L  N++ G+IP  L  +R L  ++   NS++G +P    + + +  L  S N   G +
Sbjct: 202 IALYQNQLEGTIPEGLSGLRYLQYIQASRNSLSGTLPPLFFNMSSLQYLGFSSNKLHGRL 261

Query: 363 PDVFGSK-SYFMVLDLS--FNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G++     VL L    N  +G +P SL+ A  +  L ++ N   G IP
Sbjct: 262 PPDAGTRLPNLQVLRLGGIGNNFSGTIPASLSNATEIQVLGLARNSFEGRIP 313

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 63/204 (30%), Positives = 96/204 (47%), Gaps = 33/204 (16%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ L+ + L  NQ+ G +P     LR L     SRN L GT+P     M+ L  
Sbjct: 190 PPSLGNLTMLLQIALYQNQLEGTIPEGLSGLRYLQYIQASRNSLSGTLPPLFFNMSSLQY 249

Query: 183 LDLSMNRITGSIPVRLG-KMRVLSTLKLDG--NSMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L  S N++ G +P   G ++  L  L+L G  N+ +G IP++L + T + +L L+RN FE
Sbjct: 250 LGFSSNKLHGRLPPDAGTRLPNLQVLRLGGIGNNFSGTIPASLSNATEIQVLGLARNSFE 309

Query: 354 GTIPDVFGS-----------------------KSYF------MVLDLSFNKLTGRVPNSL 446
           G IP   G                          YF       V+DLS N L G +P+ +
Sbjct: 310 GRIPPEIGKLCPVSVQMGSNKLQANDAGDWEFLRYFTNCTRLQVIDLSDNTLGGILPSFI 369

Query: 447 AK-AKFMGHLDISNNHLCGNIPIG 515
           A  ++ +  L ++ N + G IP G
Sbjct: 370 ANLSRSIQWLSMAKNQISGIIPPG 393

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 50/166 (30%), Positives = 81/166 (48%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  ++ L  LDL NN + G++     +L +L    L+ N   G +P  +   + L  L +
Sbjct: 98  IGNLTFLQSLDLFNNTLSGDVYFT-SQLHRLHYLELAYNDFSGDLPVGLCNCSNLVFLSV 156

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
             N + G+IP  LG +  L  L L  N++TG +P +L + T +  + L +N  EGTIP+ 
Sbjct: 157 EANELHGAIPSCLGSLLQLKVLYLGENNLTGTVPPSLGNLTMLLQIALYQNQLEGTIPEG 216

Query: 372 FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                Y   +  S N L+G +P        + +L  S+N L G +P
Sbjct: 217 LSGLRYLQYIQASRNSLSGTLPPLFFNMSSLQYLGFSSNKLHGRLP 262

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 41/123 (33%), Positives = 63/123 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++   + L++L L +N   G +P   G LR LS   L+RN L G+IP  +  ++ L  
Sbjct: 536 PTTLGDCASLVYLALDSNHFTGSIPPSLGNLRGLSILNLTRNALSGSIPQQLSNIHGLQQ 595

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L+ N ++G+IP  L K   L  L L  N ++G++PS  L     G   L   G  G I
Sbjct: 596 LYLAHNNLSGTIPQFLEKSSALIELDLSYNHLSGEVPSHGLFANMSGFSVLGNYGLCGGI 655

Query: 363 PDV 371
            ++
Sbjct: 656 AEL 658

[140][TOP]
>UniRef100_A7QXG2 Chromosome undetermined scaffold_222, whole genome shotgun sequence
           (Fragment) n=1 Tax=Vitis vinifera RepID=A7QXG2_VITVI
          Length = 529

 Score =  124 bits (310), Expect = 7e-27
 Identities = 70/195 (35%), Positives = 108/195 (55%), Gaps = 5/195 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQ--IIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRL 176
           P  I ++S L+ LD+S+N     G +P++  +L  L    +S+N L+G IP+ + +M  L
Sbjct: 320 PSQICQLSSLIVLDVSDNDNNFSGSIPTELSQLFGLRFLNVSKNHLMGRIPEKIGRMTSL 379

Query: 177 ADLDLSMNRITGSIPVRL---GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNG 347
             LDLS N ++G IP +L   G ++ +  + L  N+ +G IP+ L    G+  LN+S+N 
Sbjct: 380 LSLDLSTNHLSGEIPQKLEYKGILKYVRMVDLSSNNFSGSIPTELSQLFGLRFLNVSKNH 439

Query: 348 FEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFD 527
             G IP   G  +  + LDLS N L+G +P SLA   F+  L++S N   G IP+ +   
Sbjct: 440 LMGRIPKKIGRMTSLLSLDLSTNHLSGEIPQSLADLTFLNRLNLSCNQFWGRIPLSTQLQ 499

Query: 528 HLDAASFSNNDCLCG 572
             DA S+  N  LCG
Sbjct: 500 SFDAFSYIGNAQLCG 514

 Score =  102 bits (254), Expect = 2e-20
 Identities = 66/183 (36%), Positives = 91/183 (49%), Gaps = 21/183 (11%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           + L+ LDL +N + G +P    +LR L+   LSRNQL G IP+ + ++  L  L L  N 
Sbjct: 114 TSLLKLDLRDNSLKGHIPITILELRYLNILYLSRNQLTGQIPEYLGQLKHLEALSLRYNS 173

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-------LSNTGMG------------- 323
             G IP  LG +  L +L L GN + G +PS+L       LSN  +              
Sbjct: 174 FDGPIPSSLGNLSSLRSLYLYGNRLNGTLPSSLSKLEALDLSNNDLSGELPLCWKSWQSL 233

Query: 324 -ILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCG 500
             +NL  N F G IPD   S      L L  N L+G +P+SL +   +G LD+S N L G
Sbjct: 234 THVNLGNNNFSGKIPDSISSLFSLKALHLQNNGLSGSIPSSLRECTSLGLLDLSGNKLLG 293

Query: 501 NIP 509
           N+P
Sbjct: 294 NVP 296

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 59/165 (35%), Positives = 85/165 (51%), Gaps = 2/165 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  LDLSNN + GELP  +   + L+   L  N   G IPDS+  +  L  L L  N
Sbjct: 206 LSKLEALDLSNNDLSGELPLCWKSWQSLTHVNLGNNNFSGKIPDSISSLFSLKALHLQNN 265

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
            ++GSIP  L +   L  L L GN + G +P+ +   + + +L L  N F   IP     
Sbjct: 266 GLSGSIPSSLRECTSLGLLDLSGNKLLGNVPNWIGELSALKVLCLRSNKFIAEIPSQICQ 325

Query: 381 KSYFMVLDLS--FNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            S  +VLD+S   N  +G +P  L++   +  L++S NHL G IP
Sbjct: 326 LSSLIVLDVSDNDNNFSGSIPTELSQLFGLRFLNVSKNHLMGRIP 370

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 56/174 (32%), Positives = 93/174 (53%), Gaps = 5/174 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +  L  L L NN + G +PS   +   L    LS N+L+G +P+ + +++ L  
Sbjct: 248 PDSISSLFSLKALHLQNNGLSGSIPSSLRECTSLGLLDLSGNKLLGNVPNWIGELSALKV 307

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKL--DGNSMTGQIPSTLLSNTGMGILNLSRNGFEG 356
           L L  N+    IP ++ ++  L  L +  + N+ +G IP+ L    G+  LN+S+N   G
Sbjct: 308 LCLRSNKFIAEIPSQICQLSSLIVLDVSDNDNNFSGSIPTELSQLFGLRFLNVSKNHLMG 367

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSL---AKAKFMGHLDISNNHLCGNIP 509
            IP+  G  +  + LDLS N L+G +P  L      K++  +D+S+N+  G+IP
Sbjct: 368 RIPEKIGRMTSLLSLDLSTNHLSGEIPQKLEYKGILKYVRMVDLSSNNFSGSIP 421

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 55/169 (32%), Positives = 86/169 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + ++  L  L L  N   G +PS  G L  L    L  N+L GT+P S   +++L  
Sbjct: 155 PEYLGQLKHLEALSLRYNSFDGPIPSSLGNLSSLRSLYLYGNRLNGTLPSS---LSKLEA 211

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N ++G +P+     + L+ + L  N+ +G+IP ++ S   +  L+L  NG  G+I
Sbjct: 212 LDLSNNDLSGELPLCWKSWQSLTHVNLGNNNFSGKIPDSISSLFSLKALHLQNNGLSGSI 271

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P      +   +LDLS NKL G VPN + +   +  L + +N     IP
Sbjct: 272 PSSLRECTSLGLLDLSGNKLLGNVPNWIGELSALKVLCLRSNKFIAEIP 320

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 56/166 (33%), Positives = 85/166 (51%), Gaps = 2/166 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPS-DFGKLRKLSRALLSRNQLIGTIPDSVLKMNR-LADLDLS 194
           +S L  L L + ++    PS ++     L+   L  N     IP+ +  +   L  LDL 
Sbjct: 63  LSSLSMLLLEDCELDNMSPSLEYVNFTSLTVLSLYGNHFSHEIPNWLSNLTTSLLKLDLR 122

Query: 195 MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVF 374
            N + G IP+ + ++R L+ L L  N +TGQIP  L     +  L+L  N F+G IP   
Sbjct: 123 DNSLKGHIPITILELRYLNILYLSRNQLTGQIPEYLGQLKHLEALSLRYNSFDGPIPSSL 182

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           G+ S    L L  N+L G +P+SL+K +    LD+SNN L G +P+
Sbjct: 183 GNLSSLRSLYLYGNRLNGTLPSSLSKLEA---LDLSNNDLSGELPL 225

[141][TOP]
>UniRef100_A5BLM9 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BLM9_VITVI
          Length = 661

 Score =  124 bits (310), Expect = 7e-27
 Identities = 70/187 (37%), Positives = 107/187 (57%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++ L HLDLS+NQ+ G + +  G L +L+    S N+L G IP S+ ++ +L  
Sbjct: 256 PHQIGSLTKLTHLDLSSNQLTGPILNQIGTLIELTYLEFSGNELTGVIPSSLGRLTKLTH 315

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N++ GSIP ++G +  L+ L + GN +TG +PS+L   T +  L+L +N   G+I
Sbjct: 316 LGLFYNQLNGSIPHQIGTLTELTYLHISGNELTGAMPSSLGCLTKLISLDLCKNQINGSI 375

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P   G+    + LDLS N ++G +P+SL   K +G LD+S N L GN+P           
Sbjct: 376 PPEIGNIKSLVTLDLSDNLISGEIPSSLKNLKKLGRLDLSYNRLSGNLP----------- 424

Query: 543 SFSNNDC 563
           SF  N+C
Sbjct: 425 SFITNNC 431

 Score =  110 bits (275), Expect = 8e-23
 Identities = 67/169 (39%), Positives = 95/169 (56%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++ L HLDLS NQ+ G +P   G L +L+   LS N L   IP S+ ++ +L  
Sbjct: 136 PHQIGSLTKLTHLDLSFNQLTGPIPHQIGTLTELTYLNLSSNVLTDVIPSSLGRLTKLTH 195

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N++TG IP ++G +  L+ L L  N +T  IPS+L   T +  L+L  N   G+I
Sbjct: 196 LDLSFNQLTGPIPHQIGTLTELTYLPLSSNVLTDVIPSSLGRLTKLTHLDLYCNKLIGSI 255

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   GS +    LDLS N+LTG + N +     + +L+ S N L G IP
Sbjct: 256 PHQIGSLTKLTHLDLSSNQLTGPILNQIGTLIELTYLEFSGNELTGVIP 304

 Score =  106 bits (265), Expect = 1e-21
 Identities = 63/169 (37%), Positives = 97/169 (57%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++ L +L LS+N +   +PS  G+L KL+   L  N+LIG+IP  +  + +L  
Sbjct: 208 PHQIGTLTELTYLPLSSNVLTDVIPSSLGRLTKLTHLDLYCNKLIGSIPHQIGSLTKLTH 267

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N++TG I  ++G +  L+ L+  GN +TG IPS+L   T +  L L  N   G+I
Sbjct: 268 LDLSSNQLTGPILNQIGTLIELTYLEFSGNELTGVIPSSLGRLTKLTHLGLFYNQLNGSI 327

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+ +    L +S N+LTG +P+SL     +  LD+  N + G+IP
Sbjct: 328 PHQIGTLTELTYLHISGNELTGAMPSSLGCLTKLISLDLCKNQINGSIP 376

 Score =  102 bits (255), Expect = 2e-20
 Identities = 69/184 (37%), Positives = 98/184 (53%), Gaps = 4/184 (2%)
 Frame = +3

Query: 6   MSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           +++  +  L  L LS   + G +    G L KL+   LS NQL   IP  +  + +L  L
Sbjct: 89  LNLSLLPSLNFLILSRMGLNGSISDQIGSLTKLTILDLSHNQLTDPIPHQIGSLTKLTHL 148

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           DLS N++TG IP ++G +  L+ L L  N +T  IPS+L   T +  L+LS N   G IP
Sbjct: 149 DLSFNQLTGPIPHQIGTLTELTYLNLSSNVLTDVIPSSLGRLTKLTHLDLSFNQLTGPIP 208

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS--PFDHL 533
              G+ +    L LS N LT  +P+SL +   + HLD+  N L G+IP  IGS     HL
Sbjct: 209 HQIGTLTELTYLPLSSNVLTDVIPSSLGRLTKLTHLDLYCNKLIGSIPHQIGSLTKLTHL 268

Query: 534 DAAS 545
           D +S
Sbjct: 269 DLSS 272

 Score =  102 bits (255), Expect = 2e-20
 Identities = 68/182 (37%), Positives = 95/182 (52%), Gaps = 2/182 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           ++ L  LDLS+NQ+   +P   G L KL+   LS NQL G IP  +  +  L  L+LS N
Sbjct: 118 LTKLTILDLSHNQLTDPIPHQIGSLTKLTHLDLSFNQLTGPIPHQIGTLTELTYLNLSSN 177

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
            +T  IP  LG++  L+ L L  N +TG IP  + + T +  L LS N     IP   G 
Sbjct: 178 VLTDVIPSSLGRLTKLTHLDLSFNQLTGPIPHQIGTLTELTYLPLSSNVLTDVIPSSLGR 237

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI--PIGSPFDHLDAASFSN 554
            +    LDL  NKL G +P+ +     + HLD+S+N L G I   IG+  + L    FS 
Sbjct: 238 LTKLTHLDLYCNKLIGSIPHQIGSLTKLTHLDLSSNQLTGPILNQIGTLIE-LTYLEFSG 296

Query: 555 ND 560
           N+
Sbjct: 297 NE 298

 Score = 91.7 bits (226), Expect = 4e-17
 Identities = 51/138 (36%), Positives = 79/138 (57%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+ R++ L HL L  NQ+ G +P   G L +L+   +S N+L G +P S+  + +L  
Sbjct: 304 PSSLGRLTKLTHLGLFYNQLNGSIPHQIGTLTELTYLHISGNELTGAMPSSLGCLTKLIS 363

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL  N+I GSIP  +G ++ L TL L  N ++G+IPS+L +   +G L+LS N   G +
Sbjct: 364 LDLCKNQINGSIPPEIGNIKSLVTLDLSDNLISGEIPSSLKNLKKLGRLDLSYNRLSGNL 423

Query: 363 PDVFGSKSYFMVLDLSFN 416
           P    +      ++LS N
Sbjct: 424 PSFITNNCKQTTINLSQN 441

[142][TOP]
>UniRef100_A5BAC2 Putative uncharacterized protein n=1 Tax=Vitis vinifera
            RepID=A5BAC2_VITVI
          Length = 1049

 Score =  124 bits (310), Expect = 7e-27
 Identities = 68/190 (35%), Positives = 98/190 (51%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  +  L  L L NN++ G +P   G L +L    LS N L  +IP  +  +  L  
Sbjct: 542  PEELCGLRDLGELSLYNNKLSGSIPHCIGNLXRLQXLFLSSNSLTSSIPTGLWSLGNLLF 601

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N + GS+P  +G + V+  + L  N + G IP  L +   +  LNLSRN F+  I
Sbjct: 602  LNLSFNSLGGSLPSDMGTLTVIEDIDLSWNKLXGXIPGILGTFESLYSLNLSRNSFQEAI 661

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P+  G       +DLS N L+G +P S      + +L++S N+L G IP G PF +  A 
Sbjct: 662  PEXLGKLRALEFMDLSQNNLSGTIPKSFEXLSHLKYLNLSFNNLSGEIPNGGPFVNFTAQ 721

Query: 543  SFSNNDCLCG 572
            SF  N  LCG
Sbjct: 722  SFLENKALCG 731

 Score = 94.4 bits (233), Expect = 6e-18
 Identities = 63/179 (35%), Positives = 95/179 (53%), Gaps = 10/179 (5%)
 Frame = +3

Query: 3   PMSIVRIS-GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPD--------S 155
           P+ I + S  +  L  + NQ+ G+LPS   + R+L  A LS N+  G IP+        S
Sbjct: 236 PVDICQHSPNIEELLFTXNQLSGQLPSGIHRCRELLXASLSYNRFDGQIPEEIGRPIPSS 295

Query: 156 VLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNL 335
           +  ++ L  L L  N+I GSIP  LG +  LS L L+ N +TG IP  + + + + IL++
Sbjct: 296 IGNISSLQILXLEDNKIQGSIPSTLGNLLNLSYLVLEXNELTGAIPQEIFNXSSLQILSV 355

Query: 336 SRNGFEGTIPDVFG-SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +N   G +P   G      MVL L+ N L+G++P SL+    +  +DI NN   G IP
Sbjct: 356 VKNNLSGNLPSTTGLGLPNLMVLFLAGNXLSGKIPPSLSNYSQLTKIDIGNNLFTGPIP 414

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 57/166 (34%), Positives = 91/166 (54%), Gaps = 1/166 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S ++ LDLSNN   G LP + G L +L   +L  NQL G IP S+    RL  + L  N
Sbjct: 98  LSFIVLLDLSNNSFGGHLPYELGHLYRLRILILQNNQLEGKIPPSISHCRRLEFISLXSN 157

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
            ++G IP  LG +  L +L L GN++ G IPS+L + + + +L L   G  G+IP +  +
Sbjct: 158 WLSGGIPEELGILPKLDSLLLGGNNLRGTIPSSLGNISTLELLXLXEXGLTGSIPSLIFN 217

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIPIG 515
            S  + + L+ N ++G +P  + + +  +  L  + N L G +P G
Sbjct: 218 ISSLLSIILTGNSISGSLPVDICQHSPNIEELLFTXNQLSGQLPSG 263

 Score = 84.3 bits (207), Expect = 6e-15
 Identities = 54/168 (32%), Positives = 82/168 (48%), Gaps = 1/168 (0%)
 Frame = +3

Query: 57  QIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGK 236
           Q+ G +PS  G L+ L    L  N L G IP ++  +  L  +++  N + G IP  L  
Sbjct: 488 QLKGHIPSGIGSLKNLGTLELGBNNLNGNIPSTIGXLENLQRMNIFBNELEGPIPEELCG 547

Query: 237 MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFN 416
           +R L  L L  N ++G IP  + +   +  L LS N    +IP    S    + L+LSFN
Sbjct: 548 LRDLGELSLYNNKLSGSIPHCIGNLXRLQXLFLSSNSLTSSIPTGLWSLGNLLFLNLSFN 607

Query: 417 KLTGRVPNSLAKAKFMGHLDISNNHLCGNIP-IGSPFDHLDAASFSNN 557
            L G +P+ +     +  +D+S N L G IP I   F+ L + + S N
Sbjct: 608 SLGGSLPSDMGTLTVIEDIDLSWNKLXGXIPGILGTFESLYSLNLSRN 655

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 52/176 (29%), Positives = 86/176 (48%), Gaps = 3/176 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +  L  L L NNQ+ G++P      R+L    L  N L G IP+ +  + +L  
Sbjct: 116 PYELGHLYRLRILILQNNQLEGKIPPSISHCRRLEFISLXSNWLSGGIPEELGILPKLDS 175

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N + G+IP  LG +  L  L L    +TG IPS + + + +  + L+ N   G++
Sbjct: 176 LLLGGNNLRGTIPSSLGNISTLELLXLXEXGLTGSIPSLIFNISSLLSIILTGNSISGSL 235

Query: 363 P-DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSP 521
           P D+         L  + N+L+G++P+ + + + +    +S N   G IP  IG P
Sbjct: 236 PVDICQHSPNIEELLFTXNQLSGQLPSGIHRCRELLXASLSYNRFDGQIPEEIGRP 291

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 49/177 (27%), Positives = 77/177 (43%), Gaps = 8/177 (4%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIG-------TIPDSVL 161
           P S+   S L  +D+ NN   G +P   G L+ L    L  NQL         +   ++ 
Sbjct: 390 PPSLSNYSQLTKIDIGNNLFTGPIPPSLGNLKFLZTLSLGENQLKVEPGRPELSFITALT 449

Query: 162 KMNRLADLDLSMNRITGSIPVRLGKM-RVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLS 338
               L ++ +  N + G IP  +G +   +  +   G  + G IPS + S   +G L L 
Sbjct: 450 NCRLLEEITMQNNPLGGIIPNSIGNLSNHVRNIVAFGCQLKGHIPSGIGSLKNLGTLELG 509

Query: 339 RNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            N   G IP   G       +++  N+L G +P  L   + +G L + NN L G+IP
Sbjct: 510 BNNLNGNIPSTIGXLENLQRMNIFBNELEGPIPEELCGLRDLGELSLYNNKLSGSIP 566

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 39/138 (28%), Positives = 64/138 (46%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           ++++   L +  L GT+   +  ++ +  LDLS N   G +P  LG +  L  L L  N 
Sbjct: 75  QRVTALRLQKRGLKGTLSPYLGNLSFIVLLDLSNNSFGGHLPYELGHLYRLRILILQNNQ 134

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA 455
           + G+IP ++     +  ++L  N   G IP+  G       L L  N L G +P+SL   
Sbjct: 135 LEGKIPPSISHCRRLEFISLXSNWLSGGIPEELGILPKLDSLLLGGNNLRGTIPSSLGNI 194

Query: 456 KFMGHLDISNNHLCGNIP 509
             +  L +    L G+IP
Sbjct: 195 STLELLXLXEXGLTGSIP 212

[143][TOP]
>UniRef100_A3C3F1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=A3C3F1_ORYSJ
          Length = 1059

 Score =  124 bits (310), Expect = 7e-27
 Identities = 65/190 (34%), Positives = 102/190 (53%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P +   +  ++ L L NN+  G +  D G L KL    LS NQL  T+P S+  ++ L +
Sbjct: 504  PSNTAMLKNVVMLFLQNNEFSGSIIEDIGNLTKLEHLRLSNNQLSSTVPPSLFHLDSLIE 563

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            LDLS N  +G++PV +G ++ +  + L  N   G +P ++     +  LNLS N F  +I
Sbjct: 564  LDLSRNLFSGALPVDIGHLKQIYKMDLSSNHFLGSLPDSIGQIQMITYLNLSINSFNDSI 623

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P+ FG+ +    LDLS N ++G +P  L+    +  L++S N+L G IP G  F ++   
Sbjct: 624  PNSFGNLTSLQTLDLSHNNISGTIPKYLSSFTMLASLNLSFNNLHGQIPGGGVFSNITLQ 683

Query: 543  SFSNNDCLCG 572
            S   N  LCG
Sbjct: 684  SLVGNSGLCG 693

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 59/172 (34%), Positives = 88/172 (51%), Gaps = 1/172 (0%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  +S L  L+LSN  ++G +P D G+L +L    L  N ++G +P ++  + RL  LDL
Sbjct: 97  IGNLSFLSVLNLSNTGLMGSVPDDIGRLHRLKILDLGHNDMLGGVPATIGNLTRLDVLDL 156

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT-GMGILNLSRNGFEGTIPD 368
             N ++G IPV L     L ++ +  N +TG IP+ L +NT  +  L +  N   G IP 
Sbjct: 157 EFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNGLFNNTPSLKHLIIGNNSLSGPIPS 216

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPF 524
             GS      L L  N LTG VP S+     +  + +++N L G IP    F
Sbjct: 217 CIGSLPLLERLVLQCNNLTGPVPPSIFNMSRLHVIALASNGLTGPIPGNKSF 268

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 57/172 (33%), Positives = 93/172 (54%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLI-GTIPDSVLKMNRLA 179
           P+ +     L    L +N I G LPS  GKL KL+   L  N L+ G I D++  +  L 
Sbjct: 288 PLGLAACRHLKVFSLLDNLIEGPLPSWLGKLTKLNVISLGENLLVVGPIRDALSNLTMLN 347

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            LDL+M  +TG+IP  LG++  LS L+L  N +TG IP++L + + + +L L  N  +G 
Sbjct: 348 FLDLAMCNLTGAIPADLGQIGHLSVLRLSTNQLTGPIPASLGNLSALSVLLLDDNHLDGL 407

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+ +    L +S N L G +   ++++  + +  L I++N   G +P
Sbjct: 408 LPTTIGNMNSLTELIISENGLQGDLNFLSAVSNCRKLSVLCINSNRFTGILP 459

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 48/158 (30%), Positives = 82/158 (51%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           ++L +  + GEL    G L  LS   LS   L+G++PD + +++RL  LDL  N + G +
Sbjct: 82  VELPDVPLQGELSPHIGNLSFLSVLNLSNTGLMGSVPDDIGRLHRLKILDLGHNDMLGGV 141

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD-VFGSKSYFM 395
           P  +G +  L  L L+ NS++G IP  L  +  +  +N+  N   G IP+ +F +     
Sbjct: 142 PATIGNLTRLDVLDLEFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNGLFNNTPSLK 201

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L +  N L+G +P+ +     +  L +  N+L G +P
Sbjct: 202 HLIIGNNSLSGPIPSCIGSLPLLERLVLQCNNLTGPVP 239

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 57/186 (30%), Positives = 81/186 (43%), Gaps = 26/186 (13%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI- 206
           L HL + NN + G +PS  G L  L R +L  N L G +P S+  M+RL  + L+ N + 
Sbjct: 200 LKHLIIGNNSLSGPIPSCIGSLPLLERLVLQCNNLTGPVPPSIFNMSRLHVIALASNGLT 259

Query: 207 ------------------------TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT 314
                                   TG IP+ L   R L    L  N + G +PS L   T
Sbjct: 260 GPIPGNKSFILPILQFFSLDYNYFTGQIPLGLAACRHLKVFSLLDNLIEGPLPSWLGKLT 319

Query: 315 GMGILNLSRNGF-EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
            + +++L  N    G I D   + +    LDL+   LTG +P  L +   +  L +S N 
Sbjct: 320 KLNVISLGENLLVVGPIRDALSNLTMLNFLDLAMCNLTGAIPADLGQIGHLSVLRLSTNQ 379

Query: 492 LCGNIP 509
           L G IP
Sbjct: 380 LTGPIP 385

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 64/217 (29%), Positives = 90/217 (41%), Gaps = 47/217 (21%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  + +I  L  L LS NQ+ G +P+  G L  LS  LL  N L G +P ++  MN L +
Sbjct: 361  PADLGQIGHLSVLRLSTNQLTGPIPASLGNLSALSVLLLDDNHLDGLLPTTIGNMNSLTE 420

Query: 183  LDLS--------------------------MNRITGSIPVRLG----------------- 233
            L +S                           NR TG +P  LG                 
Sbjct: 421  LIISENGLQGDLNFLSAVSNCRKLSVLCINSNRFTGILPDYLGNLSSTLESFLASRIKLS 480

Query: 234  ----KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVL 401
                +M  L  L L GN++ G IPS       + +L L  N F G+I +  G+ +    L
Sbjct: 481  ESIMEMENLHMLDLSGNNLAGSIPSNTAMLKNVVMLFLQNNEFSGSIIEDIGNLTKLEHL 540

Query: 402  DLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
             LS N+L+  VP SL     +  LD+S N   G +P+
Sbjct: 541  RLSNNQLSSTVPPSLFHLDSLIELDLSRNLFSGALPV 577

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 48/174 (27%), Positives = 87/174 (50%), Gaps = 5/174 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMN-RLA 179
           P +I  ++ L  LDL  N + G +P +      L    +  N L G IP+ +      L 
Sbjct: 142 PATIGNLTRLDVLDLEFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNGLFNNTPSLK 201

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L +  N ++G IP  +G + +L  L L  N++TG +P ++ + + + ++ L+ NG  G 
Sbjct: 202 HLIIGNNSLSGPIPSCIGSLPLLERLVLQCNNLTGPVPPSIFNMSRLHVIALASNGLTGP 261

Query: 360 IPDVFGSKSYFMVL----DLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G+KS+ + +     L +N  TG++P  LA  + +    + +N + G +P
Sbjct: 262 IP---GNKSFILPILQFFSLDYNYFTGQIPLGLAACRHLKVFSLLDNLIEGPLP 312

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 34/115 (29%), Positives = 56/115 (48%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  ++L    + G +   +G +  LS L L    + G +P  +     + IL+L  N  
Sbjct: 78  RVTAVELPDVPLQGELSPHIGNLSFLSVLNLSNTGLMGSVPDDIGRLHRLKILDLGHNDM 137

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
            G +P   G+ +   VLDL FN L+G +P  L  +  +  ++I  N+L G IP G
Sbjct: 138 LGGVPATIGNLTRLDVLDLEFNSLSGPIPVELRLSHNLRSINIQMNYLTGLIPNG 192

[144][TOP]
>UniRef100_UPI00019845AE PREDICTED: hypothetical protein isoform 1 n=1 Tax=Vitis vinifera
           RepID=UPI00019845AE
          Length = 869

 Score =  123 bits (309), Expect = 9e-27
 Identities = 67/181 (37%), Positives = 98/181 (54%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L L +N   G +P+  GKL +L +  LS NQ+ G IPD + +++RL  +D S N I 
Sbjct: 279 LQSLALDHNFFSGSMPTSLGKLSELQKVSLSHNQITGAIPDEIGRLSRLKTVDFSSNAIN 338

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           GS+P+ L  +  L  L L+ N +  QIP        + +LNL RN F G IP   G+ S 
Sbjct: 339 GSLPISLSNLSSLLVLNLENNGLDSQIPDAFEKLQNLSVLNLRRNRFNGPIPGSIGNASA 398

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLC 569
              LDLS N LTG +P+S+A    +   ++S N+L G++P        +++ F  N  LC
Sbjct: 399 LTQLDLSQNNLTGDIPSSIADLPNLNSFNVSYNNLSGSVP-ALLSQKFNSSCFVGNLQLC 457

Query: 570 G 572
           G
Sbjct: 458 G 458

 Score =  112 bits (280), Expect = 2e-23
 Identities = 60/175 (34%), Positives = 97/175 (55%), Gaps = 6/175 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG------KLRKLSRALLSRNQLIGTIPDSVLK 164
           P+S+ R S L  L L +N + G +P+ +G       L +L    L  N   G++P S+ K
Sbjct: 240 PVSLTRSSSLTFLALQHNNLSGPIPNSWGVGTQGKSLFRLQSLALDHNFFSGSMPTSLGK 299

Query: 165 MNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRN 344
           ++ L  + LS N+ITG+IP  +G++  L T+    N++ G +P +L + + + +LNL  N
Sbjct: 300 LSELQKVSLSHNQITGAIPDEIGRLSRLKTVDFSSNAINGSLPISLSNLSSLLVLNLENN 359

Query: 345 GFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G +  IPD F       VL+L  N+  G +P S+  A  +  LD+S N+L G+IP
Sbjct: 360 GLDSQIPDAFEKLQNLSVLNLRRNRFNGPIPGSIGNASALTQLDLSQNNLTGDIP 414

 Score = 96.3 bits (238), Expect = 2e-18
 Identities = 61/192 (31%), Positives = 96/192 (50%), Gaps = 7/192 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++  +  L  + L NN+  G +P   G    L    LS N L GTIPDS+    +   
Sbjct: 168 PSALGFLPNLRGVQLFNNRFSGSIPPSIGSCPLLQTVDLSNNSLSGTIPDSLFNSTKFYR 227

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGI-----LNLSRN 344
           L+LS N  +GSIPV L +   L+ L L  N+++G IP++  +   G  +     L L  N
Sbjct: 228 LNLSFNSFSGSIPVSLTRSSSLTFLALQHNNLSGPIPNSWGVGTQGKSLFRLQSLALDHN 287

Query: 345 GFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SP 521
            F G++P   G  S    + LS N++TG +P+ + +   +  +D S+N + G++PI  S 
Sbjct: 288 FFSGSMPTSLGKLSELQKVSLSHNQITGAIPDEIGRLSRLKTVDFSSNAINGSLPISLSN 347

Query: 522 FDHLDAASFSNN 557
              L   +  NN
Sbjct: 348 LSSLLVLNLENN 359

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 64/190 (33%), Positives = 91/190 (47%), Gaps = 8/190 (4%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I ++  L  L L +N I G +PS  G L  L    L  N+  G+IP S+     L  +DL
Sbjct: 147 IGQLQALRKLSLHDNFIGGSIPSALGFLPNLRGVQLFNNRFSGSIPPSIGSCPLLQTVDL 206

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
           S N ++G+IP  L        L L  NS +G IP +L  ++ +  L L  N   G IP+ 
Sbjct: 207 SNNSLSGTIPDSLFNSTKFYRLNLSFNSFSGSIPVSLTRSSSLTFLALQHNNLSGPIPNS 266

Query: 372 FG----SKSYFMV--LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFD 527
           +G     KS F +  L L  N  +G +P SL K   +  + +S+N + G IP  IG    
Sbjct: 267 WGVGTQGKSLFRLQSLALDHNFFSGSMPTSLGKLSELQKVSLSHNQITGAIPDEIGR-LS 325

Query: 528 HLDAASFSNN 557
            L    FS+N
Sbjct: 326 RLKTVDFSSN 335

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 56/171 (32%), Positives = 85/171 (49%), Gaps = 7/171 (4%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRV 245
           G +    G+L+ L +  L  N + G+IP ++  +  L  + L  NR +GSIP  +G   +
Sbjct: 141 GRISEKIGQLQALRKLSLHDNFIGGSIPSALGFLPNLRGVQLFNNRFSGSIPPSIGSCPL 200

Query: 246 LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLT 425
           L T+ L  NS++G IP +L ++T    LNLS N F G+IP      S    L L  N L+
Sbjct: 201 LQTVDLSNNSLSGTIPDSLFNSTKFYRLNLSFNSFSGSIPVSLTRSSSLTFLALQHNNLS 260

Query: 426 GRVPNS-----LAKAKF-MGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
           G +PNS       K+ F +  L + +N   G++P        L   S S+N
Sbjct: 261 GPIPNSWGVGTQGKSLFRLQSLALDHNFFSGSMPTSLGKLSELQKVSLSHN 311

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 36/110 (32%), Positives = 56/110 (50%)
 Frame = +3

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           + L    + G I  ++G+++ L  L L  N + G IPS L     +  + L  N F G+I
Sbjct: 132 IQLPWKGLGGRISEKIGQLQALRKLSLHDNFIGGSIPSALGFLPNLRGVQLFNNRFSGSI 191

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           P   GS      +DLS N L+G +P+SL  +     L++S N   G+IP+
Sbjct: 192 PPSIGSCPLLQTVDLSNNSLSGTIPDSLFNSTKFYRLNLSFNSFSGSIPV 241

[145][TOP]
>UniRef100_UPI000198418F PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
            RepID=UPI000198418F
          Length = 1179

 Score =  123 bits (309), Expect = 9e-27
 Identities = 73/192 (38%), Positives = 104/192 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  +  L +L LS N++ G +PS FG L  L    L  N L   IP S   +  L  
Sbjct: 641  PNDLCHLKNLGYLRLSYNKLSGSIPSCFGDLPALRELSLDSNVLAFNIPMSFWSLRDLLV 700

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N +TG++P  +G M+ ++TL L  N ++G IPS +     +  L+LS+N  +G I
Sbjct: 701  LNLSSNFLTGNLPPEVGNMKSITTLDLSKNLVSGYIPSRMGKLQNLITLSLSQNKLQGPI 760

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  FG       LDLS N L+G +P +L    ++ +L++S N L G IP G PF    A 
Sbjct: 761  PVEFGDLVSLESLDLSQNNLSGTIPKTLEALIYLKYLNVSFNKLQGEIPNGGPFVKFTAE 820

Query: 543  SFSNNDCLCGNP 578
            SF  N+ LCG P
Sbjct: 821  SFMFNEALCGAP 832

 Score =  106 bits (264), Expect = 1e-21
 Identities = 66/170 (38%), Positives = 90/170 (52%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  IS L+++ LSNN + G LP D      KL    LS N L G IP  + +  +L 
Sbjct: 164 PATIFNISSLLNISLSNNNLSGSLPMDMCYANPKLKELNLSSNHLSGKIPTGLGQCIQLQ 223

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            + L+ N  TGSIP  +G +  L  L L  NS+TG+IPS L     +  L+LS N F G 
Sbjct: 224 VISLAYNDFTGSIPNGIGNLVELQRLSLRNNSLTGEIPSNLSHCRELRGLSLSINQFTGG 283

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   GS S    L L++NKLTG +P  +     +  L + +N + G IP
Sbjct: 284 IPQAIGSLSNLEELYLNYNKLTGGIPREIGNLSNLNILQLGSNGISGPIP 333

 Score =  104 bits (259), Expect = 6e-21
 Identities = 58/170 (34%), Positives = 84/170 (49%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I +   L  L+L NN+++G +P     L KL    L  NQLIG IP  +  +  L  
Sbjct: 92  PKDIGKCKELQQLNLFNNKLVGGIPEAICNLSKLEELYLGNNQLIGEIPKKMNHLQNLKV 151

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGT 359
           L   MN +TGSIP  +  +  L  + L  N+++G +P  +  +N  +  LNLS N   G 
Sbjct: 152 LSFPMNNLTGSIPATIFNISSLLNISLSNNNLSGSLPMDMCYANPKLKELNLSSNHLSGK 211

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G      V+ L++N  TG +PN +     +  L + NN L G IP
Sbjct: 212 IPTGLGQCIQLQVISLAYNDFTGSIPNGIGNLVELQRLSLRNNSLTGEIP 261

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 59/168 (35%), Positives = 83/168 (49%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9    SIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADL 185
            S+     L +L +  N + G LP+  G L   L   + S  Q  GTIP  +  +  L  L
Sbjct: 546  SLTNCKFLRNLWIGYNPLTGTLPNSLGNLPIALEIFIASACQFRGTIPTGIGNLTNLIWL 605

Query: 186  DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
            DL  N +TGSIP  LG+++ L  L + GN + G IP+ L     +G L LS N   G+IP
Sbjct: 606  DLGANDLTGSIPTTLGQLQKLQALSIVGNRIRGSIPNDLCHLKNLGYLRLSYNKLSGSIP 665

Query: 366  DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              FG       L L  N L   +P S    + +  L++S+N L GN+P
Sbjct: 666  SCFGDLPALRELSLDSNVLAFNIPMSFWSLRDLLVLNLSSNFLTGNLP 713

 Score = 91.7 bits (226), Expect = 4e-17
 Identities = 59/194 (30%), Positives = 90/194 (46%), Gaps = 25/194 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L  L L NN + GE+PS+    R+L    LS NQ  G IP ++  ++ L +
Sbjct: 237 PNGIGNLVELQRLSLRNNSLTGEIPSNLSHCRELRGLSLSINQFTGGIPQAIGSLSNLEE 296

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS----------------TLLSNT 314
           L L+ N++TG IP  +G +  L+ L+L  N ++G IP+                +L  + 
Sbjct: 297 LYLNYNKLTGGIPREIGNLSNLNILQLGSNGISGPIPAEIFTVSSLQRIIFANNSLSGSL 356

Query: 315 GMGI---------LNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
            M I         L LS+N   G +P         + L L  NK TG +P  +     + 
Sbjct: 357 PMDICKHLPNLQGLYLSQNHLSGQLPTTLSLCRELLSLALPMNKFTGSIPREIGNLSKLE 416

Query: 468 HLDISNNHLCGNIP 509
            +D+S N L G+IP
Sbjct: 417 EIDLSENSLIGSIP 430

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 55/170 (32%), Positives = 83/170 (48%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + +   L  + L+ N   G +P+  G L +L R  L  N L G IP ++     L  
Sbjct: 213 PTGLGQCIQLQVISLAYNDFTGSIPNGIGNLVELQRLSLRNNSLTGEIPSNLSHCRELRG 272

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS+N+ TG IP  +G +  L  L L+ N +TG IP  + + + + IL L  NG  G I
Sbjct: 273 LSLSINQFTGGIPQAIGSLSNLEELYLNYNKLTGGIPREIGNLSNLNILQLGSNGISGPI 332

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIP 509
           P    + S    +  + N L+G +P  + K    +  L +S NHL G +P
Sbjct: 333 PAEIFTVSSLQRIIFANNSLSGSLPMDICKHLPNLQGLYLSQNHLSGQLP 382

 Score = 85.1 bits (209), Expect = 4e-15
 Identities = 60/181 (33%), Positives = 86/181 (47%), Gaps = 17/181 (9%)
 Frame = +3

Query: 3   PMSIVR-ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           PM I + +  L  L LS N + G+LP+     R+L    L  N+  G+IP  +  +++L 
Sbjct: 357 PMDICKHLPNLQGLYLSQNHLSGQLPTTLSLCRELLSLALPMNKFTGSIPREIGNLSKLE 416

Query: 180 DLDLSMNRITGSIPVRLGKMRV----------LSTLKLDGNSMTGQIPSTL------LSN 311
           ++DLS N + GSIP   G +            L TL L  N ++G +PS++      L  
Sbjct: 417 EIDLSENSLIGSIPTSFGNLMTLKFLSFNISKLQTLGLVQNHLSGSLPSSIGTWLPDLEG 476

Query: 312 TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
             +GI     N F GTIP    + S   VL LS N  TG VP  L     +  LD++ N 
Sbjct: 477 LYIGI-----NEFSGTIPMSISNMSKLTVLSLSDNSFTGNVPKDLCNLTKLQFLDLAYNQ 531

Query: 492 L 494
           L
Sbjct: 532 L 532

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 54/151 (35%), Positives = 77/151 (50%)
 Frame = +3

Query: 57   QIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGK 236
            Q  G +P+  G L  L    L  N L G+IP ++ ++ +L  L +  NRI GSIP  L  
Sbjct: 587  QFRGTIPTGIGNLTNLIWLDLGANDLTGSIPTTLGQLQKLQALSIVGNRIRGSIPNDLCH 646

Query: 237  MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFN 416
            ++ L  L+L  N ++G IPS       +  L+L  N     IP  F S    +VL+LS N
Sbjct: 647  LKNLGYLRLSYNKLSGSIPSCFGDLPALRELSLDSNVLAFNIPMSFWSLRDLLVLNLSSN 706

Query: 417  KLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             LTG +P  +   K +  LD+S N + G IP
Sbjct: 707  FLTGNLPPEVGNMKSITTLDLSKNLVSGYIP 737

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 48/160 (30%), Positives = 77/160 (48%), Gaps = 1/160 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           ++LSN  + G +    G L  L    LS N    ++P  + K   L  L+L  N++ G I
Sbjct: 56  INLSNMGLEGTIAPQVGNLSFLVSLDLSNNYFHDSVPKDIGKCKELQQLNLFNNKLVGGI 115

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  +  +  L  L L  N + G+IP  +     + +L+   N   G+IP    + S  + 
Sbjct: 116 PEAICNLSKLEELYLGNNQLIGEIPKKMNHLQNLKVLSFPMNNLTGSIPATIFNISSLLN 175

Query: 399 LDLSFNKLTGRVPNSLAKAK-FMGHLDISNNHLCGNIPIG 515
           + LS N L+G +P  +  A   +  L++S+NHL G IP G
Sbjct: 176 ISLSNNNLSGSLPMDMCYANPKLKELNLSSNHLSGKIPTG 215

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 54/178 (30%), Positives = 84/178 (47%), Gaps = 8/178 (4%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGE-LPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
            P  +  ++ L  LDL+ NQ+  E L S  G L  L+     RN  IG  P +    N L 
Sbjct: 513  PKDLCNLTKLQFLDLAYNQLTDEHLASGVGFLTSLTNCKFLRNLWIGYNPLTGTLPNSLG 572

Query: 180  DLDLSMN-------RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLS 338
            +L +++        +  G+IP  +G +  L  L L  N +TG IP+TL     +  L++ 
Sbjct: 573  NLPIALEIFIASACQFRGTIPTGIGNLTNLIWLDLGANDLTGSIPTTLGQLQKLQALSIV 632

Query: 339  RNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
             N   G+IP+          L LS+NKL+G +P+       +  L + +N L  NIP+
Sbjct: 633  GNRIRGSIPNDLCHLKNLGYLRLSYNKLSGSIPSCFGDLPALRELSLDSNVLAFNIPM 690

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 59/196 (30%), Positives = 85/196 (43%), Gaps = 33/196 (16%)
 Frame = +3

Query: 21   ISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
            IS L  L L  N + G LPS  G  L  L    +  N+  GTIP S+  M++L  L LS 
Sbjct: 446  ISKLQTLGLVQNHLSGSLPSSIGTWLPDLEGLYIGINEFSGTIPMSISNMSKLTVLSLSD 505

Query: 198  NRITGSIP-------------------------------VRLGKMRVLSTLKLDGNSMTG 284
            N  TG++P                                 L   + L  L +  N +TG
Sbjct: 506  NSFTGNVPKDLCNLTKLQFLDLAYNQLTDEHLASGVGFLTSLTNCKFLRNLWIGYNPLTG 565

Query: 285  QIPSTLLS-NTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF 461
             +P++L +    + I   S   F GTIP   G+ +  + LDL  N LTG +P +L + + 
Sbjct: 566  TLPNSLGNLPIALEIFIASACQFRGTIPTGIGNLTNLIWLDLGANDLTGSIPTTLGQLQK 625

Query: 462  MGHLDISNNHLCGNIP 509
            +  L I  N + G+IP
Sbjct: 626  LQALSIVGNRIRGSIP 641

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 44/139 (31%), Positives = 68/139 (48%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           +++S   LS   L GTI   V  ++ L  LDLS N    S+P  +GK + L  L L  N 
Sbjct: 51  QRVSAINLSNMGLEGTIAPQVGNLSFLVSLDLSNNYFHDSVPKDIGKCKELQQLNLFNNK 110

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA 455
           + G IP  + + + +  L L  N   G IP          VL    N LTG +P ++   
Sbjct: 111 LVGGIPEAICNLSKLEELYLGNNQLIGEIPKKMNHLQNLKVLSFPMNNLTGSIPATIFNI 170

Query: 456 KFMGHLDISNNHLCGNIPI 512
             + ++ +SNN+L G++P+
Sbjct: 171 SSLLNISLSNNNLSGSLPM 189

[146][TOP]
>UniRef100_B9I7R5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I7R5_POPTR
          Length = 1012

 Score =  123 bits (309), Expect = 9e-27
 Identities = 79/201 (39%), Positives = 103/201 (51%), Gaps = 11/201 (5%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  + ++  L  LDL NN I G +PS  G L +L    LS+N L G IP  + +   +  
Sbjct: 414  PDEMGQMENLGLLDLGNNSITGSIPSSLGNLSQLRYLDLSQNSLSGNIPIKLSQCTLMMQ 473

Query: 183  LDLSMNRITGSIP------VRLGKMRVLSTLKLDG-----NSMTGQIPSTLLSNTGMGIL 329
            LDLS N + G +P      V L      S   LDG     N  +G I S++ S   +  L
Sbjct: 474  LDLSFNNLQGPLPPEITLLVNLNLFLNFSNNNLDGEIPAMNKFSGMISSSIGSCASLEYL 533

Query: 330  NLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            NLS+N  EGTIP+     +Y  VLDLSFN LTGRVP  LA A  M + + S N L G +P
Sbjct: 534  NLSKNMIEGTIPESLKQITYLKVLDLSFNHLTGRVPIWLANASVMQNFNFSYNRLTGEVP 593

Query: 510  IGSPFDHLDAASFSNNDCLCG 572
                F +L+ +S   N  LCG
Sbjct: 594  STGRFKNLNGSSLIGNAGLCG 614

 Score =  113 bits (283), Expect = 9e-24
 Identities = 77/206 (37%), Positives = 104/206 (50%), Gaps = 36/206 (17%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI  +SGL+ L L +N++ G +P+ FGKL+ L R  L RN+L G+IPD + +M  L  
Sbjct: 366 PDSIGNLSGLVTLHLWDNRLDGTIPATFGKLKLLQRLYLGRNKLQGSIPDEMGQMENLGL 425

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIP----------------------- 293
           LDL  N ITGSIP  LG +  L  L L  NS++G IP                       
Sbjct: 426 LDLGNNSITGSIPSSLGNLSQLRYLDLSQNSLSGNIPIKLSQCTLMMQLDLSFNNLQGPL 485

Query: 294 ---STLLSNTGMGILNLSRNGFEGTIPDV----------FGSKSYFMVLDLSFNKLTGRV 434
               TLL N  +  LN S N  +G IP +           GS +    L+LS N + G +
Sbjct: 486 PPEITLLVNLNL-FLNFSNNNLDGEIPAMNKFSGMISSSIGSCASLEYLNLSKNMIEGTI 544

Query: 435 PNSLAKAKFMGHLDISNNHLCGNIPI 512
           P SL +  ++  LD+S NHL G +PI
Sbjct: 545 PESLKQITYLKVLDLSFNHLTGRVPI 570

 Score =  107 bits (268), Expect = 5e-22
 Identities = 71/186 (38%), Positives = 101/186 (54%), Gaps = 2/186 (1%)
 Frame = +3

Query: 3   PMSIVRIS-GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P SI  +S  L + +L NN+I GE+P   G L  L    L  N+L GTIP +  K+  L 
Sbjct: 341 PASIGNLSKDLYYFNLLNNRIRGEIPDSIGNLSGLVTLHLWDNRLDGTIPATFGKLKLLQ 400

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L L  N++ GSIP  +G+M  L  L L  NS+TG IPS+L + + +  L+LS+N   G 
Sbjct: 401 RLYLGRNKLQGSIPDEMGQMENLGLLDLGNNSITGSIPSSLGNLSQLRYLDLSQNSLSGN 460

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG-HLDISNNHLCGNIPIGSPFDHLD 536
           IP      +  M LDLSFN L G +P  +     +   L+ SNN+L G IP  + F  + 
Sbjct: 461 IPIKLSQCTLMMQLDLSFNNLQGPLPPEITLLVNLNLFLNFSNNNLDGEIPAMNKFSGMI 520

Query: 537 AASFSN 554
           ++S  +
Sbjct: 521 SSSIGS 526

 Score = 97.1 bits (240), Expect = 9e-19
 Identities = 60/182 (32%), Positives = 96/182 (52%), Gaps = 2/182 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  L L +N   GE+P+  G L +L    +S N+L G  P S+     L  LDL+ N
Sbjct: 78  LSLLTKLSLQSNSFHGEIPTTLGVLSQLEYLNMSENKLTGAFPASLHGCQSLKFLDLTTN 137

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
            ++G IP  LG M+ L+ L +  N+++G IP+ L + T +  L L+ N F G IP   G+
Sbjct: 138 SLSGVIPEELGWMKNLTFLAISQNNLSGVIPAFLSNLTELTRLELAVNYFTGKIPWELGA 197

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAASFSN 554
            +   +L L  N L G +P+SL+    +  + +  N + G +P  +G+   +L    F N
Sbjct: 198 LTRLEILYLHLNFLEGAIPSSLSNCTALREISLIENRISGELPAEMGNKLQNLQKLYFIN 257

Query: 555 ND 560
           N+
Sbjct: 258 NN 259

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 55/170 (32%), Positives = 88/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+     L  LDL+ N + G +P + G ++ L+   +S+N L G IP  +  +  L  
Sbjct: 120 PASLHGCQSLKFLDLTTNSLSGVIPEELGWMKNLTFLAISQNNLSGVIPAFLSNLTELTR 179

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L++N  TG IP  LG +  L  L L  N + G IPS+L + T +  ++L  N   G +
Sbjct: 180 LELAVNYFTGKIPWELGALTRLEILYLHLNFLEGAIPSSLSNCTALREISLIENRISGEL 239

Query: 363 PDVFGSK-SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+K      L    N ++GR+P + +    +  LD+S N+L G +P
Sbjct: 240 PAEMGNKLQNLQKLYFINNNISGRIPVTFSNLSQITLLDLSINYLEGEVP 289

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 60/223 (26%), Positives = 98/223 (43%), Gaps = 54/223 (24%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P S+   + L  + L  N+I GELP++ G KL+ L +     N + G IP +   ++++ 
Sbjct: 216 PSSLSNCTALREISLIENRISGELPAEMGNKLQNLQKLYFINNNISGRIPVTFSNLSQIT 275

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMT-------------------------- 281
            LDLS+N + G +P  LGK++ L  L L  N++                           
Sbjct: 276 LLDLSINYLEGEVPEELGKLKNLEILYLHSNNLVSNSSLSFLTALTNCSFLQKLHLGSCL 335

Query: 282 ---------------------------GQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
                                      G+IP ++ + +G+  L+L  N  +GTIP  FG 
Sbjct: 336 FAGSLPASIGNLSKDLYYFNLLNNRIRGEIPDSIGNLSGLVTLHLWDNRLDGTIPATFGK 395

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                 L L  NKL G +P+ + + + +G LD+ NN + G+IP
Sbjct: 396 LKLLQRLYLGRNKLQGSIPDEMGQMENLGLLDLGNNSITGSIP 438

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 42/114 (36%), Positives = 59/114 (51%)
 Frame = +3

Query: 168 NRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNG 347
           NR+ DL+L+   + GSI   L  + +L+ L L  NS  G+IP+TL   + +  LN+S N 
Sbjct: 55  NRVIDLELTNMDLQGSISPFLSNLSLLTKLSLQSNSFHGEIPTTLGVLSQLEYLNMSENK 114

Query: 348 FEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             G  P           LDL+ N L+G +P  L   K +  L IS N+L G IP
Sbjct: 115 LTGAFPASLHGCQSLKFLDLTTNSLSGVIPEELGWMKNLTFLAISQNNLSGVIP 168

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 39/131 (29%), Positives = 62/131 (47%)
 Frame = +3

Query: 117 LSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS 296
           L+   L G+I   +  ++ L  L L  N   G IP  LG +  L  L +  N +TG  P+
Sbjct: 62  LTNMDLQGSISPFLSNLSLLTKLSLQSNSFHGEIPTTLGVLSQLEYLNMSENKLTGAFPA 121

Query: 297 TLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLD 476
           +L     +  L+L+ N   G IP+  G       L +S N L+G +P  L+    +  L+
Sbjct: 122 SLHGCQSLKFLDLTTNSLSGVIPEELGWMKNLTFLAISQNNLSGVIPAFLSNLTELTRLE 181

Query: 477 ISNNHLCGNIP 509
           ++ N+  G IP
Sbjct: 182 LAVNYFTGKIP 192

[147][TOP]
>UniRef100_A7Q4L0 Chromosome chr10 scaffold_50, whole genome shotgun sequence n=1
            Tax=Vitis vinifera RepID=A7Q4L0_VITVI
          Length = 1113

 Score =  123 bits (309), Expect = 9e-27
 Identities = 73/192 (38%), Positives = 104/192 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  +  L +L LS N++ G +PS FG L  L    L  N L   IP S   +  L  
Sbjct: 562  PNDLCHLKNLGYLRLSYNKLSGSIPSCFGDLPALRELSLDSNVLAFNIPMSFWSLRDLLV 621

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N +TG++P  +G M+ ++TL L  N ++G IPS +     +  L+LS+N  +G I
Sbjct: 622  LNLSSNFLTGNLPPEVGNMKSITTLDLSKNLVSGYIPSRMGKLQNLITLSLSQNKLQGPI 681

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  FG       LDLS N L+G +P +L    ++ +L++S N L G IP G PF    A 
Sbjct: 682  PVEFGDLVSLESLDLSQNNLSGTIPKTLEALIYLKYLNVSFNKLQGEIPNGGPFVKFTAE 741

Query: 543  SFSNNDCLCGNP 578
            SF  N+ LCG P
Sbjct: 742  SFMFNEALCGAP 753

 Score =  100 bits (249), Expect = 8e-20
 Identities = 58/180 (32%), Positives = 90/180 (50%), Gaps = 11/180 (6%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L  L L NN + GE+PS+    R+L    LS NQ  G IP ++  ++ L +
Sbjct: 205 PNGIGNLVELQRLSLRNNSLTGEIPSNLSHCRELRGLSLSINQFTGGIPQAIGSLSNLEE 264

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLL-----------SNTGMGIL 329
           L L+ N++TG IP  +G +  L+ L+L  N ++G IP+ +            +N+  G L
Sbjct: 265 LYLNYNKLTGGIPREIGNLSNLNILQLGSNGISGPIPAEIFTVSSLQRIIFANNSLSGRL 324

Query: 330 NLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            LS+N   G +P         + L L  NK TG +P  +     +  +D+S N L G+IP
Sbjct: 325 YLSQNHLSGQLPTTLSLCRELLSLALPMNKFTGSIPREIGNLSKLEEIDLSENSLIGSIP 384

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 55/161 (34%), Positives = 80/161 (49%), Gaps = 1/161 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L+L NN+++G +P     L KL    L  NQLIG IP  +  +  L  L   MN +T
Sbjct: 78  LQQLNLFNNKLVGGIPEAICNLSKLEELYLGNNQLIGEIPKKMNHLQNLKVLSFPMNNLT 137

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           GSIP  +  +  L  + L  N+++G +P  +  +N  +  LNLS N   G IP       
Sbjct: 138 GSIPATIFNISSLLNISLSNNNLSGSLPMDMCYANPKLKELNLSSNHLSGKIP------- 190

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              V+ L++N  TG +PN +     +  L + NN L G IP
Sbjct: 191 --TVISLAYNDFTGSIPNGIGNLVELQRLSLRNNSLTGEIP 229

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 65/209 (31%), Positives = 92/209 (44%), Gaps = 40/209 (19%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  +S L  L L NNQ+IGE+P     L+ L       N L G+IP ++  ++ L +
Sbjct: 93  PEAICNLSKLEELYLGNNQLIGEIPKKMNHLQNLKVLSFPMNNLTGSIPATIFNISSLLN 152

Query: 183 LDLSMNRI----------------------------------------TGSIPVRLGKMR 242
           + LS N +                                        TGSIP  +G + 
Sbjct: 153 ISLSNNNLSGSLPMDMCYANPKLKELNLSSNHLSGKIPTVISLAYNDFTGSIPNGIGNLV 212

Query: 243 VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKL 422
            L  L L  NS+TG+IPS L     +  L+LS N F G IP   GS S    L L++NKL
Sbjct: 213 ELQRLSLRNNSLTGEIPSNLSHCRELRGLSLSINQFTGGIPQAIGSLSNLEELYLNYNKL 272

Query: 423 TGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           TG +P  +     +  L + +N + G IP
Sbjct: 273 TGGIPREIGNLSNLNILQLGSNGISGPIP 301

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 59/168 (35%), Positives = 83/168 (49%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           S+     L +L +  N + G LP+  G L   L   + S  Q  GTIP  +  +  L  L
Sbjct: 467 SLTNCKFLRNLWIGYNPLTGTLPNSLGNLPIALEIFIASACQFRGTIPTGIGNLTNLIWL 526

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           DL  N +TGSIP  LG+++ L  L + GN + G IP+ L     +G L LS N   G+IP
Sbjct: 527 DLGANDLTGSIPTTLGQLQKLQALSIVGNRIRGSIPNDLCHLKNLGYLRLSYNKLSGSIP 586

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             FG       L L  N L   +P S    + +  L++S+N L GN+P
Sbjct: 587 SCFGDLPALRELSLDSNVLAFNIPMSFWSLRDLLVLNLSSNFLTGNLP 634

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 61/193 (31%), Positives = 92/193 (47%), Gaps = 13/193 (6%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           + L+ N   G +P+  G L +L R  L  N L G IP ++     L  L LS+N+ TG I
Sbjct: 193 ISLAYNDFTGSIPNGIGNLVELQRLSLRNNSLTGEIPSNLSHCRELRGLSLSINQFTGGI 252

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD---------- 368
           P  +G +  L  L L+ N +TG IP  + + + + IL L  NG  G IP           
Sbjct: 253 PQAIGSLSNLEELYLNYNKLTGGIPREIGNLSNLNILQLGSNGISGPIPAEIFTVSSLQR 312

Query: 369 -VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDA 539
            +F + S    L LS N L+G++P +L+  + +  L +  N   G+IP  IG+    L+ 
Sbjct: 313 IIFANNSLSGRLYLSQNHLSGQLPTTLSLCRELLSLALPMNKFTGSIPREIGN-LSKLEE 371

Query: 540 ASFSNNDCLCGNP 578
              S N  +   P
Sbjct: 372 IDLSENSLIGSIP 384

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 54/166 (32%), Positives = 86/166 (51%), Gaps = 9/166 (5%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L LS N + G+LP+     R+L    L  N+  G+IP  +  +++L ++DLS N + GSI
Sbjct: 324 LYLSQNHLSGQLPTTLSLCRELLSLALPMNKFTGSIPREIGNLSKLEEIDLSENSLIGSI 383

Query: 219 PVRLGKMRVLSTLKL--DGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYF 392
           P   G +  L  L+L    N  +G IP ++ + + + +L+LS N F G +P    + +  
Sbjct: 384 PTSFGNLMTLKFLRLYIGINEFSGTIPMSISNMSKLTVLSLSDNSFTGNVPKDLCNLTKL 443

Query: 393 MVLDLSFNKLTGR-------VPNSLAKAKFMGHLDISNNHLCGNIP 509
             LDL++N+LT            SL   KF+ +L I  N L G +P
Sbjct: 444 QFLDLAYNQLTDEHLASGVGFLTSLTNCKFLRNLWIGYNPLTGTLP 489

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 59/177 (33%), Positives = 83/177 (46%), Gaps = 13/177 (7%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRAL-----------LSRNQLIGTIP 149
           P  I  +S L  L L +N I G +P++   +  L R +           LS+N L G +P
Sbjct: 277 PREIGNLSNLNILQLGSNGISGPIPAEIFTVSSLQRIIFANNSLSGRLYLSQNHLSGQLP 336

Query: 150 DSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGIL 329
            ++     L  L L MN+ TGSIP  +G +  L  + L  NS+ G IP++  +   +  L
Sbjct: 337 TTLSLCRELLSLALPMNKFTGSIPREIGNLSKLEEIDLSENSLIGSIPTSFGNLMTLKFL 396

Query: 330 NL--SRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHL 494
            L    N F GTIP    + S   VL LS N  TG VP  L     +  LD++ N L
Sbjct: 397 RLYIGINEFSGTIPMSISNMSKLTVLSLSDNSFTGNVPKDLCNLTKLQFLDLAYNQL 453

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 54/151 (35%), Positives = 77/151 (50%)
 Frame = +3

Query: 57  QIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGK 236
           Q  G +P+  G L  L    L  N L G+IP ++ ++ +L  L +  NRI GSIP  L  
Sbjct: 508 QFRGTIPTGIGNLTNLIWLDLGANDLTGSIPTTLGQLQKLQALSIVGNRIRGSIPNDLCH 567

Query: 237 MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFN 416
           ++ L  L+L  N ++G IPS       +  L+L  N     IP  F S    +VL+LS N
Sbjct: 568 LKNLGYLRLSYNKLSGSIPSCFGDLPALRELSLDSNVLAFNIPMSFWSLRDLLVLNLSSN 627

Query: 417 KLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            LTG +P  +   K +  LD+S N + G IP
Sbjct: 628 FLTGNLPPEVGNMKSITTLDLSKNLVSGYIP 658

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 54/178 (30%), Positives = 84/178 (47%), Gaps = 8/178 (4%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGE-LPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  +  ++ L  LDL+ NQ+  E L S  G L  L+     RN  IG  P +    N L 
Sbjct: 434 PKDLCNLTKLQFLDLAYNQLTDEHLASGVGFLTSLTNCKFLRNLWIGYNPLTGTLPNSLG 493

Query: 180 DLDLSMN-------RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLS 338
           +L +++        +  G+IP  +G +  L  L L  N +TG IP+TL     +  L++ 
Sbjct: 494 NLPIALEIFIASACQFRGTIPTGIGNLTNLIWLDLGANDLTGSIPTTLGQLQKLQALSIV 553

Query: 339 RNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
            N   G+IP+          L LS+NKL+G +P+       +  L + +N L  NIP+
Sbjct: 554 GNRIRGSIPNDLCHLKNLGYLRLSYNKLSGSIPSCFGDLPALRELSLDSNVLAFNIPM 611

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 1/115 (0%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMR-VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNG 347
           R++ ++LS   + G+I  ++G +  +L  L L  N + G IP  + + + +  L L  N 
Sbjct: 52  RVSAINLSNMGLEGTIAPQVGNLSFLLQQLNLFNNKLVGGIPEAICNLSKLEELYLGNNQ 111

Query: 348 FEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
             G IP          VL    N LTG +P ++     + ++ +SNN+L G++P+
Sbjct: 112 LIGEIPKKMNHLQNLKVLSFPMNNLTGSIPATIFNISSLLNISLSNNNLSGSLPM 166

[148][TOP]
>UniRef100_A7Q4K8 Chromosome chr10 scaffold_50, whole genome shotgun sequence n=1
            Tax=Vitis vinifera RepID=A7Q4K8_VITVI
          Length = 1099

 Score =  123 bits (309), Expect = 9e-27
 Identities = 73/192 (38%), Positives = 103/192 (53%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  +  +  L +L LS+N++ G +PS FG L  L    L  N L   IP S   +  L  
Sbjct: 548  PNDLFHLKNLGYLHLSSNKLSGSIPSCFGDLPALRELSLDSNVLAFNIPMSFWSLRDLLV 607

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L LS N +TG++P  +G M+ ++TL L  N ++G IP  +     +  L LS+N  +G+I
Sbjct: 608  LSLSSNFLTGNLPPEVGNMKSITTLDLSKNLISGYIPRRMGELQNLVNLCLSQNKLQGSI 667

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  FG       +DLS N L G +P SL    ++ HL++S N L G IP G PF +  A 
Sbjct: 668  PVEFGDLLSLESMDLSQNNLFGTIPKSLEALIYLKHLNVSFNKLQGEIPNGGPFVNFTAE 727

Query: 543  SFSNNDCLCGNP 578
            SF  N+ LCG P
Sbjct: 728  SFIFNEALCGAP 739

 Score =  108 bits (269), Expect = 4e-22
 Identities = 60/181 (33%), Positives = 102/181 (56%), Gaps = 2/181 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L+ LDLSNN   G LP D GK ++L +  L  N+L+G+IP+++  +++L +L    N
Sbjct: 93  LSFLVSLDLSNNYFDGSLPKDIGKCKELQQLNLFNNKLVGSIPEAICNLSKLEELYFGNN 152

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFG 377
           ++ G IP ++  +  L  L    N++TG IP+T+ + + +  ++LS N   G++P D+  
Sbjct: 153 QLIGEIPKKMSNLLNLKVLSFPMNNLTGSIPTTIFNMSSLLNISLSYNSLSGSLPMDICY 212

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSN 554
           +      L+LS N L+G+VP  L +   +  + +S N   G+IP G      L + S  N
Sbjct: 213 TNLKLKELNLSSNHLSGKVPTGLGQCIKLQGISLSYNDFTGSIPSGIGNLVELQSLSLQN 272

Query: 555 N 557
           N
Sbjct: 273 N 273

 Score =  100 bits (249), Expect = 8e-20
 Identities = 57/170 (33%), Positives = 82/170 (48%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I +   L  L+L NN+++G +P     L KL       NQLIG IP  +  +  L  
Sbjct: 111 PKDIGKCKELQQLNLFNNKLVGSIPEAICNLSKLEELYFGNNQLIGEIPKKMSNLLNLKV 170

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGT 359
           L   MN +TGSIP  +  M  L  + L  NS++G +P  +  +N  +  LNLS N   G 
Sbjct: 171 LSFPMNNLTGSIPTTIFNMSSLLNISLSYNSLSGSLPMDICYTNLKLKELNLSSNHLSGK 230

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +P   G       + LS+N  TG +P+ +     +  L + NN L G IP
Sbjct: 231 VPTGLGQCIKLQGISLSYNDFTGSIPSGIGNLVELQSLSLQNNSLTGEIP 280

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 62/170 (36%), Positives = 86/170 (50%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  +S L+++ LS N + G LP D      KL    LS N L G +P  + +  +L 
Sbjct: 183 PTTIFNMSSLLNISLSYNSLSGSLPMDICYTNLKLKELNLSSNHLSGKVPTGLGQCIKLQ 242

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            + LS N  TGSIP  +G +  L +L L  NS+TG+IP +L +   +  LNL  N  EG 
Sbjct: 243 GISLSYNDFTGSIPSGIGNLVELQSLSLQNNSLTGEIPQSLFNIYSLRFLNLEINNLEGE 302

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           I   F       VL LS N+ TG +P +L     +  L +  N L G IP
Sbjct: 303 ISS-FSHCRELRVLKLSINQFTGGIPKALGSLSDLEELYLGYNKLTGGIP 351

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 62/193 (32%), Positives = 93/193 (48%), Gaps = 1/193 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +I  +S L  L   NNQ+IGE+P     L  L       N L G+IP ++  M+ L +
Sbjct: 135 PEAICNLSKLEELYFGNNQLIGEIPKKMSNLLNLKVLSFPMNNLTGSIPTTIFNMSSLLN 194

Query: 183 LDLSMNRITGSIPVRLGKMRV-LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           + LS N ++GS+P+ +    + L  L L  N ++G++P+ L     +  ++LS N F G+
Sbjct: 195 ISLSYNSLSGSLPMDICYTNLKLKELNLSSNHLSGKVPTGLGQCIKLQGISLSYNDFTGS 254

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
           IP   G+      L L  N LTG +P SL     +  L++  N+L G I   S    L  
Sbjct: 255 IPSGIGNLVELQSLSLQNNSLTGEIPQSLFNIYSLRFLNLEINNLEGEISSFSHCRELRV 314

Query: 540 ASFSNNDCLCGNP 578
              S N    G P
Sbjct: 315 LKLSINQFTGGIP 327

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 58/168 (34%), Positives = 80/168 (47%), Gaps = 1/168 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           S+     L  L +  N + G LP+  G L   L     S     GTIP  +  +  L  L
Sbjct: 453 SLTNCKFLRTLWIDYNPLKGTLPNSLGNLSVALESFTASACHFRGTIPTGIGNLTNLIWL 512

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           DL  N +TGSIP  LG+++ L  L + GN + G IP+ L     +G L+LS N   G+IP
Sbjct: 513 DLGANDLTGSIPTTLGQLQKLQRLYIAGNRIQGSIPNDLFHLKNLGYLHLSSNKLSGSIP 572

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             FG       L L  N L   +P S    + +  L +S+N L GN+P
Sbjct: 573 SCFGDLPALRELSLDSNVLAFNIPMSFWSLRDLLVLSLSSNFLTGNLP 620

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 53/148 (35%), Positives = 75/148 (50%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRV 245
           G +P+  G L  L    L  N L G+IP ++ ++ +L  L ++ NRI GSIP  L  ++ 
Sbjct: 497 GTIPTGIGNLTNLIWLDLGANDLTGSIPTTLGQLQKLQRLYIAGNRIQGSIPNDLFHLKN 556

Query: 246 LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLT 425
           L  L L  N ++G IPS       +  L+L  N     IP  F S    +VL LS N LT
Sbjct: 557 LGYLHLSSNKLSGSIPSCFGDLPALRELSLDSNVLAFNIPMSFWSLRDLLVLSLSSNFLT 616

Query: 426 GRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G +P  +   K +  LD+S N + G IP
Sbjct: 617 GNLPPEVGNMKSITTLDLSKNLISGYIP 644

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 51/177 (28%), Positives = 88/177 (49%), Gaps = 9/177 (5%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  I  L  L+L  N + GE+ S F   R+L    LS NQ  G IP ++  ++ L +
Sbjct: 280 PQSLFNIYSLRFLNLEINNLEGEI-SSFSHCRELRVLKLSINQFTGGIPKALGSLSDLEE 338

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEG-- 356
           L L  N++TG IP  +G +  L+ L L  + + G IP+ + + + +  ++ + N   G  
Sbjct: 339 LYLGYNKLTGGIPREIGILSNLNILHLASSGINGPIPAEIFNISSLHRIDFTNNSLSGGG 398

Query: 357 -------TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
                   +PD+ G       L +  N+ +G +P S++    +  L IS+N+  GN+
Sbjct: 399 LPSSISTWLPDLEG-------LFIGGNEFSGTIPVSISNMSKLIRLHISDNYFIGNV 448

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 55/174 (31%), Positives = 88/174 (50%), Gaps = 4/174 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELP--SDFGKLRKLSRALLSRNQLIGTIPDSVLKMN-R 173
           P+SI  +S L+ L +S+N  IG +   +     + L    +  N L GT+P+S+  ++  
Sbjct: 425 PVSISNMSKLIRLHISDNYFIGNVGFLTSLTNCKFLRTLWIDYNPLKGTLPNSLGNLSVA 484

Query: 174 LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L     S     G+IP  +G +  L  L L  N +TG IP+TL     +  L ++ N  +
Sbjct: 485 LESFTASACHFRGTIPTGIGNLTNLIWLDLGANDLTGSIPTTLGQLQKLQRLYIAGNRIQ 544

Query: 354 GTIP-DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           G+IP D+F  K+    L LS NKL+G +P+       +  L + +N L  NIP+
Sbjct: 545 GSIPNDLFHLKN-LGYLHLSSNKLSGSIPSCFGDLPALRELSLDSNVLAFNIPM 597

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 44/146 (30%), Positives = 70/146 (47%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           +++S   LS   L GTI   V  ++ L  LDLS N   GS+P  +GK + L  L L  N 
Sbjct: 70  QRVSAINLSNMGLEGTIAPQVGNLSFLVSLDLSNNYFDGSLPKDIGKCKELQQLNLFNNK 129

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA 455
           + G IP  + + + +  L    N   G IP    +     VL    N LTG +P ++   
Sbjct: 130 LVGSIPEAICNLSKLEELYFGNNQLIGEIPKKMSNLLNLKVLSFPMNNLTGSIPTTIFNM 189

Query: 456 KFMGHLDISNNHLCGNIPIGSPFDHL 533
             + ++ +S N L G++P+   + +L
Sbjct: 190 SSLLNISLSYNSLSGSLPMDICYTNL 215

[149][TOP]
>UniRef100_A7Q3Q3 Chromosome chr13 scaffold_48, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7Q3Q3_VITVI
          Length = 858

 Score =  123 bits (309), Expect = 9e-27
 Identities = 67/181 (37%), Positives = 98/181 (54%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L L +N   G +P+  GKL +L +  LS NQ+ G IPD + +++RL  +D S N I 
Sbjct: 274 LQSLALDHNFFSGSMPTSLGKLSELQKVSLSHNQITGAIPDEIGRLSRLKTVDFSSNAIN 333

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           GS+P+ L  +  L  L L+ N +  QIP        + +LNL RN F G IP   G+ S 
Sbjct: 334 GSLPISLSNLSSLLVLNLENNGLDSQIPDAFEKLQNLSVLNLRRNRFNGPIPGSIGNASA 393

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLC 569
              LDLS N LTG +P+S+A    +   ++S N+L G++P        +++ F  N  LC
Sbjct: 394 LTQLDLSQNNLTGDIPSSIADLPNLNSFNVSYNNLSGSVP-ALLSQKFNSSCFVGNLQLC 452

Query: 570 G 572
           G
Sbjct: 453 G 453

 Score =  116 bits (290), Expect = 1e-24
 Identities = 61/170 (35%), Positives = 98/170 (57%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P+S+ R S L  L L +N + G +P+ +GK L +L    L  N   G++P S+ K++ L 
Sbjct: 240 PVSLTRSSSLTFLALQHNNLSGPIPNSWGKSLFRLQSLALDHNFFSGSMPTSLGKLSELQ 299

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            + LS N+ITG+IP  +G++  L T+    N++ G +P +L + + + +LNL  NG +  
Sbjct: 300 KVSLSHNQITGAIPDEIGRLSRLKTVDFSSNAINGSLPISLSNLSSLLVLNLENNGLDSQ 359

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IPD F       VL+L  N+  G +P S+  A  +  LD+S N+L G+IP
Sbjct: 360 IPDAFEKLQNLSVLNLRRNRFNGPIPGSIGNASALTQLDLSQNNLTGDIP 409

 Score = 97.1 bits (240), Expect = 9e-19
 Identities = 61/187 (32%), Positives = 95/187 (50%), Gaps = 2/187 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++  +  L  + L NN+  G +P   G    L    LS N L GTIPDS+    +   
Sbjct: 168 PSALGFLPNLRGVQLFNNRFSGSIPPSIGSCPLLQTVDLSNNSLSGTIPDSLFNSTKFYR 227

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGT 359
           L+LS N  +GSIPV L +   L+ L L  N+++G IP++   S   +  L L  N F G+
Sbjct: 228 LNLSFNSFSGSIPVSLTRSSSLTFLALQHNNLSGPIPNSWGKSLFRLQSLALDHNFFSGS 287

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLD 536
           +P   G  S    + LS N++TG +P+ + +   +  +D S+N + G++PI  S    L 
Sbjct: 288 MPTSLGKLSELQKVSLSHNQITGAIPDEIGRLSRLKTVDFSSNAINGSLPISLSNLSSLL 347

Query: 537 AASFSNN 557
             +  NN
Sbjct: 348 VLNLENN 354

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 56/166 (33%), Positives = 85/166 (51%), Gaps = 2/166 (1%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRV 245
           G +    G+L+ L +  L  N + G+IP ++  +  L  + L  NR +GSIP  +G   +
Sbjct: 141 GRISEKIGQLQALRKLSLHDNFIGGSIPSALGFLPNLRGVQLFNNRFSGSIPPSIGSCPL 200

Query: 246 LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLT 425
           L T+ L  NS++G IP +L ++T    LNLS N F G+IP      S    L L  N L+
Sbjct: 201 LQTVDLSNNSLSGTIPDSLFNSTKFYRLNLSFNSFSGSIPVSLTRSSSLTFLALQHNNLS 260

Query: 426 GRVPNSLAKAKF-MGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
           G +PNS  K+ F +  L + +N   G++P        L   S S+N
Sbjct: 261 GPIPNSWGKSLFRLQSLALDHNFFSGSMPTSLGKLSELQKVSLSHN 306

 Score = 87.0 bits (214), Expect = 9e-16
 Identities = 64/186 (34%), Positives = 91/186 (48%), Gaps = 4/186 (2%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I ++  L  L L +N I G +PS  G L  L    L  N+  G+IP S+     L  +DL
Sbjct: 147 IGQLQALRKLSLHDNFIGGSIPSALGFLPNLRGVQLFNNRFSGSIPPSIGSCPLLQTVDL 206

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
           S N ++G+IP  L        L L  NS +G IP +L  ++ +  L L  N   G IP+ 
Sbjct: 207 SNNSLSGTIPDSLFNSTKFYRLNLSFNSFSGSIPVSLTRSSSLTFLALQHNNLSGPIPNS 266

Query: 372 FGSKSYFMV--LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDA 539
           +G KS F +  L L  N  +G +P SL K   +  + +S+N + G IP  IG     L  
Sbjct: 267 WG-KSLFRLQSLALDHNFFSGSMPTSLGKLSELQKVSLSHNQITGAIPDEIGR-LSRLKT 324

Query: 540 ASFSNN 557
             FS+N
Sbjct: 325 VDFSSN 330

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 36/110 (32%), Positives = 56/110 (50%)
 Frame = +3

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           + L    + G I  ++G+++ L  L L  N + G IPS L     +  + L  N F G+I
Sbjct: 132 IQLPWKGLGGRISEKIGQLQALRKLSLHDNFIGGSIPSALGFLPNLRGVQLFNNRFSGSI 191

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           P   GS      +DLS N L+G +P+SL  +     L++S N   G+IP+
Sbjct: 192 PPSIGSCPLLQTVDLSNNSLSGTIPDSLFNSTKFYRLNLSFNSFSGSIPV 241

[150][TOP]
>UniRef100_A5C6W6 Putative uncharacterized protein n=1 Tax=Vitis vinifera
            RepID=A5C6W6_VITVI
          Length = 913

 Score =  123 bits (309), Expect = 9e-27
 Identities = 82/208 (39%), Positives = 109/208 (52%), Gaps = 25/208 (12%)
 Frame = +3

Query: 30   LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
            L H+ L+NNQ IG +PS  G L+KL    LS N   GT+P ++   + L  L L+ N ++
Sbjct: 587  LEHVLLNNNQFIGMIPSWLGGLQKLGELDLSFNFFHGTVPAALGNCSILLKLSLNDNSLS 646

Query: 210  GSIPVRLGKMRVLSTLKLDGNSMTGQIPST-----------LLSNTGMG----------- 323
            G IP  +G +  L+ L L  N+++GQIPST           L  N   G           
Sbjct: 647  GEIPPEMGNLTSLNVLDLQRNNLSGQIPSTFQQCKKLYELRLSENMLTGSIPSELGTLTE 706

Query: 324  ---ILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHL 494
               IL+LSRN F G IP   G+      L++SFN+L G VP+SL K   +  LD+SNNHL
Sbjct: 707  LQVILDLSRNLFSGEIPSSLGNLMKLESLNISFNQLQGEVPSSLGKLTSLHLLDLSNNHL 766

Query: 495  CGNIPIGSPFDHLDAASFSNNDCLCGNP 578
             G +P  S F     +SF  ND LCG P
Sbjct: 767  RGQLP--STFSEFPLSSFMXNDKLCGPP 792

 Score =  108 bits (270), Expect = 3e-22
 Identities = 60/169 (35%), Positives = 94/169 (55%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ ++  S +  LDLS+N+  G LP +  KL  L+  LL+ N   G +P  +  M+ L  
Sbjct: 291 PLELLNCSSIQQLDLSDNRFEGVLPPELEKLENLTDLLLNNNSFSGKLPPEIGNMSSLET 350

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N ITG+IPV LGK++ LS++ L  N ++G IP  L + + +  ++   N F G+I
Sbjct: 351 LYLFDNMITGNIPVELGKLQKLSSIYLYDNQLSGSIPRELTNCSSLSEIDFFGNHFMGSI 410

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G     + L L  N L+G +P SL   K +  L +++N L G++P
Sbjct: 411 PATIGKLRNLVFLQLRQNDLSGPIPPSLGYCKKLHTLTLADNKLSGSLP 459

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 64/185 (34%), Positives = 93/185 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +S L  L L +N I G +P + GKL+KLS   L  NQL G+IP  +   + L++
Sbjct: 339 PPEIGNMSSLETLYLFDNMITGNIPVELGKLQKLSSIYLYDNQLSGSIPRELTNCSSLSE 398

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +D   N   GSIP  +GK+R L  L+L  N ++G IP +L     +  L L+ N   G++
Sbjct: 399 IDFFGNHFMGSIPATIGKLRNLVFLQLRQNDLSGPIPPSLGYCKKLHTLTLADNKLSGSL 458

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P  F   S   +  L  N   G +P SL   K +G ++ S+N   G+I      D L   
Sbjct: 459 PPTFRFLSELHLFSLYNNSFEGPLPESLFLLKKLGIINFSHNRFSGSILPLLGSDFLTLL 518

Query: 543 SFSNN 557
             +NN
Sbjct: 519 DLTNN 523

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 56/157 (35%), Positives = 79/157 (50%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           LDL+NN   G +PS     + L+R  L+ N L G I     ++  L  LDLS N  TG +
Sbjct: 518 LDLTNNSFSGPIPSRLAMSKNLTRLRLAHNLLTGNISSEFGQLKELKFLDLSFNNFTGEV 577

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
              L   + L  + L+ N   G IPS L     +G L+LS N F GT+P   G+ S  + 
Sbjct: 578 APELSNCKKLEHVLLNNNQFIGMIPSWLGGLQKLGELDLSFNFFHGTVPAALGNCSILLK 637

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           L L+ N L+G +P  +     +  LD+  N+L G IP
Sbjct: 638 LSLNDNSLSGEIPPEMGNLTSLNVLDLQRNNLSGQIP 674

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 60/169 (35%), Positives = 84/169 (49%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+     L  L L++N++ G LP  F  L +L    L  N   G +P+S+  + +L  
Sbjct: 435 PPSLGYCKKLHTLTLADNKLSGSLPPTFRFLSELHLFSLYNNSFEGPLPESLFLLKKLGI 494

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           ++ S NR +GSI   LG    L+ L L  NS +G IPS L  +  +  L L+ N   G I
Sbjct: 495 INFSHNRFSGSILPLLGS-DFLTLLDLTNNSFSGPIPSRLAMSKNLTRLRLAHNLLTGNI 553

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              FG       LDLSFN  TG V   L+  K + H+ ++NN   G IP
Sbjct: 554 SSEFGQLKELKFLDLSFNNFTGEVAPELSNCKKLEHVLLNNNQFIGMIP 602

 Score = 85.1 bits (209), Expect = 4e-15
 Identities = 51/165 (30%), Positives = 82/165 (49%), Gaps = 1/165 (0%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDF-GKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLS 194
           ++  L  L LS+N +   +P +F      L +  L++N+L GT P  +L  + +  LDLS
Sbjct: 247 QLKSLEVLALSDNLLTDSIPGNFCTSSSSLRQIFLAQNKLSGTFPLELLNCSSIQQLDLS 306

Query: 195 MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVF 374
            NR  G +P  L K+  L+ L L+ NS +G++P  + + + +  L L  N   G IP   
Sbjct: 307 DNRFEGVLPPELEKLENLTDLLLNNNSFSGKLPPEIGNMSSLETLYLFDNMITGNIPVEL 366

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G       + L  N+L+G +P  L     +  +D   NH  G+IP
Sbjct: 367 GKLQKLSSIYLYDNQLSGSIPRELTNCSSLSEIDFFGNHFMGSIP 411

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 48/162 (29%), Positives = 75/162 (46%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L  + L+ N++ G  P +      + +  LS N+  G +P  + K+  L DL L+ N 
Sbjct: 274 SSLRQIFLAQNKLSGTFPLELLNCSSIQQLDLSDNRFEGVLPPELEKLENLTDLLLNNNS 333

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
            +G +P  +G M  L TL L  N +TG IP  L     +  + L  N   G+IP    + 
Sbjct: 334 FSGKLPPEIGNMSSLETLYLFDNMITGNIPVELGKLQKLSSIYLYDNQLSGSIPRELTNC 393

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           S    +D   N   G +P ++ K + +  L +  N L G IP
Sbjct: 394 SSLSEIDFFGNHFMGSIPATIGKLRNLVFLQLRQNDLSGPIP 435

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 52/189 (27%), Positives = 87/189 (46%), Gaps = 4/189 (2%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           ++ L  LDLS N   G +P + G L+ L   LL  N L G IP  +  + +L  L +  N
Sbjct: 93  LTSLQTLDLSLNAFAGSIPHELGLLQNLRELLLYSNYLSGKIPTEICLLKKLQVLRIGDN 152

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
            + G I   +G ++ L  L L    + G IP+ + +   +  L+L +N     IP+    
Sbjct: 153 MLAGEITPSIGNLKELRVLGLAYCQLNGSIPAEIGNLKNLKFLDLQKNSLSSVIPE---- 208

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP-IGSPFDHLDAASFSNN 557
                        L+G +P+ L +   +  LD+S+N+L G I  + +    L+  + S+N
Sbjct: 209 ---------EIQGLSGMIPSELNQLDQLQKLDLSSNNLSGTINFLNTQLKSLEVLALSDN 259

Query: 558 ---DCLCGN 575
              D + GN
Sbjct: 260 LLTDSIPGN 268

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 53/182 (29%), Positives = 83/182 (45%), Gaps = 12/182 (6%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +  L  L L +N + G++P++   L+KL    +  N L G I  S+  +  L  
Sbjct: 111 PHELGLLQNLRELLLYSNYLSGKIPTEICLLKKLQVLRIGDNMLAGEITPSIGNLKELRV 170

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNS-----------MTGQIPSTLLSNTGMGIL 329
           L L+  ++ GSIP  +G ++ L  L L  NS           ++G IPS L     +  L
Sbjct: 171 LGLAYCQLNGSIPAEIGNLKNLKFLDLQKNSLSSVIPEEIQGLSGMIPSELNQLDQLQKL 230

Query: 330 NLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVP-NSLAKAKFMGHLDISNNHLCGNI 506
           +LS N   GTI  +        VL LS N LT  +P N    +  +  + ++ N L G  
Sbjct: 231 DLSSNNLSGTINFLNTQLKSLEVLALSDNLLTDSIPGNFCTSSSSLRQIFLAQNKLSGTF 290

Query: 507 PI 512
           P+
Sbjct: 291 PL 292

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 42/131 (32%), Positives = 64/131 (48%)
 Frame = +3

Query: 117 LSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS 296
           LS + L G+I      +  L  LDLS+N   GSIP  LG ++ L  L L  N ++G+IP+
Sbjct: 77  LSGSGLSGSISPEFSHLTSLQTLDLSLNAFAGSIPHELGLLQNLRELLLYSNYLSGKIPT 136

Query: 297 TLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLD 476
            +     + +L +  N   G I    G+     VL L++ +L G +P  +   K +  LD
Sbjct: 137 EICLLKKLQVLRIGDNMLAGEITPSIGNLKELRVLGLAYCQLNGSIPAEIGNLKNLKFLD 196

Query: 477 ISNNHLCGNIP 509
           +  N L   IP
Sbjct: 197 LQKNSLSSVIP 207

[151][TOP]
>UniRef100_Q9LQ11 F16P17.10 protein n=1 Tax=Arabidopsis thaliana RepID=Q9LQ11_ARATH
          Length = 890

 Score =  123 bits (308), Expect = 1e-26
 Identities = 75/192 (39%), Positives = 102/192 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I     L  LDL +N++ G +P   GK+ KLS   L  N + G +P  +  +  L  
Sbjct: 306 PSGITGCKSLKLLDLESNRLNGSVPVGMGKMEKLSVIRLGDNFIDGKLPLELGNLEYLQV 365

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L    + G IP  L   R+L  L + GN + G+IP  LL+ T + IL+L RN   G I
Sbjct: 366 LNLHNLNLVGEIPEDLSNCRLLLELDVSGNGLEGEIPKNLLNLTNLEILDLHRNRISGNI 425

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P   GS S    LDLS N L+G +P+SL   K + H ++S N+L G IP         A+
Sbjct: 426 PPNLGSLSRIQFLDLSENLLSGPIPSSLENLKRLTHFNVSYNNLSGIIP---KIQASGAS 482

Query: 543 SFSNNDCLCGNP 578
           SFSNN  LCG+P
Sbjct: 483 SFSNNPFLCGDP 494

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 59/195 (30%), Positives = 86/195 (44%), Gaps = 24/195 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKL-RKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  +  L  LDLS N   GE+P+   K   K     LS N L G+IP+S++  N L 
Sbjct: 138 PEFIGDLPNLRFLDLSKNAFFGEIPNSLFKFCYKTKFVSLSHNNLSGSIPESIVNCNNLI 197

Query: 180 DLDLSMNRITGSIP-----------------------VRLGKMRVLSTLKLDGNSMTGQI 290
             D S N ITG +P                         + K + LS + +  NS  G  
Sbjct: 198 GFDFSYNGITGLLPRICDIPVLEFVSVRRNLLSGDVFEEISKCKRLSHVDIGSNSFDGVA 257

Query: 291 PSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGH 470
              ++    +   N+S N F G I ++         LD S N+LTG VP+ +   K +  
Sbjct: 258 SFEVIGFKNLTYFNVSGNRFRGEIGEIVDCSESLEFLDASSNELTGNVPSGITGCKSLKL 317

Query: 471 LDISNNHLCGNIPIG 515
           LD+ +N L G++P+G
Sbjct: 318 LDLESNRLNGSVPVG 332

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 50/161 (31%), Positives = 81/161 (50%), Gaps = 1/161 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           ++ L  L L  N+I G LP D+ KL+ L +  +S N L G +P+ +  +  L  LDLS N
Sbjct: 96  LTSLRVLTLFGNRITGNLPLDYLKLQTLWKINVSSNALSGLVPEFIGDLPNLRFLDLSKN 155

Query: 201 RITGSIPVRLGKMRVLST-LKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
              G IP  L K    +  + L  N+++G IP ++++   +   + S NG  G +P +  
Sbjct: 156 AFFGEIPNSLFKFCYKTKFVSLSHNNLSGSIPESIVNCNNLIGFDFSYNGITGLLPRICD 215

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCG 500
                 V  +  N L+G V   ++K K + H+DI +N   G
Sbjct: 216 IPVLEFV-SVRRNLLSGDVFEEISKCKRLSHVDIGSNSFDG 255

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 48/171 (28%), Positives = 80/171 (46%), Gaps = 1/171 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SIV  + L+  D S N I G LP     +  L    + RN L G + + + K  RL+ 
Sbjct: 187 PESIVNCNNLIGFDFSYNGITGLLPR-ICDIPVLEFVSVRRNLLSGDVFEEISKCKRLSH 245

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +D+  N   G     +   + L+   + GN   G+I   +  +  +  L+ S N   G +
Sbjct: 246 VDIGSNSFDGVASFEVIGFKNLTYFNVSGNRFRGEIGEIVDCSESLEFLDASSNELTGNV 305

Query: 363 PD-VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           P  + G KS   +LDL  N+L G VP  + K + +  + + +N + G +P+
Sbjct: 306 PSGITGCKS-LKLLDLESNRLNGSVPVGMGKMEKLSVIRLGDNFIDGKLPL 355

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 39/137 (28%), Positives = 69/137 (50%), Gaps = 1/137 (0%)
 Frame = +3

Query: 102 LSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMT 281
           + + +L    L GT+  ++  +  L  L L  NRITG++P+   K++ L  + +  N+++
Sbjct: 75  VEKIVLWNTSLAGTLTPALSGLTSLRVLTLFGNRITGNLPLDYLKLQTLWKINVSSNALS 134

Query: 282 GQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY-FMVLDLSFNKLTGRVPNSLAKAK 458
           G +P  +     +  L+LS+N F G IP+      Y    + LS N L+G +P S+    
Sbjct: 135 GLVPEFIGDLPNLRFLDLSKNAFFGEIPNSLFKFCYKTKFVSLSHNNLSGSIPESIVNCN 194

Query: 459 FMGHLDISNNHLCGNIP 509
            +   D S N + G +P
Sbjct: 195 NLIGFDFSYNGITGLLP 211

[152][TOP]
>UniRef100_Q53PC8 Leucine Rich Repeat family protein, expressed n=2 Tax=Oryza sativa
            Japonica Group RepID=Q53PC8_ORYSJ
          Length = 1013

 Score =  123 bits (308), Expect = 1e-26
 Identities = 69/190 (36%), Positives = 102/190 (53%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P S+  IS L  L L +NQ+ G +PS  GKL  LS   +S N L G+IP+ + ++  +  
Sbjct: 432  PSSLANISMLEELFLESNQLYGYIPSSLGKLNVLSVLSMSNNSLHGSIPEEIFRIPTIRK 491

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            + LS N +   +   +G  + L+ L+L  N++TG IPSTL +   +  + L  N F G+I
Sbjct: 492  ISLSFNNLDAPLHDDIGNAKQLTYLQLSSNNITGYIPSTLGNCESLEDIELDHNVFSGSI 551

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P   G+     VL LS N LTG +P SL   + +  LD+S N+L G +P    F +  A 
Sbjct: 552  PTTLGNIKTLKVLKLSNNNLTGSIPASLGNLQLLEQLDLSFNNLKGEVPTKGIFKNATAM 611

Query: 543  SFSNNDCLCG 572
                N+ LCG
Sbjct: 612  RVDGNEGLCG 621

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 52/170 (30%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRIS-GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P S+  +S  L HL L  N++ G+ P     L  L+   L  N+  G +P+ +  +  L 
Sbjct: 359 PSSLGNLSVQLQHLLLGTNKLSGDFPFGIANLPGLTMLGLEDNKFTGIVPEWLGSLQNLQ 418

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            ++L+ N  TG IP  L  + +L  L L+ N + G IPS+L     + +L++S N   G+
Sbjct: 419 GIELANNFFTGLIPSSLANISMLEELFLESNQLYGYIPSSLGKLNVLSVLSMSNNSLHGS 478

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP+          + LSFN L   + + +  AK + +L +S+N++ G IP
Sbjct: 479 IPEEIFRIPTIRKISLSFNNLDAPLHDDIGNAKQLTYLQLSSNNITGYIP 528

 Score = 84.3 bits (207), Expect = 6e-15
 Identities = 58/167 (34%), Positives = 82/167 (49%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S+  ++ L  L L  N + GE+PS FG L +L    LS N L G IPD +   + L  + 
Sbjct: 93  SLGNLTFLKFLLLPTNSLTGEIPSSFGYLHRLQFLYLSNNTLQGMIPD-LTNCSNLKAIW 151

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           L  N + G IP  L     L  L+L  N++TG IPS L + T +  L    N  EG IP+
Sbjct: 152 LDSNDLVGQIPNILPPH--LQQLQLYNNNLTGTIPSYLANITSLKELIFVSNQIEGNIPN 209

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            F       VL    NKL G+ P ++     +  L ++ N+L G +P
Sbjct: 210 EFAKLPNLKVLYAGANKLEGKFPQAILNISTLTGLSLAYNNLSGELP 256

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 70/242 (28%), Positives = 104/242 (42%), Gaps = 57/242 (23%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSD-FGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I+ IS L  L L+ N + GELPS+ F  L  L    L+ N   G IP+S+   ++L 
Sbjct: 232 PQAILNISTLTGLSLAYNNLSGELPSNLFTYLPNLQDLGLAANLFQGHIPNSLANASKLY 291

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLD------------------------------G 269
            LD+++N  TG IP  +GK+  LS L L+                               
Sbjct: 292 MLDIALNYFTGIIPTSIGKLTELSWLNLEHHRLQARSKQDWEFMTSLANCSELNIFSMKD 351

Query: 270 NSMTGQIPSTL------------------------LSN-TGMGILNLSRNGFEGTIPDVF 374
           N + G +PS+L                        ++N  G+ +L L  N F G +P+  
Sbjct: 352 NLLEGHVPSSLGNLSVQLQHLLLGTNKLSGDFPFGIANLPGLTMLGLEDNKFTGIVPEWL 411

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFS 551
           GS      ++L+ N  TG +P+SLA    +  L + +N L G IP      + L   S S
Sbjct: 412 GSLQNLQGIELANNFFTGLIPSSLANISMLEELFLESNQLYGYIPSSLGKLNVLSVLSMS 471

Query: 552 NN 557
           NN
Sbjct: 472 NN 473

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 46/156 (29%), Positives = 79/156 (50%), Gaps = 1/156 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L L NN + G +PS    +  L   +   NQ+ G IP+   K+  L  L    N++ 
Sbjct: 169 LQQLQLYNNNLTGTIPSYLANITSLKELIFVSNQIEGNIPNEFAKLPNLKVLYAGANKLE 228

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN-TGMGILNLSRNGFEGTIPDVFGSKS 386
           G  P  +  +  L+ L L  N+++G++PS L +    +  L L+ N F+G IP+   + S
Sbjct: 229 GKFPQAILNISTLTGLSLAYNNLSGELPSNLFTYLPNLQDLGLAANLFQGHIPNSLANAS 288

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHL 494
              +LD++ N  TG +P S+ K   +  L++ ++ L
Sbjct: 289 KLYMLDIALNYFTGIIPTSIGKLTELSWLNLEHHRL 324

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 51/167 (30%), Positives = 82/167 (49%), Gaps = 1/167 (0%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           +   S L  + L +N ++G++P+       L +  L  N L GTIP  +  +  L +L  
Sbjct: 141 LTNCSNLKAIWLDSNDLVGQIPNILPP--HLQQLQLYNNNLTGTIPSYLANITSLKELIF 198

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-D 368
             N+I G+IP    K+  L  L    N + G+ P  +L+ + +  L+L+ N   G +P +
Sbjct: 199 VSNQIEGNIPNEFAKLPNLKVLYAGANKLEGKFPQAILNISTLTGLSLAYNNLSGELPSN 258

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +F        L L+ N   G +PNSLA A  +  LDI+ N+  G IP
Sbjct: 259 LFTYLPNLQDLGLAANLFQGHIPNSLANASKLYMLDIALNYFTGIIP 305

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 43/138 (31%), Positives = 66/138 (47%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           R+++   L+   L+G I  S+  +  L  L L  N +TG IP   G +  L  L L  N+
Sbjct: 74  RRVTSLNLTNRGLVGKISPSLGNLTFLKFLLLPTNSLTGEIPSSFGYLHRLQFLYLSNNT 133

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA 455
           + G IP  L + + +  + L  N   G IP++     +   L L  N LTG +P+ LA  
Sbjct: 134 LQGMIPD-LTNCSNLKAIWLDSNDLVGQIPNIL--PPHLQQLQLYNNNLTGTIPSYLANI 190

Query: 456 KFMGHLDISNNHLCGNIP 509
             +  L   +N + GNIP
Sbjct: 191 TSLKELIFVSNQIEGNIP 208

[153][TOP]
>UniRef100_Q0WVG0 Protein kinase like protein (Fragment) n=1 Tax=Arabidopsis thaliana
           RepID=Q0WVG0_ARATH
          Length = 853

 Score =  123 bits (308), Expect = 1e-26
 Identities = 75/192 (39%), Positives = 102/192 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I     L  LDL +N++ G +P   GK+ KLS   L  N + G +P  +  +  L  
Sbjct: 269 PSGITGCKSLKLLDLESNRLNGSVPVGMGKMEKLSVIRLGDNFIDGKLPLELGNLEYLQV 328

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L    + G IP  L   R+L  L + GN + G+IP  LL+ T + IL+L RN   G I
Sbjct: 329 LNLHNLNLVGEIPEDLSNCRLLLELDVSGNGLEGEIPKNLLNLTNLEILDLHRNRISGNI 388

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P   GS S    LDLS N L+G +P+SL   K + H ++S N+L G IP         A+
Sbjct: 389 PPNLGSLSRIQFLDLSENLLSGPIPSSLENLKRLTHFNVSYNNLSGIIP---KIQASGAS 445

Query: 543 SFSNNDCLCGNP 578
           SFSNN  LCG+P
Sbjct: 446 SFSNNPFLCGDP 457

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 59/195 (30%), Positives = 86/195 (44%), Gaps = 24/195 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKL-RKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  +  L  LDLS N   GE+P+   K   K     LS N L G+IP+S++  N L 
Sbjct: 101 PEFIGDLPNLRFLDLSKNAFFGEIPNSLFKFCYKTKFVSLSHNNLSGSIPESIVNCNNLI 160

Query: 180 DLDLSMNRITGSIP-----------------------VRLGKMRVLSTLKLDGNSMTGQI 290
             D S N ITG +P                         + K + LS + +  NS  G  
Sbjct: 161 GFDFSYNGITGLLPRICDIPVLEFVSVRRNLLSGDVFEEISKCKRLSHVDIGSNSFDGVA 220

Query: 291 PSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGH 470
              ++    +   N+S N F G I ++         LD S N+LTG VP+ +   K +  
Sbjct: 221 SFEVIGFKNLTYFNVSGNRFRGEIGEIVDCSESLEFLDGSSNELTGNVPSGITGCKSLKL 280

Query: 471 LDISNNHLCGNIPIG 515
           LD+ +N L G++P+G
Sbjct: 281 LDLESNRLNGSVPVG 295

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 50/161 (31%), Positives = 81/161 (50%), Gaps = 1/161 (0%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           ++ L  L L  N+I G LP D+ KL+ L +  +S N L G +P+ +  +  L  LDLS N
Sbjct: 59  LTSLRVLTLFGNRITGNLPLDYLKLQTLWKINVSSNALSGLVPEFIGDLPNLRFLDLSKN 118

Query: 201 RITGSIPVRLGKMRVLST-LKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
              G IP  L K    +  + L  N+++G IP ++++   +   + S NG  G +P +  
Sbjct: 119 AFFGEIPNSLFKFCYKTKFVSLSHNNLSGSIPESIVNCNNLIGFDFSYNGITGLLPRICD 178

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCG 500
                 V  +  N L+G V   ++K K + H+DI +N   G
Sbjct: 179 IPVLEFV-SVRRNLLSGDVFEEISKCKRLSHVDIGSNSFDG 218

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 48/171 (28%), Positives = 80/171 (46%), Gaps = 1/171 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SIV  + L+  D S N I G LP     +  L    + RN L G + + + K  RL+ 
Sbjct: 150 PESIVNCNNLIGFDFSYNGITGLLPR-ICDIPVLEFVSVRRNLLSGDVFEEISKCKRLSH 208

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +D+  N   G     +   + L+   + GN   G+I   +  +  +  L+ S N   G +
Sbjct: 209 VDIGSNSFDGVASFEVIGFKNLTYFNVSGNRFRGEIGEIVDCSESLEFLDGSSNELTGNV 268

Query: 363 PD-VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           P  + G KS   +LDL  N+L G VP  + K + +  + + +N + G +P+
Sbjct: 269 PSGITGCKS-LKLLDLESNRLNGSVPVGMGKMEKLSVIRLGDNFIDGKLPL 318

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 39/137 (28%), Positives = 69/137 (50%), Gaps = 1/137 (0%)
 Frame = +3

Query: 102 LSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMT 281
           + + +L    L GT+  ++  +  L  L L  NRITG++P+   K++ L  + +  N+++
Sbjct: 38  VEKIVLWNTSLAGTLTPALSGLTSLRVLTLFGNRITGNLPLDYLKLQTLWKINVSSNALS 97

Query: 282 GQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY-FMVLDLSFNKLTGRVPNSLAKAK 458
           G +P  +     +  L+LS+N F G IP+      Y    + LS N L+G +P S+    
Sbjct: 98  GLVPEFIGDLPNLRFLDLSKNAFFGEIPNSLFKFCYKTKFVSLSHNNLSGSIPESIVNCN 157

Query: 459 FMGHLDISNNHLCGNIP 509
            +   D S N + G +P
Sbjct: 158 NLIGFDFSYNGITGLLP 174

[154][TOP]
>UniRef100_C7J8A5 Os11g0173900 protein n=1 Tax=Oryza sativa Japonica Group
            RepID=C7J8A5_ORYSJ
          Length = 1029

 Score =  123 bits (308), Expect = 1e-26
 Identities = 69/190 (36%), Positives = 102/190 (53%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P S+  IS L  L L +NQ+ G +PS  GKL  LS   +S N L G+IP+ + ++  +  
Sbjct: 432  PSSLANISMLEELFLESNQLYGYIPSSLGKLNVLSVLSMSNNSLHGSIPEEIFRIPTIRK 491

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            + LS N +   +   +G  + L+ L+L  N++TG IPSTL +   +  + L  N F G+I
Sbjct: 492  ISLSFNNLDAPLHDDIGNAKQLTYLQLSSNNITGYIPSTLGNCESLEDIELDHNVFSGSI 551

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P   G+     VL LS N LTG +P SL   + +  LD+S N+L G +P    F +  A 
Sbjct: 552  PTTLGNIKTLKVLKLSNNNLTGSIPASLGNLQLLEQLDLSFNNLKGEVPTKGIFKNATAM 611

Query: 543  SFSNNDCLCG 572
                N+ LCG
Sbjct: 612  RVDGNEGLCG 621

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 52/170 (30%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRIS-GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P S+  +S  L HL L  N++ G+ P     L  L+   L  N+  G +P+ +  +  L 
Sbjct: 359 PSSLGNLSVQLQHLLLGTNKLSGDFPFGIANLPGLTMLGLEDNKFTGIVPEWLGSLQNLQ 418

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            ++L+ N  TG IP  L  + +L  L L+ N + G IPS+L     + +L++S N   G+
Sbjct: 419 GIELANNFFTGLIPSSLANISMLEELFLESNQLYGYIPSSLGKLNVLSVLSMSNNSLHGS 478

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP+          + LSFN L   + + +  AK + +L +S+N++ G IP
Sbjct: 479 IPEEIFRIPTIRKISLSFNNLDAPLHDDIGNAKQLTYLQLSSNNITGYIP 528

 Score = 84.3 bits (207), Expect = 6e-15
 Identities = 58/167 (34%), Positives = 82/167 (49%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLD 188
           S+  ++ L  L L  N + GE+PS FG L +L    LS N L G IPD +   + L  + 
Sbjct: 93  SLGNLTFLKFLLLPTNSLTGEIPSSFGYLHRLQFLYLSNNTLQGMIPD-LTNCSNLKAIW 151

Query: 189 LSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPD 368
           L  N + G IP  L     L  L+L  N++TG IPS L + T +  L    N  EG IP+
Sbjct: 152 LDSNDLVGQIPNILPPH--LQQLQLYNNNLTGTIPSYLANITSLKELIFVSNQIEGNIPN 209

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            F       VL    NKL G+ P ++     +  L ++ N+L G +P
Sbjct: 210 EFAKLPNLKVLYAGANKLEGKFPQAILNISTLTGLSLAYNNLSGELP 256

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 70/242 (28%), Positives = 104/242 (42%), Gaps = 57/242 (23%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSD-FGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I+ IS L  L L+ N + GELPS+ F  L  L    L+ N   G IP+S+   ++L 
Sbjct: 232 PQAILNISTLTGLSLAYNNLSGELPSNLFTYLPNLQDLGLAANLFQGHIPNSLANASKLY 291

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLD------------------------------G 269
            LD+++N  TG IP  +GK+  LS L L+                               
Sbjct: 292 MLDIALNYFTGIIPTSIGKLTELSWLNLEHHRLQARSKQDWEFMTSLANCSELNIFSMKD 351

Query: 270 NSMTGQIPSTL------------------------LSN-TGMGILNLSRNGFEGTIPDVF 374
           N + G +PS+L                        ++N  G+ +L L  N F G +P+  
Sbjct: 352 NLLEGHVPSSLGNLSVQLQHLLLGTNKLSGDFPFGIANLPGLTMLGLEDNKFTGIVPEWL 411

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFS 551
           GS      ++L+ N  TG +P+SLA    +  L + +N L G IP      + L   S S
Sbjct: 412 GSLQNLQGIELANNFFTGLIPSSLANISMLEELFLESNQLYGYIPSSLGKLNVLSVLSMS 471

Query: 552 NN 557
           NN
Sbjct: 472 NN 473

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 46/156 (29%), Positives = 79/156 (50%), Gaps = 1/156 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L L NN + G +PS    +  L   +   NQ+ G IP+   K+  L  L    N++ 
Sbjct: 169 LQQLQLYNNNLTGTIPSYLANITSLKELIFVSNQIEGNIPNEFAKLPNLKVLYAGANKLE 228

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN-TGMGILNLSRNGFEGTIPDVFGSKS 386
           G  P  +  +  L+ L L  N+++G++PS L +    +  L L+ N F+G IP+   + S
Sbjct: 229 GKFPQAILNISTLTGLSLAYNNLSGELPSNLFTYLPNLQDLGLAANLFQGHIPNSLANAS 288

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHL 494
              +LD++ N  TG +P S+ K   +  L++ ++ L
Sbjct: 289 KLYMLDIALNYFTGIIPTSIGKLTELSWLNLEHHRL 324

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 51/167 (30%), Positives = 82/167 (49%), Gaps = 1/167 (0%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           +   S L  + L +N ++G++P+       L +  L  N L GTIP  +  +  L +L  
Sbjct: 141 LTNCSNLKAIWLDSNDLVGQIPNILPP--HLQQLQLYNNNLTGTIPSYLANITSLKELIF 198

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-D 368
             N+I G+IP    K+  L  L    N + G+ P  +L+ + +  L+L+ N   G +P +
Sbjct: 199 VSNQIEGNIPNEFAKLPNLKVLYAGANKLEGKFPQAILNISTLTGLSLAYNNLSGELPSN 258

Query: 369 VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +F        L L+ N   G +PNSLA A  +  LDI+ N+  G IP
Sbjct: 259 LFTYLPNLQDLGLAANLFQGHIPNSLANASKLYMLDIALNYFTGIIP 305

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 43/138 (31%), Positives = 66/138 (47%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           R+++   L+   L+G I  S+  +  L  L L  N +TG IP   G +  L  L L  N+
Sbjct: 74  RRVTSLNLTNRGLVGKISPSLGNLTFLKFLLLPTNSLTGEIPSSFGYLHRLQFLYLSNNT 133

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA 455
           + G IP  L + + +  + L  N   G IP++     +   L L  N LTG +P+ LA  
Sbjct: 134 LQGMIPD-LTNCSNLKAIWLDSNDLVGQIPNIL--PPHLQQLQLYNNNLTGTIPSYLANI 190

Query: 456 KFMGHLDISNNHLCGNIP 509
             +  L   +N + GNIP
Sbjct: 191 TSLKELIFVSNQIEGNIP 208

[155][TOP]
>UniRef100_B9IED3 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IED3_POPTR
          Length = 1023

 Score =  123 bits (308), Expect = 1e-26
 Identities = 66/190 (34%), Positives = 107/190 (56%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P S   +SG++ L L++N + G +P       +L    LS N L G IP+ +  ++ L  
Sbjct: 440  PSSFGNLSGILRLSLADNFLEGTIPVSLANYSQLEVLDLSYNHLSGVIPEKLAGIDSLFG 499

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L L++N +TG +P +LG  R L+ L +  N ++G+IP ++ +   +  LN+  N FEGTI
Sbjct: 500  LFLALNNLTGPLPSQLGNARNLNELDISENKLSGEIPRSIENCVMLENLNMEGNFFEGTI 559

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P  F       VL+L+ N L+G++P  L +   +G+L++S N   G +P G  F++  A 
Sbjct: 560  PSSFKKLRSIRVLNLARNNLSGQIPKFLGELPLLGYLNLSVNSFDGEVPTGGVFNNASAF 619

Query: 543  SFSNNDCLCG 572
            S + ND LCG
Sbjct: 620  SVAGNDKLCG 629

 Score =  105 bits (263), Expect = 2e-21
 Identities = 60/170 (35%), Positives = 91/170 (53%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRIS-GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P+SI  +S  L  L L  N I G++P +   L+ L       N L G +PDS+ K+++L 
Sbjct: 367 PISIANLSTNLYWLTLGTNYITGDIPVEIENLKNLEYLAFHGNMLTGRLPDSIGKLSKLQ 426

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           +L +  N+I+G+IP   G +  +  L L  N + G IP +L + + + +L+LS N   G 
Sbjct: 427 ELHIYTNKISGNIPSSFGNLSGILRLSLADNFLEGTIPVSLANYSQLEVLDLSYNHLSGV 486

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP+          L L+ N LTG +P+ L  A+ +  LDIS N L G IP
Sbjct: 487 IPEKLAGIDSLFGLFLALNNLTGPLPSQLGNARNLNELDISENKLSGEIP 536

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 54/169 (31%), Positives = 81/169 (47%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ I  +  L +L    N + G LP   GKL KL    +  N++ G IP S   ++ +  
Sbjct: 392 PVEIENLKNLEYLAFHGNMLTGRLPDSIGKLSKLQELHIYTNKISGNIPSSFGNLSGILR 451

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L+ N + G+IPV L     L  L L  N ++G IP  L     +  L L+ N   G +
Sbjct: 452 LSLADNFLEGTIPVSLANYSQLEVLDLSYNHLSGVIPEKLAGIDSLFGLFLALNNLTGPL 511

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+      LD+S NKL+G +P S+     + +L++  N   G IP
Sbjct: 512 PSQLGNARNLNELDISENKLSGEIPRSIENCVMLENLNMEGNFFEGTIP 560

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 59/201 (29%), Positives = 89/201 (44%), Gaps = 32/201 (15%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  +  IS +  L +++NQ+ G LP D G  L K+    L  NQ  G IP S++  + L 
Sbjct: 240 PEQLYNISSINLLTVADNQLTGRLPHDIGLTLPKMQTLYLGTNQFFGHIPKSIVNFSSLI 299

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDG------------------------------ 269
           D+DL+ N +TG +P  LG ++ L T+   G                              
Sbjct: 300 DIDLAYNSLTGPVPNNLGNLQNLETINFGGNPLGDENTSDLTFLTSLTNCTNLREVWFFE 359

Query: 270 NSMTGQIPSTLLS-NTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSL 446
           N + G +P ++ + +T +  L L  N   G IP    +      L    N LTGR+P+S+
Sbjct: 360 NHLRGVLPISIANLSTNLYWLTLGTNYITGDIPVEIENLKNLEYLAFHGNMLTGRLPDSI 419

Query: 447 AKAKFMGHLDISNNHLCGNIP 509
            K   +  L I  N + GNIP
Sbjct: 420 GKLSKLQELHIYTNKISGNIP 440

 Score = 84.3 bits (207), Expect = 6e-15
 Identities = 56/157 (35%), Positives = 78/157 (49%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+LS+ ++ G L   FG L  L    LSRN+     P  V ++ RL  L L+ N   G +
Sbjct: 84  LNLSSLKLAGSLSPHFGNLTFLRVIDLSRNRFHHIFPPEVGQLFRLRYLSLANNSFQGEL 143

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  LG    L  L L GN+  G+IPS L S + +  L+L+ N F G IP  FG+ S    
Sbjct: 144 PSTLGICSNLIFLNLYGNNFRGKIPSALGSLSRLRRLSLASNNFTGAIPPSFGNLSSMQR 203

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             L  N L G +P  L +   +  L + +N L G +P
Sbjct: 204 ASLQLNNLEGIIPAELGRLSALEVLSLYSNKLSGMVP 240

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 53/170 (31%), Positives = 85/170 (50%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  + ++  L +L L+NN   GELPS  G    L    L  N   G IP ++  ++RL  
Sbjct: 120 PPEVGQLFRLRYLSLANNSFQGELPSTLGICSNLIFLNLYGNNFRGKIPSALGSLSRLRR 179

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L+ N  TG+IP   G +  +    L  N++ G IP+ L   + + +L+L  N   G +
Sbjct: 180 LSLASNNFTGAIPPSFGNLSSMQRASLQLNNLEGIIPAELGRLSALEVLSLYSNKLSGMV 239

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLA-KAKFMGHLDISNNHLCGNIP 509
           P+   + S   +L ++ N+LTGR+P+ +      M  L +  N   G+IP
Sbjct: 240 PEQLYNISSINLLTVADNQLTGRLPHDIGLTLPKMQTLYLGTNQFFGHIP 289

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 52/193 (26%), Positives = 86/193 (44%), Gaps = 8/193 (4%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIG------TIPDSVLK 164
           P SIV  S L+ +DL+ N + G +P++ G L+ L       N L        T   S+  
Sbjct: 289 PKSIVNFSSLIDIDLAYNSLTGPVPNNLGNLQNLETINFGGNPLGDENTSDLTFLTSLTN 348

Query: 165 MNRLADLDLSMNRITGSIPVRLGKMRV-LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSR 341
              L ++    N + G +P+ +  +   L  L L  N +TG IP  + +   +  L    
Sbjct: 349 CTNLREVWFFENHLRGVLPISIANLSTNLYWLTLGTNYITGDIPVEIENLKNLEYLAFHG 408

Query: 342 NGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-S 518
           N   G +PD  G  S    L +  NK++G +P+S      +  L +++N L G IP+  +
Sbjct: 409 NMLTGRLPDSIGKLSKLQELHIYTNKISGNIPSSFGNLSGILRLSLADNFLEGTIPVSLA 468

Query: 519 PFDHLDAASFSNN 557
            +  L+    S N
Sbjct: 469 NYSQLEVLDLSYN 481

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 47/138 (34%), Positives = 66/138 (47%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS 275
           R+++   LS  +L G++      +  L  +DLS NR     P  +G++  L  L L  NS
Sbjct: 79  RRVTSLNLSSLKLAGSLSPHFGNLTFLRVIDLSRNRFHHIFPPEVGQLFRLRYLSLANNS 138

Query: 276 MTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKA 455
             G++PSTL   + +  LNL  N F G IP   GS S    L L+ N  TG +P S    
Sbjct: 139 FQGELPSTLGICSNLIFLNLYGNNFRGKIPSALGSLSRLRRLSLASNNFTGAIPPSFGNL 198

Query: 456 KFMGHLDISNNHLCGNIP 509
             M    +  N+L G IP
Sbjct: 199 SSMQRASLQLNNLEGIIP 216

[156][TOP]
>UniRef100_A5AE09 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5AE09_VITVI
          Length = 868

 Score =  123 bits (308), Expect = 1e-26
 Identities = 71/192 (36%), Positives = 102/192 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  ++ L  LDLS+N++ G +P  FG L  L    L  N L   +P S+  +  L  
Sbjct: 336 PSGLCHLANLGFLDLSSNKLSGTIPGCFGNLTLLRGINLHSNGLASEVPSSLWTLRDLLV 395

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LS N +   +P+ +G M+ L  L L  N  +G IPST+     +  L+LS N  +G +
Sbjct: 396 LNLSSNFLNSQLPLEVGNMKSLVVLDLSKNQFSGNIPSTISLLQNLVQLHLSHNKLQGHM 455

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P  FG       LDLS N L+G +P SL   K++ +L++S N L   IP G PF +  A 
Sbjct: 456 PPNFGDLVSLEYLDLSGNNLSGSIPKSLEALKYLKYLNVSVNKLQREIPNGGPFANFTAE 515

Query: 543 SFSNNDCLCGNP 578
           SF +N  LCG P
Sbjct: 516 SFISNLALCGAP 527

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 58/169 (34%), Positives = 87/169 (51%), Gaps = 1/169 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           S+   + L +L +S N + G +P+  G L   L   + S  QL GTIP  +  +  L DL
Sbjct: 241 SLTNCNSLRNLWISGNPLKGIIPNSLGNLSISLESIVASGCQLRGTIPTGISYLTNLIDL 300

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
            L  N +TG IP   G+++ L  L    N + G IPS L     +G L+LS N   GTIP
Sbjct: 301 RLDDNNLTGLIPTSSGRLQKLQVLYFSQNQIHGPIPSGLCHLANLGFLDLSSNKLSGTIP 360

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
             FG+ +    ++L  N L   VP+SL   + +  L++S+N L   +P+
Sbjct: 361 GCFGNLTLLRGINLHSNGLASEVPSSLWTLRDLLVLNLSSNFLNSQLPL 409

 Score = 84.0 bits (206), Expect = 8e-15
 Identities = 54/177 (30%), Positives = 89/177 (50%), Gaps = 8/177 (4%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S   ++ L  L L  N I G +P + G L  L    L  + L G +P+++  +++L  
Sbjct: 87  PPSFGNLTALQDLQLGENNIQGNIPKELGSLINLKFLNLGPSNLTGIVPEAIFNISKLPS 146

Query: 183 LDLSMNRITGSIPVRLGK-MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           L L +N ++GS+P  +G  +  L  L + GN  +G IP ++L+ + + +L++S N F G 
Sbjct: 147 LSLVLNHLSGSLPSSIGTWLPDLEGLYIGGNQFSGIIPLSILNMSKLTVLDISVNFFTGY 206

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPN-------SLAKAKFMGHLDISNNHLCGNIP 509
           +P   G+      L LS N+L+    +       SL     + +L IS N L G IP
Sbjct: 207 VPKDLGNLRRLQYLSLSRNQLSNEHSDSELAFLTSLTNCNSLRNLWISGNPLKGIIP 263

 Score = 80.5 bits (197), Expect = 9e-14
 Identities = 52/168 (30%), Positives = 74/168 (44%), Gaps = 25/168 (14%)
 Frame = +3

Query: 66  GELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRV 245
           G  P + G L KL +  L RN   GTIP S   +  L DL L  N I G+IP  LG +  
Sbjct: 60  GSTPREIGNLSKLEQIYLGRNSFTGTIPPSFGNLTALQDLQLGENNIQGNIPKELGSLIN 119

Query: 246 LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG---------------- 377
           L  L L  +++TG +P  + + + +  L+L  N   G++P   G                
Sbjct: 120 LKFLNLGPSNLTGIVPEAIFNISKLPSLSLVLNHLSGSLPSSIGTWLPDLEGLYIGGNQF 179

Query: 378 ---------SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHL 494
                    + S   VLD+S N  TG VP  L   + + +L +S N L
Sbjct: 180 SGIIPLSILNMSKLTVLDISVNFFTGYVPKDLGNLRRLQYLSLSRNQL 227

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 64/205 (31%), Positives = 90/205 (43%), Gaps = 34/205 (16%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P +I  IS L  L L  N + G LPS  G  L  L    +  NQ  G IP S+L M++L 
Sbjct: 135 PEAIFNISKLPSLSLVLNHLSGSLPSSIGTWLPDLEGLYIGGNQFSGIIPLSILNMSKLT 194

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLD------------------------------- 266
            LD+S+N  TG +P  LG +R L  L L                                
Sbjct: 195 VLDISVNFFTGYVPKDLGNLRRLQYLSLSRNQLSNEHSDSELAFLTSLTNCNSLRNLWIS 254

Query: 267 GNSMTGQIPSTLLSNTGMGILNLSRNGFE--GTIPDVFGSKSYFMVLDLSFNKLTGRVPN 440
           GN + G IP++L  N  + + ++  +G +  GTIP      +  + L L  N LTG +P 
Sbjct: 255 GNPLKGIIPNSL-GNLSISLESIVASGCQLRGTIPTGISYLTNLIDLRLDDNNLTGLIPT 313

Query: 441 SLAKAKFMGHLDISNNHLCGNIPIG 515
           S  + + +  L  S N + G IP G
Sbjct: 314 SSGRLQKLQVLYFSQNQIHGPIPSG 338

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 38/118 (32%), Positives = 55/118 (46%), Gaps = 2/118 (1%)
 Frame = +3

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           GS P  +G +  L  + L  NS TG IP +  + T +  L L  N  +G IP   GS   
Sbjct: 60  GSTPREIGNLSKLEQIYLGRNSFTGTIPPSFGNLTALQDLQLGENNIQGNIPKELGSLIN 119

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAASFSNN 557
              L+L  + LTG VP ++     +  L +  NHL G++P  IG+    L+      N
Sbjct: 120 LKFLNLGPSNLTGIVPEAIFNISKLPSLSLVLNHLSGSLPSSIGTWLPDLEGLYIGGN 177

[157][TOP]
>UniRef100_UPI0001984B77 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001984B77
          Length = 717

 Score =  122 bits (307), Expect = 2e-26
 Identities = 74/194 (38%), Positives = 114/194 (58%), Gaps = 2/194 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++ L+HLDLS+NQ+   LP   G L +L+   +S N+L G IP S+ ++ +L  
Sbjct: 155 PHQIGSLTKLIHLDLSSNQLTDSLPHQIGTLTELTYLHVSSNELTGPIPSSLGRLTKLTH 214

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N++ GSIP ++G +  L+ L L    +TG +PS+L   T +  L+LS N   G+I
Sbjct: 215 LDLSYNQLNGSIPHQIGTLIELTYLDLSWGELTGAMPSSLGCLTKLTSLDLSMNQINGSI 274

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P   G+    + LDLS N ++G +P++L   K +  LD+S N L GN+P     ++ +  
Sbjct: 275 PPEIGNLKDLVTLDLSNNLISGEIPSNLKILKRLWLLDLSYNRLSGNVP-SFITNNCNQT 333

Query: 543 SF--SNNDCLCGNP 578
           +F  S ND L G+P
Sbjct: 334 TFDLSQNDDLEGHP 347

 Score =  112 bits (280), Expect = 2e-23
 Identities = 71/181 (39%), Positives = 103/181 (56%), Gaps = 2/181 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           ++ L  LDLS+NQ+   +P   G L KL+   L  NQL G IP  +  + +L  LDLS N
Sbjct: 113 LTKLTILDLSHNQLTDPIPHQIGSLTKLTHLDLFDNQLTGPIPHQIGSLTKLIHLDLSSN 172

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           ++T S+P ++G +  L+ L +  N +TG IPS+L   T +  L+LS N   G+IP   G+
Sbjct: 173 QLTDSLPHQIGTLTELTYLHVSSNELTGPIPSSLGRLTKLTHLDLSYNQLNGSIPHQIGT 232

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAASFSN 554
                 LDLS+ +LTG +P+SL     +  LD+S N + G+IP  IG+  D L     SN
Sbjct: 233 LIELTYLDLSWGELTGAMPSSLGCLTKLTSLDLSMNQINGSIPPEIGNLKD-LVTLDLSN 291

Query: 555 N 557
           N
Sbjct: 292 N 292

 Score = 91.7 bits (226), Expect = 4e-17
 Identities = 54/168 (32%), Positives = 86/168 (51%)
 Frame = +3

Query: 6   MSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           +++  +  L  L LS   + G +    G L KL+   LS NQL   IP  +  + +L  L
Sbjct: 84  LNLSSLPSLNFLILSRMGLSGSISDQIGSLTKLTILDLSHNQLTDPIPHQIGSLTKLTHL 143

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           DL  N++TG IP ++G +  L  L L  N +T  +P  + + T +  L++S N   G IP
Sbjct: 144 DLFDNQLTGPIPHQIGSLTKLIHLDLSSNQLTDSLPHQIGTLTELTYLHVSSNELTGPIP 203

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              G  +    LDLS+N+L G +P+ +     + +LD+S   L G +P
Sbjct: 204 SSLGRLTKLTHLDLSYNQLNGSIPHQIGTLIELTYLDLSWGELTGAMP 251

[158][TOP]
>UniRef100_Q10LT7 Os03g0335500 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q10LT7_ORYSJ
          Length = 971

 Score =  122 bits (307), Expect = 2e-26
 Identities = 69/178 (38%), Positives = 105/178 (58%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           +DLS+N   G +PS+  ++  L    +S N L G+IP S+++M  L  LDL+ NR+ GSI
Sbjct: 391 VDLSSNAFSGMIPSEISQVITLQSLNMSWNSLSGSIPPSIVQMKSLEVLDLTANRLNGSI 450

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  +G    L  L+L  NS+TG+IP+ + + + +  L+LS N   G IP    + +    
Sbjct: 451 PATVGG-ESLRELRLAKNSLTGEIPAQIGNLSALASLDLSHNNLTGAIPATIANITNLQT 509

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
           +DLS NKLTG +P  L+    +   +IS+N L G++P GS FD +  +S S+N  LCG
Sbjct: 510 VDLSRNKLTGGLPKQLSDLPHLVRFNISHNQLSGDLPPGSFFDTIPLSSVSDNPGLCG 567

 Score =  106 bits (265), Expect = 1e-21
 Identities = 60/170 (35%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDF-GKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  + R+  L  LDLS N   G +P  F G  R L    L+ N   G +P  V     LA
Sbjct: 115 PADLARLPDLQSLDLSANAFSGAIPDGFFGHCRNLRDVSLANNAFSGDVPRDVGACATLA 174

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L+LS NR+ G++P  +  +  L TL L GN++TG +P  +     +  LNL  N   G+
Sbjct: 175 SLNLSSNRLAGALPSDIWSLNALRTLDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLAGS 234

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +PD  G       +DL  N ++G +P SL +     +LD+S+N L GN+P
Sbjct: 235 LPDDIGDCPLLRSVDLGSNNISGNLPESLRRLSTCTYLDLSSNALTGNVP 284

 Score =  106 bits (265), Expect = 1e-21
 Identities = 58/168 (34%), Positives = 94/168 (55%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ + R+  L  L+L +N++ G LP D G    L    L  N + G +P+S+ +++    
Sbjct: 212 PVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLRRLSTCTY 271

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N +TG++P  +G+M  L TL L GN  +G+IP ++     +  L LS NGF G +
Sbjct: 272 LDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIPGSIGGLMSLKELRLSGNGFTGGL 331

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P+  G     + +D+S+N LTG +P S   A  +  + +S+N L G +
Sbjct: 332 PESIGGCKSLVHVDVSWNSLTGTLP-SWVFASGVQWVSVSDNTLSGEV 378

 Score =  102 bits (254), Expect = 2e-20
 Identities = 58/169 (34%), Positives = 87/169 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++ L  LDLS N I G+LP    ++  L    L  N+L G++PD +     L  
Sbjct: 188 PSDIWSLNALRTLDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRS 247

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +DL  N I+G++P  L ++   + L L  N++TG +P+ +     +  L+LS N F G I
Sbjct: 248 VDLGSNNISGNLPESLRRLSTCTYLDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEI 307

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G       L LS N  TG +P S+   K + H+D+S N L G +P
Sbjct: 308 PGSIGGLMSLKELRLSGNGFTGGLPESIGGCKSLVHVDVSWNSLTGTLP 356

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 56/169 (33%), Positives = 87/169 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +   + L  L+LS+N++ G LPSD   L  L    LS N + G +P  V +M  L  
Sbjct: 164 PRDVGACATLASLNLSSNRLAGALPSDIWSLNALRTLDLSGNAITGDLPVGVSRMFNLRS 223

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L  NR+ GS+P  +G   +L ++ L  N+++G +P +L   +    L+LS N   G +
Sbjct: 224 LNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLRRLSTCTYLDLSSNALTGNV 283

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G  +    LDLS NK +G +P S+     +  L +S N   G +P
Sbjct: 284 PTWVGEMASLETLDLSGNKFSGEIPGSIGGLMSLKELRLSGNGFTGGLP 332

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 56/160 (35%), Positives = 81/160 (50%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  + L+NN   G++P D G    L+   LS N+L G +P  +  +N L  LDLS N IT
Sbjct: 149 LRDVSLANNAFSGDVPRDVGACATLASLNLSSNRLAGALPSDIWSLNALRTLDLSGNAIT 208

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G +PV + +M  L +L L  N + G +P  +     +  ++L  N   G +P+     S 
Sbjct: 209 GDLPVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLRRLST 268

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              LDLS N LTG VP  + +   +  LD+S N   G IP
Sbjct: 269 CTYLDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIP 308

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 50/165 (30%), Positives = 82/165 (49%), Gaps = 1/165 (0%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           R++GL    L+   + G+L     +L  L    LS N   G +P  + ++  L  LDLS 
Sbjct: 75  RVAGL---SLAGFGLSGKLGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQSLDLSA 131

Query: 198 NRITGSIPVR-LGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVF 374
           N  +G+IP    G  R L  + L  N+ +G +P  + +   +  LNLS N   G +P   
Sbjct: 132 NAFSGAIPDGFFGHCRNLRDVSLANNAFSGDVPRDVGACATLASLNLSSNRLAGALPSDI 191

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            S +    LDLS N +TG +P  +++   +  L++ +N L G++P
Sbjct: 192 WSLNALRTLDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLAGSLP 236

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 38/129 (29%), Positives = 68/129 (52%), Gaps = 1/129 (0%)
 Frame = +3

Query: 132 LIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN 311
           L G +   +L++  L  L LS N  +G +P  L ++  L +L L  N+ +G IP     +
Sbjct: 86  LSGKLGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQSLDLSANAFSGAIPDGFFGH 145

Query: 312 T-GMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNN 488
              +  ++L+ N F G +P   G+ +    L+LS N+L G +P+ +     +  LD+S N
Sbjct: 146 CRNLRDVSLANNAFSGDVPRDVGACATLASLNLSSNRLAGALPSDIWSLNALRTLDLSGN 205

Query: 489 HLCGNIPIG 515
            + G++P+G
Sbjct: 206 AITGDLPVG 214

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 30/88 (34%), Positives = 48/88 (54%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L L+ N + GE+P+  G L  L+   LS N L G IP ++  +  L  +DLS N++T
Sbjct: 459 LRELRLAKNSLTGEIPAQIGNLSALASLDLSHNNLTGAIPATIANITNLQTVDLSRNKLT 518

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIP 293
           G +P +L  +  L    +  N ++G +P
Sbjct: 519 GGLPKQLSDLPHLVRFNISHNQLSGDLP 546

[159][TOP]
>UniRef100_O64794 Leucine-rich repeat receptor-like protein kinase n=1
           Tax=Arabidopsis thaliana RepID=O64794_ARATH
          Length = 719

 Score =  122 bits (307), Expect = 2e-26
 Identities = 72/194 (37%), Positives = 103/194 (53%), Gaps = 2/194 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +  L  L+L NN++ G +P+       L    L  N L GT+P S+ K+ +L +
Sbjct: 89  PSELGSLIYLRRLNLHNNELYGSIPTQLFNATSLHSIFLYGNNLSGTLPPSICKLPKLQN 148

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN-TGMGILNLSRNGFEGT 359
           LDLSMN ++G++   L K + L  L L  N+ +G+IP  +    T +  L+LS N F G 
Sbjct: 149 LDLSMNSLSGTLSPDLNKCKQLQRLILSANNFSGEIPGDIWPELTNLAQLDLSANEFSGE 208

Query: 360 IP-DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLD 536
           IP D+   KS    L+LSFN L+G++PNSL        LD+ NN   G IP    F +  
Sbjct: 209 IPKDIGELKSLSGTLNLSFNHLSGQIPNSLGNLPVTVSLDLRNNDFSGEIPQSGSFSNQG 268

Query: 537 AASFSNNDCLCGNP 578
             +F NN  LCG P
Sbjct: 269 PTAFLNNPKLCGFP 282

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 37/114 (32%), Positives = 54/114 (47%)
 Frame = +3

Query: 168 NRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNG 347
           +R+  + L+   + G IP  LG +  L  L L  N + G IP+ L + T +  + L  N 
Sbjct: 72  SRVVGISLAGKHLRGYIPSELGSLIYLRRLNLHNNELYGSIPTQLFNATSLHSIFLYGNN 131

Query: 348 FEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             GT+P           LDLS N L+G +   L K K +  L +S N+  G IP
Sbjct: 132 LSGTLPPSICKLPKLQNLDLSMNSLSGTLSPDLNKCKQLQRLILSANNFSGEIP 185

[160][TOP]
>UniRef100_B9RBW0 Leucine-rich repeat transmembrane protein kinase, putative n=1
           Tax=Ricinus communis RepID=B9RBW0_RICCO
          Length = 884

 Score =  122 bits (307), Expect = 2e-26
 Identities = 70/192 (36%), Positives = 102/192 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+SI     L  L+L  N++ G +P     L+ L    ++ N + GTIP     +  L  
Sbjct: 306 PLSITNCKNLKVLNLGFNRLNGSIPPGIADLKSLRVLNMANNSIDGTIPAGFGGIELLLV 365

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL    + G IP  +     L  L L GN ++G+IPST  + T + +L+L RN F G+I
Sbjct: 366 LDLHNLHLNGEIPRDISNSMTLCELDLSGNDLSGEIPSTFYNMTWLEVLDLHRNQFNGSI 425

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P+  G+ S   VLDLS N L+G +P+SL     + + ++S+N L G IP    F    A+
Sbjct: 426 PETVGNLSNLKVLDLSQNNLSGSIPSSLGNLPNLTYFNLSSNSLSGPIPFMPKFLAFGAS 485

Query: 543 SFSNNDCLCGNP 578
           +F NN  LCG P
Sbjct: 486 AFLNNSRLCGPP 497

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 54/171 (31%), Positives = 85/171 (49%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+S+V  + L   D S N + G+LPS+   +  L    L  N L G++ + +L+  RL  
Sbjct: 186 PVSLVNCAKLEGFDFSFNNLSGQLPSEICSIPVLKYMSLRSNVLTGSVQEEILRCQRLNF 245

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL  N  +G  P      + +S      N   G+IP     + G+   ++S N F+G I
Sbjct: 246 LDLGSNMFSGLAPFGALGFKNMSYFNASYNGFHGEIPEIETCSEGLEFFDVSGNDFDGEI 305

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           P    +     VL+L FN+L G +P  +A  K +  L+++NN + G IP G
Sbjct: 306 PLSITNCKNLKVLNLGFNRLNGSIPPGIADLKSLRVLNMANNSIDGTIPAG 356

 Score = 85.1 bits (209), Expect = 4e-15
 Identities = 53/166 (31%), Positives = 76/166 (45%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I+R   L  LDL +N   G  P      + +S    S N   G IP+       L   D+
Sbjct: 237 ILRCQRLNFLDLGSNMFSGLAPFGALGFKNMSYFNASYNGFHGEIPEIETCSEGLEFFDV 296

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
           S N   G IP+ +   + L  L L  N + G IP  +     + +LN++ N  +GTIP  
Sbjct: 297 SGNDFDGEIPLSITNCKNLKVLNLGFNRLNGSIPPGIADLKSLRVLNMANNSIDGTIPAG 356

Query: 372 FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           FG     +VLDL    L G +P  ++ +  +  LD+S N L G IP
Sbjct: 357 FGGIELLLVLDLHNLHLNGEIPRDISNSMTLCELDLSGNDLSGEIP 402

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 63/211 (29%), Positives = 91/211 (43%), Gaps = 26/211 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKL-RKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  +  +  LDLS N   GE+PS   K   K   A LS N L G IP S++   +L 
Sbjct: 137 PEFIGDLPNIRFLDLSRNSYNGEIPSSLFKFCYKTKFASLSHNSLSGQIPVSLVNCAKLE 196

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLL-----------SNTGMGI 326
             D S N ++G +P  +  + VL  + L  N +TG +   +L           SN   G+
Sbjct: 197 GFDFSFNNLSGQLPSEICSIPVLKYMSLRSNVLTGSVQEEILRCQRLNFLDLGSNMFSGL 256

Query: 327 -------------LNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
                         N S NGF G IP++          D+S N   G +P S+   K + 
Sbjct: 257 APFGALGFKNMSYFNASYNGFHGEIPEIETCSEGLEFFDVSGNDFDGEIPLSITNCKNLK 316

Query: 468 HLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
            L++  N L G+IP G +    L   + +NN
Sbjct: 317 VLNLGFNRLNGSIPPGIADLKSLRVLNMANN 347

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 1/173 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++  +  L  L L  N+  G +P ++ +L  L +  LS N L G+IP+ +  +  +  
Sbjct: 89  PPALSGLRSLRILTLFGNKFTGNIPQEYAELSTLWKINLSSNALSGSIPEFIGDLPNIRF 148

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTL-KLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           LDLS N   G IP  L K    +    L  NS++GQIP +L++   +   + S N   G 
Sbjct: 149 LDLSRNSYNGEIPSSLFKFCYKTKFASLSHNSLSGQIPVSLVNCAKLEGFDFSFNNLSGQ 208

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGS 518
           +P    S      + L  N LTG V   + + + +  LD+ +N   G  P G+
Sbjct: 209 LPSEICSIPVLKYMSLRSNVLTGSVQEEILRCQRLNFLDLGSNMFSGLAPFGA 261

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 47/155 (30%), Positives = 76/155 (49%), Gaps = 1/155 (0%)
 Frame = +3

Query: 45  LSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPV 224
           L N  + G LP     LR L    L  N+  G IP    +++ L  ++LS N ++GSIP 
Sbjct: 79  LWNKHLSGSLPPALSGLRSLRILTLFGNKFTGNIPQEYAELSTLWKINLSSNALSGSIPE 138

Query: 225 RLGKMRVLSTLKLDGNSMTGQIPSTLLSNT-GMGILNLSRNGFEGTIPDVFGSKSYFMVL 401
            +G +  +  L L  NS  G+IPS+L          +LS N   G IP    + +     
Sbjct: 139 FIGDLPNIRFLDLSRNSYNGEIPSSLFKFCYKTKFASLSHNSLSGQIPVSLVNCAKLEGF 198

Query: 402 DLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           D SFN L+G++P+ +     + ++ + +N L G++
Sbjct: 199 DFSFNNLSGQLPSEICSIPVLKYMSLRSNVLTGSV 233

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 38/104 (36%), Positives = 53/104 (50%), Gaps = 1/104 (0%)
 Frame = +3

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           ++GS+P  L  +R L  L L GN  TG IP      + +  +NLS N   G+IP+  G  
Sbjct: 84  LSGSLPPALSGLRSLRILTLFGNKFTGNIPQEYAELSTLWKINLSSNALSGSIPEFIGDL 143

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHL-DISNNHLCGNIPI 512
                LDLS N   G +P+SL K  +      +S+N L G IP+
Sbjct: 144 PNIRFLDLSRNSYNGEIPSSLFKFCYKTKFASLSHNSLSGQIPV 187

[161][TOP]
>UniRef100_B8ANZ9 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8ANZ9_ORYSI
          Length = 971

 Score =  122 bits (307), Expect = 2e-26
 Identities = 69/178 (38%), Positives = 105/178 (58%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           +DLS+N   G +PS+  ++  L    +S N L G+IP S+++M  L  LDL+ NR+ GSI
Sbjct: 391 VDLSSNAFSGMIPSEISQVITLQSLNMSWNSLSGSIPPSIVQMKSLEVLDLTANRLNGSI 450

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  +G    L  L+L  NS+TG+IP+ + + + +  L+LS N   G IP    + +    
Sbjct: 451 PATVGG-ESLRELRLAKNSLTGEIPAQIGNLSALASLDLSHNNLTGAIPATIANITNLQT 509

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
           +DLS NKLTG +P  L+    +   +IS+N L G++P GS FD +  +S S+N  LCG
Sbjct: 510 VDLSRNKLTGGLPKQLSDLPHLVRFNISHNQLSGDLPPGSFFDTIPLSSVSDNPGLCG 567

 Score =  106 bits (265), Expect = 1e-21
 Identities = 60/170 (35%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDF-GKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  + R+  L  LDLS N   G +P  F G  R L    L+ N   G +P  V     LA
Sbjct: 115 PADLARLPDLQSLDLSANAFSGAIPDGFFGHCRNLRDVSLANNAFSGDVPRDVGACATLA 174

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L+LS NR+ G++P  +  +  L TL L GN++TG +P  +     +  LNL  N   G+
Sbjct: 175 SLNLSSNRLAGALPSDIWSLNALRTLDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLAGS 234

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +PD  G       +DL  N ++G +P SL +     +LD+S+N L GN+P
Sbjct: 235 LPDDIGDCPLLRSVDLGSNNISGNLPESLRRLSTCTYLDLSSNALTGNVP 284

 Score =  106 bits (265), Expect = 1e-21
 Identities = 58/168 (34%), Positives = 94/168 (55%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ + R+  L  L+L +N++ G LP D G    L    L  N + G +P+S+ +++    
Sbjct: 212 PVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLRRLSTCTY 271

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N +TG++P  +G+M  L TL L GN  +G+IP ++     +  L LS NGF G +
Sbjct: 272 LDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIPGSIGGLMSLKELRLSGNGFTGGL 331

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P+  G     + +D+S+N LTG +P S   A  +  + +S+N L G +
Sbjct: 332 PESIGGCKSLVHVDVSWNSLTGTLP-SWVFASGVQWVSVSDNTLSGEV 378

 Score =  102 bits (254), Expect = 2e-20
 Identities = 58/169 (34%), Positives = 87/169 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++ L  LDLS N I G+LP    ++  L    L  N+L G++PD +     L  
Sbjct: 188 PSDIWSLNALRTLDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRS 247

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +DL  N I+G++P  L ++   + L L  N++TG +P+ +     +  L+LS N F G I
Sbjct: 248 VDLGSNNISGNLPESLRRLSTCTYLDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEI 307

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G       L LS N  TG +P S+   K + H+D+S N L G +P
Sbjct: 308 PGSIGGLMSLKELRLSGNGFTGGLPESIGGCKSLVHVDVSWNSLTGTLP 356

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 56/169 (33%), Positives = 87/169 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +   + L  L+LS+N++ G LPSD   L  L    LS N + G +P  V +M  L  
Sbjct: 164 PRDVGACATLASLNLSSNRLAGALPSDIWSLNALRTLDLSGNAITGDLPVGVSRMFNLRS 223

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L  NR+ GS+P  +G   +L ++ L  N+++G +P +L   +    L+LS N   G +
Sbjct: 224 LNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLRRLSTCTYLDLSSNALTGNV 283

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G  +    LDLS NK +G +P S+     +  L +S N   G +P
Sbjct: 284 PTWVGEMASLETLDLSGNKFSGEIPGSIGGLMSLKELRLSGNGFTGGLP 332

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 56/160 (35%), Positives = 81/160 (50%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  + L+NN   G++P D G    L+   LS N+L G +P  +  +N L  LDLS N IT
Sbjct: 149 LRDVSLANNAFSGDVPRDVGACATLASLNLSSNRLAGALPSDIWSLNALRTLDLSGNAIT 208

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G +PV + +M  L +L L  N + G +P  +     +  ++L  N   G +P+     S 
Sbjct: 209 GDLPVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLRRLST 268

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              LDLS N LTG VP  + +   +  LD+S N   G IP
Sbjct: 269 CTYLDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIP 308

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 50/165 (30%), Positives = 82/165 (49%), Gaps = 1/165 (0%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           R++GL    L+   + G+L     +L  L    LS N   G +P  + ++  L  LDLS 
Sbjct: 75  RVAGL---SLAGFGLSGKLGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQSLDLSA 131

Query: 198 NRITGSIPVR-LGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVF 374
           N  +G+IP    G  R L  + L  N+ +G +P  + +   +  LNLS N   G +P   
Sbjct: 132 NAFSGAIPDGFFGHCRNLRDVSLANNAFSGDVPRDVGACATLASLNLSSNRLAGALPSDI 191

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            S +    LDLS N +TG +P  +++   +  L++ +N L G++P
Sbjct: 192 WSLNALRTLDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLAGSLP 236

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 38/129 (29%), Positives = 68/129 (52%), Gaps = 1/129 (0%)
 Frame = +3

Query: 132 LIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN 311
           L G +   +L++  L  L LS N  +G +P  L ++  L +L L  N+ +G IP     +
Sbjct: 86  LSGKLGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQSLDLSANAFSGAIPDGFFGH 145

Query: 312 T-GMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNN 488
              +  ++L+ N F G +P   G+ +    L+LS N+L G +P+ +     +  LD+S N
Sbjct: 146 CRNLRDVSLANNAFSGDVPRDVGACATLASLNLSSNRLAGALPSDIWSLNALRTLDLSGN 205

Query: 489 HLCGNIPIG 515
            + G++P+G
Sbjct: 206 AITGDLPVG 214

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 30/88 (34%), Positives = 48/88 (54%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L L+ N + GE+P+  G L  L+   LS N L G IP ++  +  L  +DLS N++T
Sbjct: 459 LRELRLAKNSLTGEIPAQIGNLSALASLDLSHNNLTGAIPATIANITNLQTVDLSRNKLT 518

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIP 293
           G +P +L  +  L    +  N ++G +P
Sbjct: 519 GGLPKQLSDLPHLVRFNISHNQLSGDLP 546

[162][TOP]
>UniRef100_A7PH67 Chromosome chr17 scaffold_16, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PH67_VITVI
          Length = 800

 Score =  122 bits (307), Expect = 2e-26
 Identities = 75/194 (38%), Positives = 111/194 (57%), Gaps = 2/194 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           PMS+  +SGL  L L +NQ+ G +P + G LR L    +S+NQL G+IP  +  +  L  
Sbjct: 241 PMSLGDLSGLKSLQLFDNQLSGPIPQEMGNLRSLVDLEISQNQLNGSIPTLLGNLINLEI 300

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N+++ SIP  +GK+  L  L++D N ++G IP+    +T + +LNLS N   G I
Sbjct: 301 LYLRDNKLSSSIPPEIGKLHKLVELEIDTNQLSGSIPADFGISTQLTVLNLSSNHLVGEI 360

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLD 536
           P   GS S    L L+ N+L+G +P  L     +G+LD+S N L G+IP  +G+  D L+
Sbjct: 361 PKKLGSVSSLWKLILNDNRLSGNIPPELGSLADLGYLDLSGNRLNGSIPEHLGNCLD-LN 419

Query: 537 AASFSNNDCLCGNP 578
             + SNN    G P
Sbjct: 420 YLNLSNNKLSHGIP 433

 Score =  107 bits (268), Expect = 5e-22
 Identities = 67/194 (34%), Positives = 99/194 (51%), Gaps = 9/194 (4%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I ++  L+ L++  NQ+ G +P+DFG   +L+   LS N L+G IP  +  ++ L  
Sbjct: 313 PPEIGKLHKLVELEIDTNQLSGSIPADFGISTQLTVLNLSSNHLVGEIPKKLGSVSSLWK 372

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L+ NR++G+IP  LG +  L  L L GN + G IP  L +   +  LNLS N     I
Sbjct: 373 LILNDNRLSGNIPPELGSLADLGYLDLSGNRLNGSIPEHLGNCLDLNYLNLSNNKLSHGI 432

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHL---------DISNNHLCGNIPIG 515
           P   G  S+  +LDLS N LTG +P+ +   + +  L         DIS N L G+IP  
Sbjct: 433 PVQMGKLSHLSLLDLSHNLLTGEIPSQIQGLQSLEKLNLSHNNLSVDISYNDLQGSIPNS 492

Query: 516 SPFDHLDAASFSNN 557
             F ++       N
Sbjct: 493 EAFQNVTIEVLQGN 506

 Score =  106 bits (265), Expect = 1e-21
 Identities = 65/171 (38%), Positives = 92/171 (53%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +S L +LDLS NQ  G +PS+ G L  L    L  NQL G+IP  + ++  L D
Sbjct: 119 PPQIGFLSKLKYLDLSTNQFSGRIPSEIGLLTNLEVLHLVENQLNGSIPHEIGQLKSLCD 178

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL--LSNTGMGILNLSRNGFEG 356
           L L  N++ G+IP  LG +  L+ L LD N ++G IP  +  L+   +  L+LS N   G
Sbjct: 179 LSLYTNKLEGTIPASLGNLSNLTNLYLDENKLSGLIPPEMGNLTKLHLRNLSLSSNYLSG 238

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            IP   G  S    L L  N+L+G +P  +   + +  L+IS N L G+IP
Sbjct: 239 PIPMSLGDLSGLKSLQLFDNQLSGPIPQEMGNLRSLVDLEISQNQLNGSIP 289

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 61/169 (36%), Positives = 90/169 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +  +  L  L L +N++   +P + GKL KL    +  NQL G+IP       +L  
Sbjct: 289 PTLLGNLINLEILYLRDNKLSSSIPPEIGKLHKLVELEIDTNQLSGSIPADFGISTQLTV 348

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LS N + G IP +LG +  L  L L+ N ++G IP  L S   +G L+LS N   G+I
Sbjct: 349 LNLSSNHLVGEIPKKLGSVSSLWKLILNDNRLSGNIPPELGSLADLGYLDLSGNRLNGSI 408

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P+  G+      L+LS NKL+  +P  + K   +  LD+S+N L G IP
Sbjct: 409 PEHLGNCLDLNYLNLSNNKLSHGIPVQMGKLSHLSLLDLSHNLLTGEIP 457

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 57/171 (33%), Positives = 90/171 (52%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLS--RALLSRNQLIGTIPDSVLKMNRL 176
           P S+  +S L +L L  N++ G +P + G L KL      LS N L G IP S+  ++ L
Sbjct: 191 PASLGNLSNLTNLYLDENKLSGLIPPEMGNLTKLHLRNLSLSSNYLSGPIPMSLGDLSGL 250

Query: 177 ADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEG 356
             L L  N+++G IP  +G +R L  L++  N + G IP+ L +   + IL L  N    
Sbjct: 251 KSLQLFDNQLSGPIPQEMGNLRSLVDLEISQNQLNGSIPTLLGNLINLEILYLRDNKLSS 310

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +IP   G     + L++  N+L+G +P     +  +  L++S+NHL G IP
Sbjct: 311 SIPPEIGKLHKLVELEIDTNQLSGSIPADFGISTQLTVLNLSSNHLVGEIP 361

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 56/162 (34%), Positives = 83/162 (51%), Gaps = 2/162 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L + D++ N++ G +P   G L KL    LS NQ  G IP  +  +  L  L L  N++ 
Sbjct: 104 LAYFDINMNKLSGPIPPQIGFLSKLKYLDLSTNQFSGRIPSEIGLLTNLEVLHLVENQLN 163

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG--SK 383
           GSIP  +G+++ L  L L  N + G IP++L + + +  L L  N   G IP   G  +K
Sbjct: 164 GSIPHEIGQLKSLCDLSLYTNKLEGTIPASLGNLSNLTNLYLDENKLSGLIPPEMGNLTK 223

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +   L LS N L+G +P SL     +  L + +N L G IP
Sbjct: 224 LHLRNLSLSSNYLSGPIPMSLGDLSGLKSLQLFDNQLSGPIP 265

 Score = 77.8 bits (190), Expect = 6e-13
 Identities = 52/168 (30%), Positives = 86/168 (51%), Gaps = 3/168 (1%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPS-DFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLS 194
           +   ++ ++L++  +IG L    F     L+   ++ N+L G IP  +  +++L  LDLS
Sbjct: 75  KAGSVIRINLTDLGLIGTLQDFSFSSFPNLAYFDINMNKLSGPIPPQIGFLSKLKYLDLS 134

Query: 195 MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVF 374
            N+ +G IP  +G +  L  L L  N + G IP  +     +  L+L  N  EGTIP   
Sbjct: 135 TNQFSGRIPSEIGLLTNLEVLHLVENQLNGSIPHEIGQLKSLCDLSLYTNKLEGTIPASL 194

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAK--FMGHLDISNNHLCGNIPI 512
           G+ S    L L  NKL+G +P  +       + +L +S+N+L G IP+
Sbjct: 195 GNLSNLTNLYLDENKLSGLIPPEMGNLTKLHLRNLSLSSNYLSGPIPM 242

[163][TOP]
>UniRef100_A7PCW5 Chromosome chr17 scaffold_12, whole genome shotgun sequence n=1
            Tax=Vitis vinifera RepID=A7PCW5_VITVI
          Length = 974

 Score =  122 bits (307), Expect = 2e-26
 Identities = 82/208 (39%), Positives = 109/208 (52%), Gaps = 25/208 (12%)
 Frame = +3

Query: 30   LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
            L H+ L+NNQ IG +PS  G L+KL    LS N   GT+P ++   + L  L L+ N ++
Sbjct: 648  LEHVLLNNNQFIGMIPSWLGGLQKLGELDLSFNFFHGTVPAALGNCSILLKLSLNDNSLS 707

Query: 210  GSIPVRLGKMRVLSTLKLDGNSMTGQIPST-----------LLSNTGMG----------- 323
            G IP  +G +  L+ L L  N+++GQIPST           L  N   G           
Sbjct: 708  GEIPPEMGNLTSLNVLDLQRNNLSGQIPSTFQQCKKLYELRLSENMLTGSIPSELGTLTE 767

Query: 324  ---ILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHL 494
               IL+LSRN F G IP   G+      L++SFN+L G VP+SL K   +  LD+SNNHL
Sbjct: 768  LQVILDLSRNLFSGEIPSSLGNLMKLESLNISFNQLQGEVPSSLGKLTSLHLLDLSNNHL 827

Query: 495  CGNIPIGSPFDHLDAASFSNNDCLCGNP 578
             G +P  S F     +SF  ND LCG P
Sbjct: 828  RGQLP--STFSEFPLSSFMLNDKLCGPP 853

 Score =  108 bits (270), Expect = 3e-22
 Identities = 60/169 (35%), Positives = 94/169 (55%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ ++  S +  LDLS+N+  G LP +  KL  L+  LL+ N   G +P  +  M+ L  
Sbjct: 352 PLELLNCSSIQQLDLSDNRFEGVLPPELEKLENLTDLLLNNNSFSGKLPPEIGNMSSLET 411

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N ITG+IPV LGK++ LS++ L  N ++G IP  L + + +  ++   N F G+I
Sbjct: 412 LYLFDNMITGNIPVELGKLQKLSSIYLYDNQLSGSIPRELTNCSSLSEIDFFGNHFMGSI 471

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G     + L L  N L+G +P SL   K +  L +++N L G++P
Sbjct: 472 PATIGKLRNLVFLQLRQNDLSGPIPPSLGYCKKLHTLTLADNKLSGSLP 520

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 64/185 (34%), Positives = 93/185 (50%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +S L  L L +N I G +P + GKL+KLS   L  NQL G+IP  +   + L++
Sbjct: 400 PPEIGNMSSLETLYLFDNMITGNIPVELGKLQKLSSIYLYDNQLSGSIPRELTNCSSLSE 459

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +D   N   GSIP  +GK+R L  L+L  N ++G IP +L     +  L L+ N   G++
Sbjct: 460 IDFFGNHFMGSIPATIGKLRNLVFLQLRQNDLSGPIPPSLGYCKKLHTLTLADNKLSGSL 519

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P  F   S   +  L  N   G +P SL   K +G ++ S+N   G+I      D L   
Sbjct: 520 PPTFRFLSELHLFSLYNNSFEGPLPESLFLLKKLGIINFSHNRFSGSILPLLGSDFLTLL 579

Query: 543 SFSNN 557
             +NN
Sbjct: 580 DLTNN 584

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 56/157 (35%), Positives = 79/157 (50%)
 Frame = +3

Query: 39   LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
            LDL+NN   G +PS     + L+R  L+ N L G I     ++  L  LDLS N  TG +
Sbjct: 579  LDLTNNSFSGPIPSRLAMSKNLTRLRLAHNLLTGNISSEFGQLKELKFLDLSFNNFTGEV 638

Query: 219  PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
               L   + L  + L+ N   G IPS L     +G L+LS N F GT+P   G+ S  + 
Sbjct: 639  APELSNCKKLEHVLLNNNQFIGMIPSWLGGLQKLGELDLSFNFFHGTVPAALGNCSILLK 698

Query: 399  LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L L+ N L+G +P  +     +  LD+  N+L G IP
Sbjct: 699  LSLNDNSLSGEIPPEMGNLTSLNVLDLQRNNLSGQIP 735

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 60/169 (35%), Positives = 84/169 (49%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+     L  L L++N++ G LP  F  L +L    L  N   G +P+S+  + +L  
Sbjct: 496 PPSLGYCKKLHTLTLADNKLSGSLPPTFRFLSELHLFSLYNNSFEGPLPESLFLLKKLGI 555

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           ++ S NR +GSI   LG    L+ L L  NS +G IPS L  +  +  L L+ N   G I
Sbjct: 556 INFSHNRFSGSILPLLGS-DFLTLLDLTNNSFSGPIPSRLAMSKNLTRLRLAHNLLTGNI 614

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              FG       LDLSFN  TG V   L+  K + H+ ++NN   G IP
Sbjct: 615 SSEFGQLKELKFLDLSFNNFTGEVAPELSNCKKLEHVLLNNNQFIGMIP 663

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 58/195 (29%), Positives = 97/195 (49%), Gaps = 4/195 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L  L + +N + GE+    G L++L    L+  QL G+IP  +  +  L  
Sbjct: 135 PTEICLLKKLQVLRIGDNMLAGEITPSIGNLKELRVLGLAYCQLNGSIPAEIGNLKNLKF 194

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDL  N ++  IP  +     L       N + G+IP+++ +   + ILNL+ N   G+I
Sbjct: 195 LDLQKNSLSSVIPEEIQGCVELQNFAASNNKLEGEIPASMGNLKSLQILNLANNSLSGSI 254

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP-IGSPFDHLDA 539
           P   G  S    L+L  N+L+G +P+ L +   +  LD+S+N+L G I  + +    L+ 
Sbjct: 255 PIELGGLSNLKYLNLLGNRLSGMIPSELNQLDQLQKLDLSSNNLSGTINFLNTQLKSLEV 314

Query: 540 ASFSNN---DCLCGN 575
            + S+N   D + GN
Sbjct: 315 LALSDNLLTDSIPGN 329

 Score = 86.3 bits (212), Expect = 2e-15
 Identities = 51/164 (31%), Positives = 79/164 (48%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           ++ L  LDLS N   G +P + G L+ L   LL  N L G IP  +  + +L  L +  N
Sbjct: 93  LTSLQTLDLSLNAFAGSIPHELGLLQNLRELLLYSNYLSGKIPTEICLLKKLQVLRIGDN 152

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
            + G I   +G ++ L  L L    + G IP+ + +   +  L+L +N     IP+    
Sbjct: 153 MLAGEITPSIGNLKELRVLGLAYCQLNGSIPAEIGNLKNLKFLDLQKNSLSSVIPEEIQG 212

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
                    S NKL G +P S+   K +  L+++NN L G+IPI
Sbjct: 213 CVELQNFAASNNKLEGEIPASMGNLKSLQILNLANNSLSGSIPI 256

 Score = 85.1 bits (209), Expect = 4e-15
 Identities = 51/165 (30%), Positives = 82/165 (49%), Gaps = 1/165 (0%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDF-GKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLS 194
           ++  L  L LS+N +   +P +F      L +  L++N+L GT P  +L  + +  LDLS
Sbjct: 308 QLKSLEVLALSDNLLTDSIPGNFCTSSSSLRQIFLAQNKLSGTFPLELLNCSSIQQLDLS 367

Query: 195 MNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVF 374
            NR  G +P  L K+  L+ L L+ NS +G++P  + + + +  L L  N   G IP   
Sbjct: 368 DNRFEGVLPPELEKLENLTDLLLNNNSFSGKLPPEIGNMSSLETLYLFDNMITGNIPVEL 427

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G       + L  N+L+G +P  L     +  +D   NH  G+IP
Sbjct: 428 GKLQKLSSIYLYDNQLSGSIPRELTNCSSLSEIDFFGNHFMGSIP 472

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 53/161 (32%), Positives = 82/161 (50%), Gaps = 1/161 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L +   SNN++ GE+P+  G L+ L    L+ N L G+IP  +  ++ L  L+L  NR++
Sbjct: 216 LQNFAASNNKLEGEIPASMGNLKSLQILNLANNSLSGSIPIELGGLSNLKYLNLLGNRLS 275

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVF-GSKS 386
           G IP  L ++  L  L L  N+++G I         + +L LS N    +IP  F  S S
Sbjct: 276 GMIPSELNQLDQLQKLDLSSNNLSGTINFLNTQLKSLEVLALSDNLLTDSIPGNFCTSSS 335

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
               + L+ NKL+G  P  L     +  LD+S+N   G +P
Sbjct: 336 SLRQIFLAQNKLSGTFPLELLNCSSIQQLDLSDNRFEGVLP 376

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 48/162 (29%), Positives = 75/162 (46%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L  + L+ N++ G  P +      + +  LS N+  G +P  + K+  L DL L+ N 
Sbjct: 335 SSLRQIFLAQNKLSGTFPLELLNCSSIQQLDLSDNRFEGVLPPELEKLENLTDLLLNNNS 394

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
            +G +P  +G M  L TL L  N +TG IP  L     +  + L  N   G+IP    + 
Sbjct: 395 FSGKLPPEIGNMSSLETLYLFDNMITGNIPVELGKLQKLSSIYLYDNQLSGSIPRELTNC 454

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           S    +D   N   G +P ++ K + +  L +  N L G IP
Sbjct: 455 SSLSEIDFFGNHFMGSIPATIGKLRNLVFLQLRQNDLSGPIP 496

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 44/160 (27%), Positives = 76/160 (47%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           ++ L LS + + G +  +F  L  L    LS N   G+IP  +  +  L +L L  N ++
Sbjct: 72  IIGLSLSGSGLSGSISPEFSHLTSLQTLDLSLNAFAGSIPHELGLLQNLRELLLYSNYLS 131

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G IP  +  ++ L  L++  N + G+I  ++ +   + +L L+     G+IP   G+   
Sbjct: 132 GKIPTEICLLKKLQVLRIGDNMLAGEITPSIGNLKELRVLGLAYCQLNGSIPAEIGNLKN 191

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              LDL  N L+  +P  +     + +   SNN L G IP
Sbjct: 192 LKFLDLQKNSLSSVIPEEIQGCVELQNFAASNNKLEGEIP 231

[164][TOP]
>UniRef100_A3AHP3 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=A3AHP3_ORYSJ
          Length = 971

 Score =  122 bits (307), Expect = 2e-26
 Identities = 69/178 (38%), Positives = 105/178 (58%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           +DLS+N   G +PS+  ++  L    +S N L G+IP S+++M  L  LDL+ NR+ GSI
Sbjct: 391 VDLSSNAFSGMIPSEISQVITLQSLNMSWNSLSGSIPPSIVQMKSLEVLDLTANRLNGSI 450

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  +G    L  L+L  NS+TG+IP+ + + + +  L+LS N   G IP    + +    
Sbjct: 451 PATVGG-ESLRELRLAKNSLTGEIPAQIGNLSALASLDLSHNNLTGAIPATIANITNLQT 509

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
           +DLS NKLTG +P  L+    +   +IS+N L G++P GS FD +  +S S+N  LCG
Sbjct: 510 VDLSRNKLTGGLPKQLSDLPHLVRFNISHNQLSGDLPPGSFFDTIPLSSVSDNPGLCG 567

 Score =  106 bits (265), Expect = 1e-21
 Identities = 60/170 (35%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDF-GKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  + R+  L  LDLS N   G +P  F G  R L    L+ N   G +P  V     LA
Sbjct: 115 PADLARLPDLQSLDLSANAFSGAIPDGFFGHCRNLRDVSLANNAFSGDVPRDVGACATLA 174

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L+LS NR+ G++P  +  +  L TL L GN++TG +P  +     +  LNL  N   G+
Sbjct: 175 SLNLSSNRLAGALPSDIWSLNALRTLDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLAGS 234

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           +PD  G       +DL  N ++G +P SL +     +LD+S+N L GN+P
Sbjct: 235 LPDDIGDCPLLRSVDLGSNNISGNLPESLRRLSTCTYLDLSSNALTGNVP 284

 Score =  106 bits (265), Expect = 1e-21
 Identities = 58/168 (34%), Positives = 94/168 (55%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ + R+  L  L+L +N++ G LP D G    L    L  N + G +P+S+ +++    
Sbjct: 212 PVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLRRLSTCTY 271

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N +TG++P  +G+M  L TL L GN  +G+IP ++     +  L LS NGF G +
Sbjct: 272 LDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIPGSIGGLMSLKELRLSGNGFTGGL 331

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P+  G     + +D+S+N LTG +P S   A  +  + +S+N L G +
Sbjct: 332 PESIGGCKSLVHVDVSWNSLTGTLP-SWVFASGVQWVSVSDNTLSGEV 378

 Score =  102 bits (254), Expect = 2e-20
 Identities = 58/169 (34%), Positives = 87/169 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  ++ L  LDLS N I G+LP    ++  L    L  N+L G++PD +     L  
Sbjct: 188 PSDIWSLNALRTLDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRS 247

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +DL  N I+G++P  L ++   + L L  N++TG +P+ +     +  L+LS N F G I
Sbjct: 248 VDLGSNNISGNLPESLRRLSTCTYLDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEI 307

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G       L LS N  TG +P S+   K + H+D+S N L G +P
Sbjct: 308 PGSIGGLMSLKELRLSGNGFTGGLPESIGGCKSLVHVDVSWNSLTGTLP 356

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 56/169 (33%), Positives = 87/169 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  +   + L  L+LS+N++ G LPSD   L  L    LS N + G +P  V +M  L  
Sbjct: 164 PRDVGACATLASLNLSSNRLAGALPSDIWSLNALRTLDLSGNAITGDLPVGVSRMFNLRS 223

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L  NR+ GS+P  +G   +L ++ L  N+++G +P +L   +    L+LS N   G +
Sbjct: 224 LNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLRRLSTCTYLDLSSNALTGNV 283

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G  +    LDLS NK +G +P S+     +  L +S N   G +P
Sbjct: 284 PTWVGEMASLETLDLSGNKFSGEIPGSIGGLMSLKELRLSGNGFTGGLP 332

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 56/160 (35%), Positives = 81/160 (50%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  + L+NN   G++P D G    L+   LS N+L G +P  +  +N L  LDLS N IT
Sbjct: 149 LRDVSLANNAFSGDVPRDVGACATLASLNLSSNRLAGALPSDIWSLNALRTLDLSGNAIT 208

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G +PV + +M  L +L L  N + G +P  +     +  ++L  N   G +P+     S 
Sbjct: 209 GDLPVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLRRLST 268

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              LDLS N LTG VP  + +   +  LD+S N   G IP
Sbjct: 269 CTYLDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIP 308

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 50/165 (30%), Positives = 82/165 (49%), Gaps = 1/165 (0%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           R++GL    L+   + G+L     +L  L    LS N   G +P  + ++  L  LDLS 
Sbjct: 75  RVAGL---SLACFGLSGKLGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQSLDLSA 131

Query: 198 NRITGSIPVR-LGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVF 374
           N  +G+IP    G  R L  + L  N+ +G +P  + +   +  LNLS N   G +P   
Sbjct: 132 NAFSGAIPDGFFGHCRNLRDVSLANNAFSGDVPRDVGACATLASLNLSSNRLAGALPSDI 191

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            S +    LDLS N +TG +P  +++   +  L++ +N L G++P
Sbjct: 192 WSLNALRTLDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLAGSLP 236

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 42/144 (29%), Positives = 74/144 (51%), Gaps = 1/144 (0%)
 Frame = +3

Query: 87  GKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLD 266
           G++  LS A      L G +   +L++  L  L LS N  +G +P  L ++  L +L L 
Sbjct: 74  GRVAGLSLACFG---LSGKLGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQSLDLS 130

Query: 267 GNSMTGQIPSTLLSNT-GMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNS 443
            N+ +G IP     +   +  ++L+ N F G +P   G+ +    L+LS N+L G +P+ 
Sbjct: 131 ANAFSGAIPDGFFGHCRNLRDVSLANNAFSGDVPRDVGACATLASLNLSSNRLAGALPSD 190

Query: 444 LAKAKFMGHLDISNNHLCGNIPIG 515
           +     +  LD+S N + G++P+G
Sbjct: 191 IWSLNALRTLDLSGNAITGDLPVG 214

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 30/88 (34%), Positives = 48/88 (54%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L L+ N + GE+P+  G L  L+   LS N L G IP ++  +  L  +DLS N++T
Sbjct: 459 LRELRLAKNSLTGEIPAQIGNLSALASLDLSHNNLTGAIPATIANITNLQTVDLSRNKLT 518

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIP 293
           G +P +L  +  L    +  N ++G +P
Sbjct: 519 GGLPKQLSDLPHLVRFNISHNQLSGDLP 546

[165][TOP]
>UniRef100_Q9LY03 Leucine-rich repeat receptor-like protein kinase n=1
           Tax=Arabidopsis thaliana RepID=Q9LY03_ARATH
          Length = 964

 Score =  122 bits (306), Expect = 2e-26
 Identities = 69/184 (37%), Positives = 102/184 (55%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           I  +  LDLS+N   GE+ +  G LR L    LSRN L G IP ++ ++  L+ LD+S N
Sbjct: 375 IKKIQVLDLSHNAFSGEIGAGLGDLRDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHN 434

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           ++ G IP   G    L  L+L+ N + G IPS++ + + +  L LS N   G+IP     
Sbjct: 435 QLNGMIPRETGGAVSLEELRLENNLLEGNIPSSIKNCSSLRSLILSHNKLLGSIPPELAK 494

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNND 560
            +    +DLSFN+L G +P  LA   ++   +IS+NHL G +P G  F+ L  +S S N 
Sbjct: 495 LTRLEEVDLSFNELAGTLPKQLANLGYLHTFNISHNHLFGELPAGGIFNGLSPSSVSGNP 554

Query: 561 CLCG 572
            +CG
Sbjct: 555 GICG 558

 Score =  117 bits (294), Expect = 5e-25
 Identities = 64/172 (37%), Positives = 95/172 (55%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+SI   S L  L+LS+N   G +P     L  L    LSRN+L G  P+ + ++N L  
Sbjct: 160 PVSISSCSSLAALNLSSNGFSGSMPLGIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRA 219

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS NR++G IP  +G   +L T+ L  NS++G +P+T    +    LNL +N  EG +
Sbjct: 220 LDLSRNRLSGPIPSEIGSCMLLKTIDLSENSLSGSLPNTFQQLSLCYSLNLGKNALEGEV 279

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGS 518
           P   G       LDLS NK +G+VP+S+     +  L+ S N L G++P+ +
Sbjct: 280 PKWIGEMRSLETLDLSMNKFSGQVPDSIGNLLALKVLNFSGNGLIGSLPVST 331

 Score =  102 bits (254), Expect = 2e-20
 Identities = 59/170 (34%), Positives = 90/170 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ I  ++ L  LDLS N++ GE P    +L  L    LSRN+L G IP  +     L  
Sbjct: 184 PLGIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCMLLKT 243

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +DLS N ++GS+P    ++ +  +L L  N++ G++P  +     +  L+LS N F G +
Sbjct: 244 IDLSENSLSGSLPNTFQQLSLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQV 303

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           PD  G+     VL+ S N L G +P S A    +  LD+S N L G +P+
Sbjct: 304 PDSIGNLLALKVLNFSGNGLIGSLPVSTANCINLLALDLSGNSLTGKLPM 353

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 60/173 (34%), Positives = 92/173 (53%), Gaps = 4/173 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDF----GKLRKLSRALLSRNQLIGTIPDSVLKMN 170
           P  ++ +  L  +DLS+N + G LP +F    G LR LS   L++N+L G IP S+   +
Sbjct: 111 PNMLLSLVNLKVVDLSSNGLSGSLPDEFFRQCGSLRVLS---LAKNKLTGKIPVSISSCS 167

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
            LA L+LS N  +GS+P+ +  +  L +L L  N + G+ P  +     +  L+LSRN  
Sbjct: 168 SLAALNLSSNGFSGSMPLGIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRL 227

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G IP   GS      +DLS N L+G +PN+  +      L++  N L G +P
Sbjct: 228 SGPIPSEIGSCMLLKTIDLSENSLSGSLPNTFQQLSLCYSLNLGKNALEGEVP 280

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 63/186 (33%), Positives = 94/186 (50%), Gaps = 17/186 (9%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +  ++S    L+L  N + GE+P   G++R L    LS N+  G +PDS+  +  L  
Sbjct: 256 PNTFQQLSLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQVPDSIGNLLALKV 315

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLL-------------SNTG-- 317
           L+ S N + GS+PV       L  L L GNS+TG++P  L              ++TG  
Sbjct: 316 LNFSGNGLIGSLPVSTANCINLLALDLSGNSLTGKLPMWLFQDGSRDVSALKNDNSTGGI 375

Query: 318 --MGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
             + +L+LS N F G I    G       L LS N LTG +P+++ + K +  LD+S+N 
Sbjct: 376 KKIQVLDLSHNAFSGEIGAGLGDLRDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHNQ 435

Query: 492 LCGNIP 509
           L G IP
Sbjct: 436 LNGMIP 441

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 63/186 (33%), Positives = 87/186 (46%), Gaps = 17/186 (9%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L  LDLS N+  G++P   G L  L     S N LIG++P S      L  
Sbjct: 280 PKWIGEMRSLETLDLSMNKFSGQVPDSIGNLLALKVLNFSGNGLIGSLPVSTANCINLLA 339

Query: 183 LDLSMNRITGSIPVRL-----------------GKMRVLSTLKLDGNSMTGQIPSTLLSN 311
           LDLS N +TG +P+ L                 G ++ +  L L  N+ +G+I + L   
Sbjct: 340 LDLSGNSLTGKLPMWLFQDGSRDVSALKNDNSTGGIKKIQVLDLSHNAFSGEIGAGLGDL 399

Query: 312 TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
             +  L+LSRN   G IP   G   +  VLD+S N+L G +P     A  +  L + NN 
Sbjct: 400 RDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHNQLNGMIPRETGGAVSLEELRLENNL 459

Query: 492 LCGNIP 509
           L GNIP
Sbjct: 460 LEGNIP 465

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 42/120 (35%), Positives = 73/120 (60%), Gaps = 2/120 (1%)
 Frame = +3

Query: 162 KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQI-PSTLLSNTGMGILNLS 338
           + NR+ +L+L    ++G I   L +++ L  L L  N++TG I P+ LLS   + +++LS
Sbjct: 67  RTNRVTELNLDGFSLSGRIGRGLLQLQFLHKLSLSNNNLTGIINPNMLLSLVNLKVVDLS 126

Query: 339 RNGFEGTIPDVFGSK-SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
            NG  G++PD F  +     VL L+ NKLTG++P S++    +  L++S+N   G++P+G
Sbjct: 127 SNGLSGSLPDEFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNGFSGSMPLG 186

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 31/90 (34%), Positives = 47/90 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI   S L  L LS+N+++G +P +  KL +L    LS N+L GT+P  +  +  L  
Sbjct: 465 PSSIKNCSSLRSLILSHNKLLGSIPPELAKLTRLEEVDLSFNELAGTLPKQLANLGYLHT 524

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGN 272
            ++S N + G +P   G    LS   + GN
Sbjct: 525 FNISHNHLFGELPAG-GIFNGLSPSSVSGN 553

[166][TOP]
>UniRef100_Q8VYT7 Putative uncharacterized protein At3g56370 n=1 Tax=Arabidopsis
           thaliana RepID=Q8VYT7_ARATH
          Length = 964

 Score =  122 bits (306), Expect = 2e-26
 Identities = 69/184 (37%), Positives = 102/184 (55%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           I  +  LDLS+N   GE+ +  G LR L    LSRN L G IP ++ ++  L+ LD+S N
Sbjct: 375 IKKIQVLDLSHNAFSGEIGAGLGDLRDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHN 434

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           ++ G IP   G    L  L+L+ N + G IPS++ + + +  L LS N   G+IP     
Sbjct: 435 QLNGMIPRETGGAVSLEELRLENNLLEGNIPSSIKNCSSLRSLILSHNKLLGSIPPELAK 494

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNND 560
            +    +DLSFN+L G +P  LA   ++   +IS+NHL G +P G  F+ L  +S S N 
Sbjct: 495 LTRLEEVDLSFNELAGTLPKQLANLGYLHTFNISHNHLFGELPAGGIFNGLSPSSVSGNP 554

Query: 561 CLCG 572
            +CG
Sbjct: 555 GICG 558

 Score =  117 bits (294), Expect = 5e-25
 Identities = 64/172 (37%), Positives = 95/172 (55%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+SI   S L  L+LS+N   G +P     L  L    LSRN+L G  P+ + ++N L  
Sbjct: 160 PVSISSCSSLAALNLSSNGFSGSMPLGIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRA 219

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS NR++G IP  +G   +L T+ L  NS++G +P+T    +    LNL +N  EG +
Sbjct: 220 LDLSRNRLSGPIPSEIGSCMLLKTIDLSENSLSGSLPNTFQQLSLCYSLNLGKNALEGEV 279

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGS 518
           P   G       LDLS NK +G+VP+S+     +  L+ S N L G++P+ +
Sbjct: 280 PKWIGEMRSLETLDLSMNKFSGQVPDSIGNLLALKVLNFSGNGLIGSLPVST 331

 Score =  102 bits (254), Expect = 2e-20
 Identities = 59/170 (34%), Positives = 90/170 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ I  ++ L  LDLS N++ GE P    +L  L    LSRN+L G IP  +     L  
Sbjct: 184 PLGIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCMLLKT 243

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +DLS N ++GS+P    ++ +  +L L  N++ G++P  +     +  L+LS N F G +
Sbjct: 244 IDLSENSLSGSLPNTFQQLSLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQV 303

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           PD  G+     VL+ S N L G +P S A    +  LD+S N L G +P+
Sbjct: 304 PDSIGNLLALKVLNFSGNGLIGSLPVSTANCINLLALDLSGNSLTGKLPM 353

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 60/173 (34%), Positives = 92/173 (53%), Gaps = 4/173 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDF----GKLRKLSRALLSRNQLIGTIPDSVLKMN 170
           P  ++ +  L  +DLS+N + G LP +F    G LR LS   L++N+L G IP S+   +
Sbjct: 111 PNMLLSLVNLKVVDLSSNGLSGSLPDEFFRQCGSLRVLS---LAKNKLTGKIPVSISSCS 167

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
            LA L+LS N  +GS+P+ +  +  L +L L  N + G+ P  +     +  L+LSRN  
Sbjct: 168 SLAALNLSSNGFSGSMPLGIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRL 227

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G IP   GS      +DLS N L+G +PN+  +      L++  N L G +P
Sbjct: 228 SGPIPSEIGSCMLLKTIDLSENSLSGSLPNTFQQLSLCYSLNLGKNALEGEVP 280

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 63/186 (33%), Positives = 94/186 (50%), Gaps = 17/186 (9%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P +  ++S    L+L  N + GE+P   G++R L    LS N+  G +PDS+  +  L  
Sbjct: 256 PNTFQQLSLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQVPDSIGNLLALKV 315

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLL-------------SNTG-- 317
           L+ S N + GS+PV       L  L L GNS+TG++P  L              ++TG  
Sbjct: 316 LNFSGNGLIGSLPVSTANCINLLALDLSGNSLTGKLPMWLFQDGSRDVSALKNDNSTGGI 375

Query: 318 --MGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
             + +L+LS N F G I    G       L LS N LTG +P+++ + K +  LD+S+N 
Sbjct: 376 KKIQVLDLSHNAFSGEIGAGLGDLRDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHNQ 435

Query: 492 LCGNIP 509
           L G IP
Sbjct: 436 LNGMIP 441

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 63/186 (33%), Positives = 87/186 (46%), Gaps = 17/186 (9%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L  LDLS N+  G++P   G L  L     S N LIG++P S      L  
Sbjct: 280 PKWIGEMRSLETLDLSMNKFSGQVPDSIGNLLALKVLNFSGNGLIGSLPVSTANCINLLA 339

Query: 183 LDLSMNRITGSIPVRL-----------------GKMRVLSTLKLDGNSMTGQIPSTLLSN 311
           LDLS N +TG +P+ L                 G ++ +  L L  N+ +G+I + L   
Sbjct: 340 LDLSGNSLTGKLPMWLFQDGSRDVSALKNDNSTGGIKKIQVLDLSHNAFSGEIGAGLGDL 399

Query: 312 TGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNH 491
             +  L+LSRN   G IP   G   +  VLD+S N+L G +P     A  +  L + NN 
Sbjct: 400 RDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHNQLNGMIPRETGGAVSLEELRLENNL 459

Query: 492 LCGNIP 509
           L GNIP
Sbjct: 460 LEGNIP 465

 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 42/120 (35%), Positives = 73/120 (60%), Gaps = 2/120 (1%)
 Frame = +3

Query: 162 KMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQI-PSTLLSNTGMGILNLS 338
           + NR+ +L+L    ++G I   L +++ L  L L  N++TG I P+ LLS   + +++LS
Sbjct: 67  RTNRVTELNLDGFSLSGRIGRGLLQLQFLHKLSLSNNNLTGIINPNMLLSLVNLKVVDLS 126

Query: 339 RNGFEGTIPDVFGSK-SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
            NG  G++PD F  +     VL L+ NKLTG++P S++    +  L++S+N   G++P+G
Sbjct: 127 SNGLSGSLPDEFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNGFSGSMPLG 186

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 31/90 (34%), Positives = 47/90 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI   S L  L LS+N+++G +P +  KL +L    LS N+L GT+P  +  +  L  
Sbjct: 465 PSSIKNCSSLRSLILSHNKLLGSIPPELAKLTRLEEVDLSFNELAGTLPKQLANLGYLHT 524

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGN 272
            ++S N + G +P   G    LS   + GN
Sbjct: 525 FNISHNHLFGELPAG-GIFNGLSPSSVSGN 553

[167][TOP]
>UniRef100_Q7XWN3 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group
            RepID=Q7XWN3_ORYSJ
          Length = 1343

 Score =  122 bits (306), Expect = 2e-26
 Identities = 68/190 (35%), Positives = 99/190 (52%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I  +  L  L L+NN   G LP+D G L  L   +LS+N +  TIP S+  MN L  
Sbjct: 992  PRQIGHLRNLQTLILNNNNFSGVLPNDLGNLSNLQYLVLSKNHMSSTIPASLFHMNSLIT 1051

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            +DLS N + G++PV +G++  +  + L  N + G+IP +         LNLS N   G+ 
Sbjct: 1052 VDLSQNSLEGALPVDIGQLNHIDRIDLSSNRLFGRIPESFGQFLMTTYLNLSHNSLNGSF 1111

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P+ F        LD+S+N L+G +P  LA    +  L++S N+L G IP G  F ++   
Sbjct: 1112 PNSFDKLINLKSLDVSYNDLSGTIPQYLANFTDLSSLNLSFNNLHGPIPEGGIFANITLQ 1171

Query: 543  SFSNNDCLCG 572
            S   N  LCG
Sbjct: 1172 SLMGNPALCG 1181

 Score =  102 bits (255), Expect = 2e-20
 Identities = 59/162 (36%), Positives = 95/162 (58%)
 Frame = +3

Query: 24   SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
            S L++     N++ G+LPS    L  L    LS NQL GTIP+S++ M++L  L+LS N 
Sbjct: 927  STLINFFAVGNRLSGDLPSTLLNLSNLVWLDLSNNQLTGTIPESIMLMDKLQVLNLSGNI 986

Query: 204  ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
            ++G+IP ++G +R L TL L+ N+ +G +P+ L + + +  L LS+N    TIP      
Sbjct: 987  MSGTIPRQIGHLRNLQTLILNNNNFSGVLPNDLGNLSNLQYLVLSKNHMSSTIPASLFHM 1046

Query: 384  SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +  + +DLS N L G +P  + +   +  +D+S+N L G IP
Sbjct: 1047 NSLITVDLSQNSLEGALPVDIGQLNHIDRIDLSSNRLFGRIP 1088

 Score = 97.4 bits (241), Expect = 7e-19
 Identities = 60/169 (35%), Positives = 86/169 (50%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P SI+ +  L  L+LS N + G +P   G LR L   +L+ N   G +P+ +  ++ L  
Sbjct: 968  PESIMLMDKLQVLNLSGNIMSGTIPRQIGHLRNLQTLILNNNNFSGVLPNDLGNLSNLQY 1027

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L LS N ++ +IP  L  M  L T+ L  NS+ G +P  +     +  ++LS N   G I
Sbjct: 1028 LVLSKNHMSSTIPASLFHMNSLITVDLSQNSLEGALPVDIGQLNHIDRIDLSSNRLFGRI 1087

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            P+ FG       L+LS N L G  PNS  K   +  LD+S N L G IP
Sbjct: 1088 PESFGQFLMTTYLNLSHNSLNGSFPNSFDKLINLKSLDVSYNDLSGTIP 1136

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 57/170 (33%), Positives = 86/170 (50%), Gaps = 2/170 (1%)
 Frame = +3

Query: 54   NQIIGELPSDFGKLRK-LSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRL 230
            N   GELP+  G     L       N+L G +P ++L ++ L  LDLS N++TG+IP  +
Sbjct: 912  NYFTGELPNYVGNFSSTLINFFAVGNRLSGDLPSTLLNLSNLVWLDLSNNQLTGTIPESI 971

Query: 231  GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLS 410
              M  L  L L GN M+G IP  +     +  L L+ N F G +P+  G+ S    L LS
Sbjct: 972  MLMDKLQVLNLSGNIMSGTIPRQIGHLRNLQTLILNNNNFSGVLPNDLGNLSNLQYLVLS 1031

Query: 411  FNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLDAASFSNN 557
             N ++  +P SL     +  +D+S N L G +P+     +H+D    S+N
Sbjct: 1032 KNHMSSTIPASLFHMNSLITVDLSQNSLEGALPVDIGQLNHIDRIDLSSN 1081

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 55/165 (33%), Positives = 83/165 (50%), Gaps = 2/165 (1%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  L+L++  + G +P+D GKL +L   +  RN L G IP  V  + RL  +D+  N
Sbjct: 105 LSFLTVLNLTSTGLTGAIPADLGKLHRLEVLVFRRNSLSGVIPPVVGNLTRLEVVDMGHN 164

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFG 377
            I+G IP+ L K+  L+ +    N +TG +P+ L SN   +  L+   N   GT+P   G
Sbjct: 165 SISGQIPLELQKLHNLTHIDFITNYLTGPLPNDLFSNNSKLQYLDFGNNSLTGTLPYSVG 224

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNN-HLCGNIP 509
           S      LD   N  +G VP ++     +  L +  N  L G IP
Sbjct: 225 SLGMLQHLDFQANHFSGPVPTTILNMSKLQILSLGGNWGLTGTIP 269

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 55/173 (31%), Positives = 82/173 (47%), Gaps = 4/173 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSD-FGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P+ + ++  L H+D   N + G LP+D F    KL       N L GT+P SV  +  L 
Sbjct: 171 PLELQKLHNLTHIDFITNYLTGPLPNDLFSNNSKLQYLDFGNNSLTGTLPYSVGSLGMLQ 230

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGN-SMTGQIP--STLLSNTGMGILNLSRNGF 350
            LD   N  +G +P  +  M  L  L L GN  +TG IP  +   +   + +++L  N F
Sbjct: 231 HLDFQANHFSGPVPTTILNMSKLQILSLGGNWGLTGTIPGNNNTFNLPMLQMISLFANRF 290

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G IP    +  Y  ++ +  N   G VP  L+K   +  LD+  N+L G IP
Sbjct: 291 TGQIPLGLANCKYIQIISIGENSFEGPVPTWLSKLPDLLLLDLGYNNLIGQIP 343

 Score = 80.9 bits (198), Expect = 7e-14
 Identities = 51/172 (29%), Positives = 81/172 (47%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQ-LIGTIP--DSVLKMNR 173
           P S+  +  L HLD   N   G +P+    + KL    L  N  L GTIP  ++   +  
Sbjct: 220 PYSVGSLGMLQHLDFQANHFSGPVPTTILNMSKLQILSLGGNWGLTGTIPGNNNTFNLPM 279

Query: 174 LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFE 353
           L  + L  NR TG IP+ L   + +  + +  NS  G +P+ L     + +L+L  N   
Sbjct: 280 LQMISLFANRFTGQIPLGLANCKYIQIISIGENSFEGPVPTWLSKLPDLLLLDLGYNNLI 339

Query: 354 GTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           G IP   G+ +  + L L    L+G +P  L + + +  L + +NH  G+IP
Sbjct: 340 GQIPSALGNITNLVSLGLQSCTLSGLIPQELGQLQQLNALYLDHNHFTGSIP 391

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 49/159 (30%), Positives = 75/159 (47%)
 Frame = +3

Query: 30   LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
            L  + L  N+ +G++P      + L    +  N   G +P  + K+  L  LDL  N + 
Sbjct: 734  LQKICLYENRFMGQIPLGLADCKYLQWIFIGHNLFEGPVPAWLGKLPDLVLLDLESNNLV 793

Query: 210  GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
            G IP  LG +  L TL L   ++TGQIP  L     +  L L  N F G+IP  F + S 
Sbjct: 794  GPIPSALGNLSNLDTLGLQSCNLTGQIPQELAQLRKIKGLFLDHNHFTGSIPTFFANFSE 853

Query: 390  FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
              V  +  N  TG VP ++     +   +I +N+L G++
Sbjct: 854  LAVFLIGANSFTGAVPTAIGSTGSVEWFNIGDNYLQGSL 892

 Score = 77.8 bits (190), Expect = 6e-13
 Identities = 52/196 (26%), Positives = 87/196 (44%), Gaps = 27/196 (13%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++  I+ L+ L L +  + G +P + G+L++L+   L  N   G+IP      + L  
Sbjct: 343 PSALGNITNLVSLGLQSCTLSGLIPQELGQLQQLNALYLDHNHFTGSIPTFFANFSELQV 402

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIP--STLLSNTGMGILNLSRNGFEG 356
             +  N  TGS+P  LG  R +    + GN   G +   +TL +   +  +    N F G
Sbjct: 403 FLIGANSFTGSVPTALGSSRSIEWFNIGGNYQEGSLDFLATLSNCQNIWEVGFDLNDFTG 462

Query: 357 TIPDVFGSKSYFMV-------------------------LDLSFNKLTGRVPNSLAKAKF 461
            +PD  G+ S  ++                         LD+S N+LTG +P S+     
Sbjct: 463 KLPDYVGNFSSTLINFFAEGNKLSGELPSTLSNLSNLVWLDISNNQLTGTIPESIKLMDK 522

Query: 462 MGHLDISNNHLCGNIP 509
           +  L++S N L G+IP
Sbjct: 523 LQLLNLSGNSLSGSIP 538

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 58/205 (28%), Positives = 89/205 (43%), Gaps = 41/205 (20%)
 Frame = +3

Query: 24   SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
            S L++     N++ GELPS    L  L    +S NQL GTIP+S+  M++L  L+LS N 
Sbjct: 473  STLINFFAEGNKLSGELPSTLSNLSNLVWLDISNNQLTGTIPESIKLMDKLQLLNLSGNS 532

Query: 204  ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNT----------------------- 314
            ++GSIP ++G++  L TL L+ N+ +    + + S +                       
Sbjct: 533  LSGSIPRQIGQLWNLQTLILNNNNFSAASRAAVTSQSYAAASWRSHPSRSKAARRRRWPG 592

Query: 315  -----------------GMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNS 443
                              +   N+  N   G IP    +      +DL  N LTG +PN 
Sbjct: 593  QAWSQRMRPTVSPLRRRSLLSQNVGYNSLSGQIPRELQNLRNLRYIDLLVNYLTGPLPND 652

Query: 444  L-AKAKFMGHLDISNNHLCGNIPIG 515
            L      + +L+  NN L G IP+G
Sbjct: 653  LFNNTPKLKYLNFRNNSLSGTIPVG 677

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 51/171 (29%), Positives = 80/171 (46%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRN-QLIGTIP-DSVLKMNRL 176
            P+ I  +  L HL+++ N   G +P     + KL    L  N  L G+IP +    +  L
Sbjct: 675  PVGIGTLPILQHLEIAYNHFSGPVPELIFNMSKLEMLHLGGNGYLDGSIPGNKSFNLPML 734

Query: 177  ADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEG 356
              + L  NR  G IP+ L   + L  + +  N   G +P+ L     + +L+L  N   G
Sbjct: 735  QKICLYENRFMGQIPLGLADCKYLQWIFIGHNLFEGPVPAWLGKLPDLVLLDLESNNLVG 794

Query: 357  TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             IP   G+ S    L L    LTG++P  LA+ + +  L + +NH  G+IP
Sbjct: 795  PIPSALGNLSNLDTLGLQSCNLTGQIPQELAQLRKIKGLFLDHNHFTGSIP 845

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 45/171 (26%), Positives = 78/171 (45%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P+ +     L  + + +N   G +P+  GKL  L    L  N L+G IP ++  ++ L  
Sbjct: 749  PLGLADCKYLQWIFIGHNLFEGPVPAWLGKLPDLVLLDLESNNLVGPIPSALGNLSNLDT 808

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L L    +TG IP  L ++R +  L LD N  TG IP+   + + + +  +  N F G +
Sbjct: 809  LGLQSCNLTGQIPQELAQLRKIKGLFLDHNHFTGSIPTFFANFSELAVFLIGANSFTGAV 868

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
            P   GS       ++  N L G +    +L+  + +  +    N+  G +P
Sbjct: 869  PTAIGSTGSVEWFNIGDNYLQGSLDFLATLSNCQNIWEVGFDLNYFTGELP 919

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 56/196 (28%), Positives = 82/196 (41%), Gaps = 27/196 (13%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSD-FGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
            P  +  +  L ++DL  N + G LP+D F    KL       N L GTIP  +  +  L 
Sbjct: 626  PRELQNLRNLRYIDLLVNYLTGPLPNDLFNNTPKLKYLNFRNNSLSGTIPVGIGTLPILQ 685

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNS-MTGQIPST------------LLSNTGM 320
             L+++ N  +G +P  +  M  L  L L GN  + G IP              L  N  M
Sbjct: 686  HLEIAYNHFSGPVPELIFNMSKLEMLHLGGNGYLDGSIPGNKSFNLPMLQKICLYENRFM 745

Query: 321  GILNL-------------SRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF 461
            G + L               N FEG +P   G     ++LDL  N L G +P++L     
Sbjct: 746  GQIPLGLADCKYLQWIFIGHNLFEGPVPAWLGKLPDLVLLDLESNNLVGPIPSALGNLSN 805

Query: 462  MGHLDISNNHLCGNIP 509
            +  L + + +L G IP
Sbjct: 806  LDTLGLQSCNLTGQIP 821

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 53/220 (24%), Positives = 85/220 (38%), Gaps = 51/220 (23%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ +     +  + +  N   G +P+   KL  L    L  N LIG IP ++  +  L  
Sbjct: 295 PLGLANCKYIQIISIGENSFEGPVPTWLSKLPDLLLLDLGYNNLIGQIPSALGNITNLVS 354

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L    ++G IP  LG+++ L+ L LD N  TG IP+   + + + +  +  N F G++
Sbjct: 355 LGLQSCTLSGLIPQELGQLQQLNALYLDHNHFTGSIPTFFANFSELQVFLIGANSFTGSV 414

Query: 363 PDVFGSKSYFMVLDLSFN------------------------------------------ 416
           P   GS       ++  N                                          
Sbjct: 415 PTALGSSRSIEWFNIGGNYQEGSLDFLATLSNCQNIWEVGFDLNDFTGKLPDYVGNFSST 474

Query: 417 ---------KLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                    KL+G +P++L+    +  LDISNN L G IP
Sbjct: 475 LINFFAEGNKLSGELPSTLSNLSNLVWLDISNNQLTGTIP 514

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 43/151 (28%), Positives = 67/151 (44%), Gaps = 25/151 (16%)
 Frame = +3

Query: 132 LIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSN 311
           L G+I   +  ++ L  L+L+   +TG+IP  LGK+  L  L    NS++G IP  + + 
Sbjct: 94  LQGSISPHLGNLSFLTVLNLTSTGLTGAIPADLGKLHRLEVLVFRRNSLSGVIPPVVGNL 153

Query: 312 TGMGILNLSRNGFEGTIP-------------------------DVFGSKSYFMVLDLSFN 416
           T + ++++  N   G IP                         D+F + S    LD   N
Sbjct: 154 TRLEVVDMGHNSISGQIPLELQKLHNLTHIDFITNYLTGPLPNDLFSNNSKLQYLDFGNN 213

Query: 417 KLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            LTG +P S+     + HLD   NH  G +P
Sbjct: 214 SLTGTLPYSVGSLGMLQHLDFQANHFSGPVP 244

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 39/120 (32%), Positives = 59/120 (49%), Gaps = 2/120 (1%)
 Frame = +3

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           + GSI   LG +  L+ L L    +TG IP+ L     + +L   RN   G IP V G+ 
Sbjct: 94  LQGSISPHLGNLSFLTVLNLTSTGLTGAIPADLGKLHRLEVLVFRRNSLSGVIPPVVGNL 153

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPFDHLDAASFSNN 557
           +   V+D+  N ++G++P  L K   + H+D   N+L G +P  + S    L    F NN
Sbjct: 154 TRLEVVDMGHNSISGQIPLELQKLHNLTHIDFITNYLTGPLPNDLFSNNSKLQYLDFGNN 213

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 46/193 (23%), Positives = 78/193 (40%), Gaps = 41/193 (21%)
 Frame = +3

Query: 54   NQIIGELPSDFGKLRK-LSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRL 230
            N   G+LP   G     L       N+L G +P ++  ++ L  LD+S N++TG+IP  +
Sbjct: 458  NDFTGKLPDYVGNFSSTLINFFAEGNKLSGELPSTLSNLSNLVWLDISNNQLTGTIPESI 517

Query: 231  GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY------- 389
              M  L  L L GNS++G IP  +     +  L L+ N F         S+SY       
Sbjct: 518  KLMDKLQLLNLSGNSLSGSIPRQIGQLWNLQTLILNNNNFSAASRAAVTSQSYAAASWRS 577

Query: 390  ---------------------------------FMVLDLSFNKLTGRVPNSLAKAKFMGH 470
                                              +  ++ +N L+G++P  L   + + +
Sbjct: 578  HPSRSKAARRRRWPGQAWSQRMRPTVSPLRRRSLLSQNVGYNSLSGQIPRELQNLRNLRY 637

Query: 471  LDISNNHLCGNIP 509
            +D+  N+L G +P
Sbjct: 638  IDLLVNYLTGPLP 650

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 53/217 (24%), Positives = 85/217 (39%), Gaps = 42/217 (19%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSV-------- 158
            P SI  +  L  L+LS N + G +P   G+L  L   +L+ N        +V        
Sbjct: 514  PESIKLMDKLQLLNLSGNSLSGSIPRQIGQLWNLQTLILNNNNFSAASRAAVTSQSYAAA 573

Query: 159  --------------------------------LKMNRLADLDLSMNRITGSIPVRLGKMR 242
                                            L+   L   ++  N ++G IP  L  +R
Sbjct: 574  SWRSHPSRSKAARRRRWPGQAWSQRMRPTVSPLRRRSLLSQNVGYNSLSGQIPRELQNLR 633

Query: 243  VLSTLKLDGNSMTGQIPSTLLSNT-GMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNK 419
             L  + L  N +TG +P+ L +NT  +  LN   N   GTIP   G+      L++++N 
Sbjct: 634  NLRYIDLLVNYLTGPLPNDLFNNTPKLKYLNFRNNSLSGTIPVGIGTLPILQHLEIAYNH 693

Query: 420  LTGRVPNSLAKAKFMGHLDI-SNNHLCGNIPIGSPFD 527
             +G VP  +     +  L +  N +L G+IP    F+
Sbjct: 694  FSGPVPELIFNMSKLEMLHLGGNGYLDGSIPGNKSFN 730

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 45/168 (26%), Positives = 80/168 (47%), Gaps = 34/168 (20%)
 Frame = +3

Query: 108  RALLSRN----QLIGTIPDSVLKMNRLADLDLSMNRIT---------------------- 209
            R+LLS+N     L G IP  +  +  L  +DL +N +T                      
Sbjct: 609  RSLLSQNVGYNSLSGQIPRELQNLRNLRYIDLLVNYLTGPLPNDLFNNTPKLKYLNFRNN 668

Query: 210  ---GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF-EGTIPDVFG 377
               G+IPV +G + +L  L++  N  +G +P  + + + + +L+L  NG+ +G+IP   G
Sbjct: 669  SLSGTIPVGIGTLPILQHLEIAYNHFSGPVPELIFNMSKLEMLHLGGNGYLDGSIP---G 725

Query: 378  SKSY----FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +KS+       + L  N+  G++P  LA  K++  + I +N   G +P
Sbjct: 726  NKSFNLPMLQKICLYENRFMGQIPLGLADCKYLQWIFIGHNLFEGPVP 773

[168][TOP]
>UniRef100_Q53QC2 Leucine Rich Repeat family protein, expressed n=1 Tax=Oryza sativa
            Japonica Group RepID=Q53QC2_ORYSJ
          Length = 1102

 Score =  122 bits (306), Expect = 2e-26
 Identities = 73/214 (34%), Positives = 108/214 (50%), Gaps = 24/214 (11%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPS------------------------DFGKLRKLSR 110
            P SI+ +  L+ LDLS N + G +PS                        D G L KL  
Sbjct: 513  PESIMEMENLLQLDLSGNSLAGSVPSNAGMLKSVEKIFLQSNKFSGSLPEDMGNLSKLEY 572

Query: 111  ALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQI 290
             +LS NQL   +P S+ ++N L  LDLS N ++G +PV +G ++ ++ L L  N  TG +
Sbjct: 573  LVLSDNQLSSNVPPSLSRLNSLMKLDLSQNFLSGVLPVGIGDLKQINILDLSTNHFTGSL 632

Query: 291  PSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGH 470
              ++     +  LNLS N F G++PD F + +    LDLS N ++G +P  LA    +  
Sbjct: 633  SDSIGQLQMITYLNLSVNLFNGSLPDSFANLTGLQTLDLSHNNISGTIPKYLANFTILIS 692

Query: 471  LDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
            L++S N+L G IP G  F ++   S   N  LCG
Sbjct: 693  LNLSFNNLHGQIPKGGVFSNITLQSLVGNSGLCG 726

 Score =  100 bits (248), Expect = 1e-19
 Identities = 62/172 (36%), Positives = 96/172 (55%), Gaps = 3/172 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+  ++ L  LDLS + + G +P ++G+L KL +  LS+NQL GTIP S+  M+ LA 
Sbjct: 342 PASLSNLTMLSVLDLSWSNLTGAIPPEYGQLGKLEKLHLSQNQLTGTIPASLGNMSELAM 401

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTG--QIPSTLLSNTGMGILNLSRNGFEG 356
           L L  N + GS+P  +G +R LS L +  N + G  +  S L +   +  L++  N   G
Sbjct: 402 LVLEGNLLNGSLPTTVGSIRSLSVLDIGANRLQGGLEFLSALSNCRELYFLSIYSNYLTG 461

Query: 357 TIPDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            +P+  G+  S   +  L  NKL G +P +++    +  LD+SNN L G IP
Sbjct: 462 NLPNYVGNLSSTLRLFSLHGNKLAGELPTTISNLTGLLVLDLSNNQLHGTIP 513

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 56/161 (34%), Positives = 84/161 (52%)
 Frame = +3

Query: 24  SGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR 203
           S L    L  N++ GELP+    L  L    LS NQL GTIP+S+++M  L  LDLS N 
Sbjct: 472 STLRLFSLHGNKLAGELPTTISNLTGLLVLDLSNNQLHGTIPESIMEMENLLQLDLSGNS 531

Query: 204 ITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSK 383
           + GS+P   G ++ +  + L  N  +G +P  + + + +  L LS N     +P      
Sbjct: 532 LAGSVPSNAGMLKSVEKIFLQSNKFSGSLPEDMGNLSKLEYLVLSDNQLSSNVPPSLSRL 591

Query: 384 SYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           +  M LDLS N L+G +P  +   K +  LD+S NH  G++
Sbjct: 592 NSLMKLDLSQNFLSGVLPVGIGDLKQINILDLSTNHFTGSL 632

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 57/163 (34%), Positives = 87/163 (53%), Gaps = 1/163 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  L + +N + G LP+  G L    R   L  N+L G +P ++  +  L  LDLS N++
Sbjct: 449 LYFLSIYSNYLTGNLPNYVGNLSSTLRLFSLHGNKLAGELPTTISNLTGLLVLDLSNNQL 508

Query: 207 TGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
            G+IP  + +M  L  L L GNS+ G +PS       +  + L  N F G++P+  G+ S
Sbjct: 509 HGTIPESIMEMENLLQLDLSGNSLAGSVPSNAGMLKSVEKIFLQSNKFSGSLPEDMGNLS 568

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
               L LS N+L+  VP SL++   +  LD+S N L G +P+G
Sbjct: 569 KLEYLVLSDNQLSSNVPPSLSRLNSLMKLDLSQNFLSGVLPVG 611

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 53/167 (31%), Positives = 91/167 (54%), Gaps = 1/167 (0%)
 Frame = +3

Query: 18  RISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSM 197
           R++GL+   L    + GEL S  G L  LS   L+   L G++P+ + +++RL  L+L  
Sbjct: 79  RVTGLV---LPGIPLQGELSSHLGNLSFLSVLNLTNASLTGSVPEDIGRLHRLEILELGY 135

Query: 198 NRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVF 374
           N ++G IP  +G +  L  L L+ N ++G IP+ L     +G+++L RN   G+IP ++F
Sbjct: 136 NSLSGGIPATIGNLTRLRVLYLEFNQLSGSIPAELQGLGSIGLMSLRRNYLTGSIPNNLF 195

Query: 375 GSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
            +       ++  N L+G +P S+     + HL++  N L G +P G
Sbjct: 196 NNTPLLAYFNIGNNSLSGSIPASIGSLSMLEHLNMQVNLLAGPVPPG 242

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 56/175 (32%), Positives = 90/175 (51%), Gaps = 6/175 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSD---FGKLRKLSRALLSRNQL-IGTIPDSVLKMN 170
           P+ +     L  L LS N   G + +      KL  L+  +L  N    G IP S+  + 
Sbjct: 290 PLGLASCQYLQVLSLSENYFEGVVTASAAWLSKLTNLTILVLGMNHFDAGPIPASLSNLT 349

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
            L+ LDLS + +TG+IP   G++  L  L L  N +TG IP++L + + + +L L  N  
Sbjct: 350 MLSVLDLSWSNLTGAIPPEYGQLGKLEKLHLSQNQLTGTIPASLGNMSELAMLVLEGNLL 409

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVP--NSLAKAKFMGHLDISNNHLCGNIP 509
            G++P   GS     VLD+  N+L G +   ++L+  + +  L I +N+L GN+P
Sbjct: 410 NGSLPTTVGSIRSLSVLDIGANRLQGGLEFLSALSNCRELYFLSIYSNYLTGNLP 464

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 56/190 (29%), Positives = 83/190 (43%), Gaps = 30/190 (15%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNR-I 206
           L + ++ NN + G +P+  G L  L    +  N L G +P  +  M+ L  + L +N  +
Sbjct: 201 LAYFNIGNNSLSGSIPASIGSLSMLEHLNMQVNLLAGPVPPGIFNMSTLRVIALGLNTFL 260

Query: 207 TGSIPVRLG-KMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT-------- 359
           TG I       +  L  L +DGN+ TGQIP  L S   + +L+LS N FEG         
Sbjct: 261 TGPIAGNTSFNLPALQWLSIDGNNFTGQIPLGLASCQYLQVLSLSENYFEGVVTASAAWL 320

Query: 360 --------------------IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDI 479
                               IP    + +   VLDLS++ LTG +P    +   +  L +
Sbjct: 321 SKLTNLTILVLGMNHFDAGPIPASLSNLTMLSVLDLSWSNLTGAIPPEYGQLGKLEKLHL 380

Query: 480 SNNHLCGNIP 509
           S N L G IP
Sbjct: 381 SQNQLTGTIP 390

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 58/189 (30%), Positives = 91/189 (48%), Gaps = 4/189 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I R+  L  L+L  N + G +P+  G L +L    L  NQL G+IP  +  +  +  
Sbjct: 119 PEDIGRLHRLEILELGYNSLSGGIPATIGNLTRLRVLYLEFNQLSGSIPAELQGLGSIGL 178

Query: 183 LDLSMNRITGSIPVRL-GKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           + L  N +TGSIP  L     +L+   +  NS++G IP+++ S + +  LN+  N   G 
Sbjct: 179 MSLRRNYLTGSIPNNLFNNTPLLAYFNIGNNSLSGSIPASIGSLSMLEHLNMQVNLLAGP 238

Query: 360 IPDVFGSKSYFMVLDLSFNK-LTGRVP-NSLAKAKFMGHLDISNNHLCGNIPIG-SPFDH 530
           +P    + S   V+ L  N  LTG +  N+      +  L I  N+  G IP+G +   +
Sbjct: 239 VPPGIFNMSTLRVIALGLNTFLTGPIAGNTSFNLPALQWLSIDGNNFTGQIPLGLASCQY 298

Query: 531 LDAASFSNN 557
           L   S S N
Sbjct: 299 LQVLSLSEN 307

[169][TOP]
>UniRef100_C5YD74 Putative uncharacterized protein Sb06g003130 n=1 Tax=Sorghum
           bicolor RepID=C5YD74_SORBI
          Length = 898

 Score =  122 bits (306), Expect = 2e-26
 Identities = 79/194 (40%), Positives = 111/194 (57%), Gaps = 3/194 (1%)
 Frame = +3

Query: 3   PMSIVRIS-GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P SI  +S  L +L L +NQI G +P +   L  L+   +  N L G+IP  + K+  L 
Sbjct: 324 PGSIANLSTSLEYLLLGSNQISGSIPVEISNLVNLTMLSMENNLLSGSIPAMIGKLQNLF 383

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L+LS N+++G IP  +G +  L  L LDGN + G IPS+L    G+  LNLS N   G+
Sbjct: 384 VLNLSKNKLSGQIPSSIGNINQLGELFLDGNDLNGNIPSSLGQCLGLLQLNLSANKLNGS 443

Query: 360 IPD-VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP-IGSPFDHL 533
           IP+ +F   S F+ LDLS N LTG++P +  K + +  LD+SNN L G +P I S   +L
Sbjct: 444 IPEKLFSGPSPFLGLDLSHNNLTGKIPEASGKLEHIVLLDLSNNLLSGGLPAIFSYLFYL 503

Query: 534 DAASFSNNDCLCGN 575
              + S ND L GN
Sbjct: 504 QYINLSRND-LSGN 516

 Score = 96.3 bits (238), Expect = 2e-18
 Identities = 60/191 (31%), Positives = 96/191 (50%), Gaps = 15/191 (7%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           ++ LDL++ Q+ G+L +    L  ++R  L  N   G IP+ +  + +L DL L+ N ++
Sbjct: 77  VVSLDLNSLQLAGQLSTSLANLTSITRLDLGSNSFFGPIPEELGTLPKLQDLILANNSLS 136

Query: 210 GSIPVRLGK-------------MRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           G IP  L K             M  L TL L  N ++G IPS++ + + +  + L +N  
Sbjct: 137 GIIPAILFKDSSRLQIFIIWQNMATLQTLNLAENQLSGSIPSSIGNISSLCSILLDQNKL 196

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGSPF 524
            G+IP+  G     + LDLSFN L+G +P  L     + H  + +N L G +P  IG+  
Sbjct: 197 TGSIPESLGQIPKLLELDLSFNNLSGYIPLPLYNMSSLKHFSLGSNGLVGQLPSDIGNSL 256

Query: 525 DHLDAASFSNN 557
            +L     SNN
Sbjct: 257 PNLQVLDLSNN 267

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 61/205 (29%), Positives = 98/205 (47%), Gaps = 29/205 (14%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L+L+ NQ+ G +PS  G +  L   LL +N+L G+IP+S+ ++ +L +LDLS N ++
Sbjct: 162 LQTLNLAENQLSGSIPSSIGNISSLCSILLDQNKLTGSIPESLGQIPKLLELDLSFNNLS 221

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL-LSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           G IP+ L  M  L    L  N + GQ+PS +  S   + +L+LS N   G +P +     
Sbjct: 222 GYIPLPLYNMSSLKHFSLGSNGLVGQLPSDIGNSLPNLQVLDLSNNSLHGRVPPLGSLAK 281

Query: 387 YFMV--------------------------LDLSFNKLTGRVPNSLAK-AKFMGHLDISN 485
              V                          L L  N + G +P S+A  +  + +L + +
Sbjct: 282 LRQVLLGRNQLEAYDWQFLSSLTNCTQLTKLSLEGNMMNGSLPGSIANLSTSLEYLLLGS 341

Query: 486 NHLCGNIPIG-SPFDHLDAASFSNN 557
           N + G+IP+  S   +L   S  NN
Sbjct: 342 NQISGSIPVEISNLVNLTMLSMENN 366

 Score = 84.7 bits (208), Expect = 5e-15
 Identities = 59/169 (34%), Positives = 86/169 (50%), Gaps = 2/169 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLK-MNRLA 179
           P SI  I+ L  L L  N + G +PS  G+   L +  LS N+L G+IP+ +    +   
Sbjct: 397 PSSIGNINQLGELFLDGNDLNGNIPSSLGQCLGLLQLNLSANKLNGSIPEKLFSGPSPFL 456

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            LDLS N +TG IP   GK+  +  L L  N ++G +P+       +  +NLSRN   G 
Sbjct: 457 GLDLSHNNLTGKIPEASGKLEHIVLLDLSNNLLSGGLPAIFSYLFYLQYINLSRNDLSGN 516

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPN-SLAKAKFMGHLDISNNHLCGN 503
           +P        F++LDLS+N   G+VP   + K   + HL+  N  LC N
Sbjct: 517 LPVFIED---FIMLDLSYNNFQGQVPTLGVFKNFSIIHLE-GNKGLCSN 561

 Score = 80.9 bits (198), Expect = 7e-14
 Identities = 63/221 (28%), Positives = 95/221 (42%), Gaps = 52/221 (23%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLS------------------------NNQIIGELPSD--------- 83
           P S+ +I  L+ LDLS                        +N ++G+LPSD         
Sbjct: 201 PESLGQIPKLLELDLSFNNLSGYIPLPLYNMSSLKHFSLGSNGLVGQLPSDIGNSLPNLQ 260

Query: 84  ---------------FGKLRKLSRALLSRNQLIG---TIPDSVLKMNRLADLDLSMNRIT 209
                           G L KL + LL RNQL         S+    +L  L L  N + 
Sbjct: 261 VLDLSNNSLHGRVPPLGSLAKLRQVLLGRNQLEAYDWQFLSSLTNCTQLTKLSLEGNMMN 320

Query: 210 GSIPVRLGKMRV-LSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKS 386
           GS+P  +  +   L  L L  N ++G IP  + +   + +L++  N   G+IP + G   
Sbjct: 321 GSLPGSIANLSTSLEYLLLGSNQISGSIPVEISNLVNLTMLSMENNLLSGSIPAMIGKLQ 380

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
              VL+LS NKL+G++P+S+     +G L +  N L GNIP
Sbjct: 381 NLFVLNLSKNKLSGQIPSSIGNINQLGELFLDGNDLNGNIP 421

[170][TOP]
>UniRef100_B9SUC9 Receptor-kinase, putative n=1 Tax=Ricinus communis RepID=B9SUC9_RICCO
          Length = 1028

 Score =  122 bits (306), Expect = 2e-26
 Identities = 73/191 (38%), Positives = 105/191 (54%), Gaps = 1/191 (0%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA- 179
            P S+  I+ L  + L  N + G +PS  G  +++    LSRN L GTIP  ++ +  L+ 
Sbjct: 436  PSSLGNITSLSTISLKVNNLEGSIPSSLGNCQQMLLMDLSRNNLSGTIPKELISIPSLSI 495

Query: 180  DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
             LDLS N+ TGS+P+ +G +  L  L +  N ++G+IP +L S T +  L L  N F+GT
Sbjct: 496  SLDLSENQFTGSLPMEVGGLVNLGYLDVSKNKLSGEIPKSLGSCTRLETLYLQGNAFQGT 555

Query: 360  IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
            IP    S      L+LS N LTG++PN  A+ K +  LD+S N   G +P    F +  A
Sbjct: 556  IPVSLSSLRGINDLNLSHNNLTGQIPNFFAEFKSLEKLDLSYNDFEGEVPAEGVFKNASA 615

Query: 540  ASFSNNDCLCG 572
             S S N  LCG
Sbjct: 616  FSISGNKNLCG 626

 Score =  114 bits (284), Expect = 7e-24
 Identities = 65/161 (40%), Positives = 95/161 (59%), Gaps = 1/161 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L+H+    N+I G +PS+   L +L      RN+L G+IP S+ K+  L  L L+ N I+
Sbjct: 373 LVHMAFGRNKIRGRIPSEIDNLIRLEALGFERNELTGSIPSSLGKLKNLIKLYLNDNNIS 432

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKS 386
           GSIP  LG +  LST+ L  N++ G IPS+L +   M +++LSRN   GTIP ++    S
Sbjct: 433 GSIPSSLGNITSLSTISLKVNNLEGSIPSSLGNCQQMLLMDLSRNNLSGTIPKELISIPS 492

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             + LDLS N+ TG +P  +     +G+LD+S N L G IP
Sbjct: 493 LSISLDLSENQFTGSLPMEVGGLVNLGYLDVSKNKLSGEIP 533

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 55/160 (34%), Positives = 86/160 (53%), Gaps = 2/160 (1%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGS 215
           L ++ N + G LP        KL      RN++ G IP  +  + RL  L    N +TGS
Sbjct: 351 LAITENNLGGVLPEMLSNFSTKLVHMAFGRNKIRGRIPSEIDNLIRLEALGFERNELTGS 410

Query: 216 IPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFM 395
           IP  LGK++ L  L L+ N+++G IPS+L + T +  ++L  N  EG+IP   G+    +
Sbjct: 411 IPSSLGKLKNLIKLYLNDNNISGSIPSSLGNITSLSTISLKVNNLEGSIPSSLGNCQQML 470

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMG-HLDISNNHLCGNIPI 512
           ++DLS N L+G +P  L     +   LD+S N   G++P+
Sbjct: 471 LMDLSRNNLSGTIPKELISIPSLSISLDLSENQFTGSLPM 510

 Score = 84.0 bits (206), Expect = 8e-15
 Identities = 48/166 (28%), Positives = 80/166 (48%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  +S L  L+L NN +   +P + G+L +L   +L RN   G IP ++   + L  L L
Sbjct: 96  IGNLSFLRVLNLQNNSLSHYIPQEIGRLFRLRTLILRRNSFSGEIPVNISYCSNLLTLRL 155

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
             N +TG +P  L  +  L   + + N +TG+I  +  + + + I+  +RN F G IP+ 
Sbjct: 156 GRNNLTGKLPAELKSLSKLQMFEFEINYLTGEISPSFSNLSSLEIIYGTRNNFHGEIPNS 215

Query: 372 FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            G         L  +  +G +P S+     +  L +  N L GN+P
Sbjct: 216 IGQLKSLQTFSLGGSNFSGVIPPSIFNLSSLTILSVPINQLHGNLP 261

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 52/194 (26%), Positives = 88/194 (45%), Gaps = 25/194 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I R+  L  L L  N   GE+P +      L    L RN L G +P  +  +++L  
Sbjct: 117 PQEIGRLFRLRTLILRRNSFSGEIPVNISYCSNLLTLRLGRNNLTGKLPAELKSLSKLQM 176

Query: 183 LDLSMNRIT------------------------GSIPVRLGKMRVLSTLKLDGNSMTGQI 290
            +  +N +T                        G IP  +G+++ L T  L G++ +G I
Sbjct: 177 FEFEINYLTGEISPSFSNLSSLEIIYGTRNNFHGEIPNSIGQLKSLQTFSLGGSNFSGVI 236

Query: 291 PSTLLSNTGMGILNLSRNGFEGTI-PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
           P ++ + + + IL++  N   G + PD+  S     VL L  NK +G +P +++ A  + 
Sbjct: 237 PPSIFNLSSLTILSVPINQLHGNLPPDLGQSLPKLEVLRLYANKFSGSIPPTISNASNLV 296

Query: 468 HLDISNNHLCGNIP 509
            LD+S N+  G +P
Sbjct: 297 ALDVSQNNFTGKVP 310

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 54/189 (28%), Positives = 88/189 (46%), Gaps = 25/189 (13%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P++I   S L+ L L  N + G+LP++   L KL       N L G I  S   ++ L  
Sbjct: 141 PVNISYCSNLLTLRLGRNNLTGKLPAELKSLSKLQMFEFEINYLTGEISPSFSNLSSLEI 200

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILN---------- 332
           +  + N   G IP  +G+++ L T  L G++ +G IP ++ + + + IL+          
Sbjct: 201 IYGTRNNFHGEIPNSIGQLKSLQTFSLGGSNFSGVIPPSIFNLSSLTILSVPINQLHGNL 260

Query: 333 ---------------LSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
                          L  N F G+IP    + S  + LD+S N  TG+VP SLA+   + 
Sbjct: 261 PPDLGQSLPKLEVLRLYANKFSGSIPPTISNASNLVALDVSQNNFTGKVP-SLARLHNLS 319

Query: 468 HLDISNNHL 494
           ++ I  N+L
Sbjct: 320 YIGIHKNNL 328

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 45/160 (28%), Positives = 78/160 (48%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           ++ +DL ++++ G L +  G L  L    L  N L   IP  + ++ RL  L L  N  +
Sbjct: 78  VIEIDLESSRLSGSLTAFIGNLSFLRVLNLQNNSLSHYIPQEIGRLFRLRTLILRRNSFS 137

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G IPV +     L TL+L  N++TG++P+ L S + + +     N   G I   F + S 
Sbjct: 138 GEIPVNISYCSNLLTLRLGRNNLTGKLPAELKSLSKLQMFEFEINYLTGEISPSFSNLSS 197

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             ++  + N   G +PNS+ + K +    +  ++  G IP
Sbjct: 198 LEIIYGTRNNFHGEIPNSIGQLKSLQTFSLGGSNFSGVIP 237

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 35/112 (31%), Positives = 54/112 (48%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+ ++DL  +R++GS+   +G +  L  L L  NS++  IP  +     +  L L RN F
Sbjct: 77  RVIEIDLESSRLSGSLTAFIGNLSFLRVLNLQNNSLSHYIPQEIGRLFRLRTLILRRNSF 136

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
            G IP      S  + L L  N LTG++P  L     +   +   N+L G I
Sbjct: 137 SGEIPVNISYCSNLLTLRLGRNNLTGKLPAELKSLSKLQMFEFEINYLTGEI 188

[171][TOP]
>UniRef100_B8BLF3 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8BLF3_ORYSI
          Length = 999

 Score =  122 bits (306), Expect = 2e-26
 Identities = 71/171 (41%), Positives = 102/171 (59%), Gaps = 2/171 (1%)
 Frame = +3

Query: 3   PMSIVRIS-GLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P+SI  +S  L  L L  NQ+ G++PS+ GKL  L+   L  N L G IPD++  +  L+
Sbjct: 350 PISIGNLSKSLEELHLMANQLTGDIPSEIGKLTGLTVITLGMNGLTGHIPDTLQNLQNLS 409

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L LS N+++G IP  +GK+  L+ L L  N +TG+IP++L     +  LNLS N F G+
Sbjct: 410 VLSLSKNKLSGEIPQSIGKLEQLTELHLRENELTGRIPTSLAGCKNLVQLNLSSNSFHGS 469

Query: 360 IP-DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP ++F   +  + LDLS N+LTG +P  + K   +  L ISNN L G IP
Sbjct: 470 IPQELFSISTLSISLDLSNNQLTGDIPMEIGKLINLNSLSISNNRLSGEIP 520

 Score =  111 bits (278), Expect = 4e-23
 Identities = 65/171 (38%), Positives = 94/171 (54%), Gaps = 1/171 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLA 179
           P S+     L+ L+LS+N   G +P +   +  LS +L LS NQL G IP  + K+  L 
Sbjct: 447 PTSLAGCKNLVQLNLSSNSFHGSIPQELFSISTLSISLDLSNNQLTGDIPMEIGKLINLN 506

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            L +S NR++G IP  LG   +L +L L+ N + G IPS+L++  G+  ++LS+N   G 
Sbjct: 507 SLSISNNRLSGEIPSNLGNCLLLQSLHLEANFLNGHIPSSLINLRGIVEMDLSQNNLSGE 566

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           IP+ FGS S   +L+LSFN L G VP               NN LC + P+
Sbjct: 567 IPEFFGSFSSLKILNLSFNNLIGPVPKGGVFDNSSAVCIQGNNKLCASSPM 617

 Score =  108 bits (270), Expect = 3e-22
 Identities = 62/192 (32%), Positives = 102/192 (53%), Gaps = 1/192 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA- 179
           P SI ++  L  L L  N++ G +P+     + L +  LS N   G+IP  +  ++ L+ 
Sbjct: 423 PQSIGKLEQLTELHLRENELTGRIPTSLAGCKNLVQLNLSSNSFHGSIPQELFSISTLSI 482

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            LDLS N++TG IP+ +GK+  L++L +  N ++G+IPS L +   +  L+L  N   G 
Sbjct: 483 SLDLSNNQLTGDIPMEIGKLINLNSLSISNNRLSGEIPSNLGNCLLLQSLHLEANFLNGH 542

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDA 539
           IP    +    + +DLS N L+G +P        +  L++S N+L G +P G  FD+  A
Sbjct: 543 IPSSLINLRGIVEMDLSQNNLSGEIPEFFGSFSSLKILNLSFNNLIGPVPKGGVFDNSSA 602

Query: 540 ASFSNNDCLCGN 575
                N+ LC +
Sbjct: 603 VCIQGNNKLCAS 614

 Score =  105 bits (262), Expect = 3e-21
 Identities = 60/169 (35%), Positives = 94/169 (55%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SI   S L  + L +N + GE+P    +   L + +LS N L G+IP     +  L+ 
Sbjct: 35  PHSISSCSRLEVISLQSNSLQGEIPQSLAECSFLQKIVLSNNNLQGSIPSKFGLLANLSV 94

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           + LS N ++GSIP  LG  R L+ + L+ NS++G+IP ++ ++T +  ++LS N   G+I
Sbjct: 95  ILLSSNSLSGSIPELLGSTRSLTEVNLNNNSISGKIPPSIFNSTTLSYIDLSHNHLSGSI 154

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P    S     +L L+ N LTG +P SL     +  L +S N+L G+IP
Sbjct: 155 PPFSKSSMPLQLLSLAENNLTGEIPVSLGNISSLSFLLLSQNNLQGSIP 203

 Score =  103 bits (256), Expect = 1e-20
 Identities = 52/155 (33%), Positives = 86/155 (55%)
 Frame = +3

Query: 45  LSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPV 224
           + NNQ+ G +  D G L +L+   LS N L G IP S+   +RL  + L  N + G IP 
Sbjct: 1   MPNNQLNGHISPDIGLLTRLTYLNLSMNSLNGVIPHSISSCSRLEVISLQSNSLQGEIPQ 60

Query: 225 RLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLD 404
            L +   L  + L  N++ G IPS       + ++ LS N   G+IP++ GS      ++
Sbjct: 61  SLAECSFLQKIVLSNNNLQGSIPSKFGLLANLSVILLSSNSLSGSIPELLGSTRSLTEVN 120

Query: 405 LSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           L+ N ++G++P S+  +  + ++D+S+NHL G+IP
Sbjct: 121 LNNNSISGKIPPSIFNSTTLSYIDLSHNHLSGSIP 155

 Score =  103 bits (256), Expect = 1e-20
 Identities = 62/169 (36%), Positives = 91/169 (53%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+   S L  + LSNN + G +PS FG L  LS  LLS N L G+IP+ +     L +
Sbjct: 59  PQSLAECSFLQKIVLSNNNLQGSIPSKFGLLANLSVILLSSNSLSGSIPELLGSTRSLTE 118

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           ++L+ N I+G IP  +     LS + L  N ++G IP    S+  + +L+L+ N   G I
Sbjct: 119 VNLNNNSISGKIPPSIFNSTTLSYIDLSHNHLSGSIPPFSKSSMPLQLLSLAENNLTGEI 178

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G+ S    L LS N L G +P SL+K   +  L++  N+L G +P
Sbjct: 179 PVSLGNISSLSFLLLSQNNLQGSIPGSLSKIVNLRVLNLKYNNLSGIVP 227

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 53/164 (32%), Positives = 84/164 (51%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           ++ L +L+LS N + G +P       +L    L  N L G IP S+ + + L  + LS N
Sbjct: 17  LTRLTYLNLSMNSLNGVIPHSISSCSRLEVISLQSNSLQGEIPQSLAECSFLQKIVLSNN 76

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
            + GSIP + G +  LS + L  NS++G IP  L S   +  +NL+ N   G IP    +
Sbjct: 77  NLQGSIPSKFGLLANLSVILLSSNSLSGSIPELLGSTRSLTEVNLNNNSISGKIPPSIFN 136

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
            +    +DLS N L+G +P     +  +  L ++ N+L G IP+
Sbjct: 137 STTLSYIDLSHNHLSGSIPPFSKSSMPLQLLSLAENNLTGEIPV 180

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 61/185 (32%), Positives = 84/185 (45%), Gaps = 25/185 (13%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  ++L+NN I G++P        LS   LS N L G+IP        L  L L+ N +T
Sbjct: 116 LTEVNLNNNSISGKIPPSIFNSTTLSYIDLSHNHLSGSIPPFSKSSMPLQLLSLAENNLT 175

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G IPV LG +  LS L L  N++ G IP +L     + +LNL  N   G +P    + S 
Sbjct: 176 GEIPVSLGNISSLSFLLLSQNNLQGSIPGSLSKIVNLRVLNLKYNNLSGIVPPALFNISS 235

Query: 390 FMVLDLSFNKLT-------------------------GRVPNSLAKAKFMGHLDISNNHL 494
              L L+ N+L                          G++PNSLA A  +  LDI +N  
Sbjct: 236 LTDLILNNNQLVGTIPANLGSTLPNITELVIGGNQFEGQIPNSLANASNLQTLDIRSNLF 295

Query: 495 CGNIP 509
            G+IP
Sbjct: 296 SGHIP 300

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 59/197 (29%), Positives = 91/197 (46%), Gaps = 28/197 (14%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSV-LKMNRLA 179
           P S+ +I  L  L+L  N + G +P     +  L+  +L+ NQL+GTIP ++   +  + 
Sbjct: 203 PGSLSKIVNLRVLNLKYNNLSGIVPPALFNISSLTDLILNNNQLVGTIPANLGSTLPNIT 262

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPS--------------------- 296
           +L +  N+  G IP  L     L TL +  N  +G IPS                     
Sbjct: 263 ELVIGGNQFEGQIPNSLANASNLQTLDIRSNLFSGHIPSLGLLSELKMLDLGTNMLQAGD 322

Query: 297 -TLLSN----TGMGILNLSRNGFEGTIPDVFGSKSYFM-VLDLSFNKLTGRVPNSLAKAK 458
            T LS+      +  L+L  NGFEG IP   G+ S  +  L L  N+LTG +P+ + K  
Sbjct: 323 WTFLSSLTNCPQLKSLSLDFNGFEGKIPISIGNLSKSLEELHLMANQLTGDIPSEIGKLT 382

Query: 459 FMGHLDISNNHLCGNIP 509
            +  + +  N L G+IP
Sbjct: 383 GLTVITLGMNGLTGHIP 399

[172][TOP]
>UniRef100_A7QQF7 Chromosome undetermined scaffold_142, whole genome shotgun sequence
            n=1 Tax=Vitis vinifera RepID=A7QQF7_VITVI
          Length = 1023

 Score =  122 bits (306), Expect = 2e-26
 Identities = 75/218 (34%), Positives = 102/218 (46%), Gaps = 26/218 (11%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P+S+   + L+ + L++NQ+ GE+P+  G L  L+   L  N L G IP  + K   L  
Sbjct: 440  PLSLANCTNLIWVSLASNQLTGEIPAGIGNLHNLAVLQLGNNTLNGRIPSELGKCQNLIW 499

Query: 183  LDLSMNRITGSIPVRLGKMRVLST--------------------------LKLDGNSMTG 284
            LDL+ N  +GS+P  L     L T                          L L  NS++G
Sbjct: 500  LDLNSNGFSGSVPSELASEAGLVTPGLVSGKQIYSGVTVYTFSSNGSMIYLDLSYNSLSG 559

Query: 285  QIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFM 464
             IP +  S   + +LNL  N   G IPD  G      VLDLS N L G +P +L    F+
Sbjct: 560  TIPQSFGSLNYLQVLNLGHNQLTGNIPDSLGGLKAIGVLDLSHNNLQGYIPGALGSLSFL 619

Query: 465  GHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCGNP 578
              LD+SNN+L G IP G       A+ + NN  LCG P
Sbjct: 620  SDLDVSNNNLTGPIPSGGQLTTFPASRYDNNSGLCGVP 657

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 61/220 (27%), Positives = 96/220 (43%), Gaps = 51/220 (23%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDS--------- 155
            P+ +     L  +DLS N + G +P +   L  LS  ++  N L G IP+          
Sbjct: 367  PLELGNCQKLRSIDLSFNNLSGPIPYEIWTLPNLSDLVMWANNLTGEIPEGICIKGGNLE 426

Query: 156  --VLKMNR--------------LADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQ 287
              +L  NR              L  + L+ N++TG IP  +G +  L+ L+L  N++ G+
Sbjct: 427  TLILNNNRINGTIPLSLANCTNLIWVSLASNQLTGEIPAGIGNLHNLAVLQLGNNTLNGR 486

Query: 288  IPSTLLSNTGMGILNLSRNGFEGTIPD--------------------------VFGSKSY 389
            IPS L     +  L+L+ NGF G++P                            F S   
Sbjct: 487  IPSELGKCQNLIWLDLNSNGFSGSVPSELASEAGLVTPGLVSGKQIYSGVTVYTFSSNGS 546

Query: 390  FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             + LDLS+N L+G +P S     ++  L++ +N L GNIP
Sbjct: 547  MIYLDLSYNSLSGTIPQSFGSLNYLQVLNLGHNQLTGNIP 586

 Score = 84.7 bits (208), Expect = 5e-15
 Identities = 52/169 (30%), Positives = 85/169 (50%), Gaps = 1/169 (0%)
 Frame = +3

Query: 6   MSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADL 185
           M I  +  L +L +  N + G +P       +L + LL+ N L GT+P  +    +L  +
Sbjct: 320 MVISTLPSLKYLYVPFNNLTGSVPLSLTNCTQLQKILLADNFLSGTVPLELGNCQKLRSI 379

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTI 362
           DLS N ++G IP  +  +  LS L +  N++TG+IP  +    G +  L L+ N   GTI
Sbjct: 380 DLSFNNLSGPIPYEIWTLPNLSDLVMWANNLTGEIPEGICIKGGNLETLILNNNRINGTI 439

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P    + +  + + L+ N+LTG +P  +     +  L + NN L G IP
Sbjct: 440 PLSLANCTNLIWVSLASNQLTGEIPAGIGNLHNLAVLQLGNNTLNGRIP 488

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 49/173 (28%), Positives = 89/173 (51%), Gaps = 2/173 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGE-LPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P++    S L+ L+L NN++ G+ L      L  L    +  N L G++P S+    +L 
Sbjct: 294 PLTFASCSSLVSLNLGNNRLSGDFLTMVISTLPSLKYLYVPFNNLTGSVPLSLTNCTQLQ 353

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            + L+ N ++G++P+ LG  + L ++ L  N+++G IP  + +   +  L +  N   G 
Sbjct: 354 KILLADNFLSGTVPLELGNCQKLRSIDLSFNNLSGPIPYEIWTLPNLSDLVMWANNLTGE 413

Query: 360 IPDVFGSKSYFM-VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
           IP+    K   +  L L+ N++ G +P SLA    +  + +++N L G IP G
Sbjct: 414 IPEGICIKGGNLETLILNNNRINGTIPLSLANCTNLIWVSLASNQLTGEIPAG 466

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 61/198 (30%), Positives = 92/198 (46%), Gaps = 27/198 (13%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDF-GKLRKLSRALLSRNQLIGTIPDSVLKM-NRL 176
           P S+     L  LDLS+N +  ++P D  G LR L    L+ N+ +G IP  +      L
Sbjct: 220 PPSLRNCELLETLDLSHNVLEYKIPGDLLGNLRNLRWLSLAHNRFMGEIPPELAATCGTL 279

Query: 177 ADLDLSMNRITGSIPV-----------RLGKMR--------VLSTLK------LDGNSMT 281
             LDLS N ++G  P+            LG  R        V+STL       +  N++T
Sbjct: 280 QGLDLSANNLSGGFPLTFASCSSLVSLNLGNNRLSGDFLTMVISTLPSLKYLYVPFNNLT 339

Query: 282 GQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKF 461
           G +P +L + T +  + L+ N   GT+P   G+      +DLSFN L+G +P  +     
Sbjct: 340 GSVPLSLTNCTQLQKILLADNFLSGTVPLELGNCQKLRSIDLSFNNLSGPIPYEIWTLPN 399

Query: 462 MGHLDISNNHLCGNIPIG 515
           +  L +  N+L G IP G
Sbjct: 400 LSDLVMWANNLTGEIPEG 417

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 64/196 (32%), Positives = 85/196 (43%), Gaps = 28/196 (14%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGT-IPDSVLKMNRLADL 185
           S+     L  LDLS N + GE+P  FG+   L+   LS N   GT  P S+     L  L
Sbjct: 175 SLSPCKNLSTLDLSYNLLSGEMP--FGECGNLTVLDLSHNDFSGTDFPPSLRNCELLETL 232

Query: 186 DLSMNRITGSIP-VRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGT 359
           DLS N +   IP   LG +R L  L L  N   G+IP  L +  G +  L+LS N   G 
Sbjct: 233 DLSHNVLEYKIPGDLLGNLRNLRWLSLAHNRFMGEIPPELAATCGTLQGLDLSANNLSGG 292

Query: 360 IPDVFGSKSYFMVLDLS-------------------------FNKLTGRVPNSLAKAKFM 464
            P  F S S  + L+L                          FN LTG VP SL     +
Sbjct: 293 FPLTFASCSSLVSLNLGNNRLSGDFLTMVISTLPSLKYLYVPFNNLTGSVPLSLTNCTQL 352

Query: 465 GHLDISNNHLCGNIPI 512
             + +++N L G +P+
Sbjct: 353 QKILLADNFLSGTVPL 368

[173][TOP]
>UniRef100_A2ZGW4 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
            RepID=A2ZGW4_ORYSI
          Length = 1044

 Score =  122 bits (306), Expect = 2e-26
 Identities = 68/192 (35%), Positives = 99/192 (51%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I  +  L+ L L NN+  G +P   G L  L    LS+N L   +P  +  ++ L  
Sbjct: 472  PAKIGFLGRLVQLYLYNNEFSGSIPEGIGNLTNLEYISLSQNNLSSGLPTGLFHLDELVH 531

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N +TG++P  LG M+ +  + L  NS+ G IP +    T +  LNLS N FEG++
Sbjct: 532  LNLSHNSLTGALPADLGHMKQIDKIDLSDNSLVGSIPDSFGQLTMLTYLNLSHNSFEGSV 591

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P    +      LDLS N L+G +P  LA   ++  L++S N L G +P    F  +   
Sbjct: 592  PYTLRNSISLAALDLSSNNLSGTIPKFLANLTYLTILNLSFNELHGPVPDEGVFRDITMQ 651

Query: 543  SFSNNDCLCGNP 578
            S + ND LCG P
Sbjct: 652  SLTGNDGLCGAP 663

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 54/160 (33%), Positives = 85/160 (53%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L+  D+ +N++ G +PS    L  LS  +L  NQL   IP+SV+ M  L  +D++ N   
Sbjct: 409 LVVFDVDSNRLTGGIPSTISNLSSLSSLILLNNQLSQEIPESVMTMESLERIDIARNNFA 468

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G IP ++G +  L  L L  N  +G IP  + + T +  ++LS+N     +P        
Sbjct: 469 GPIPAKIGFLGRLVQLYLYNNEFSGSIPEGIGNLTNLEYISLSQNNLSSGLPTGLFHLDE 528

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            + L+LS N LTG +P  L   K +  +D+S+N L G+IP
Sbjct: 529 LVHLNLSHNSLTGALPADLGHMKQIDKIDLSDNSLVGSIP 568

 Score = 85.1 bits (209), Expect = 4e-15
 Identities = 55/169 (32%), Positives = 81/169 (47%), Gaps = 2/169 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMN--RL 176
           P +I  +  L  L++  N + GE+P     +  L    ++ N L G IPD+ +  N   L
Sbjct: 169 PPAIASLPKLDFLNMQINHLSGEIPPAIFNMSGLRMLYMANNNLTGPIPDNNISFNLPML 228

Query: 177 ADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEG 356
             + LS+N  TG IP+ L   +    + L  N  TG IP+ L     +  +    N   G
Sbjct: 229 QVISLSLNNFTGPIPIGLASSKQARIISLSQNLFTGPIPTWLAELPLLTGILFGGNELVG 288

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGN 503
           TIP V G+ +    LD SF KL G +P  L K K +  L++S N L G+
Sbjct: 289 TIPAVLGNLTMLSRLDFSFCKLYGEIPVQLGKLKNLTILELSVNRLSGS 337

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 53/171 (30%), Positives = 88/171 (51%), Gaps = 5/171 (2%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALL--SRNQLIGTIPDSVLKMN-RLAD 182
           +  +S L  L+L+   I G +P D G+LR+LS   L  S N L G IP  +      L+ 
Sbjct: 97  LANLSFLAVLNLTGAGITGPIPPDLGRLRRLSIQFLDLSINSLSGEIPAQLFDTTPELSH 156

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           ++ + + ++GSIP  +  +  L  L +  N ++G+IP  + + +G+ +L ++ N   G I
Sbjct: 157 VNFANDTLSGSIPPAIASLPKLDFLNMQINHLSGEIPPAIFNMSGLRMLYMANNNLTGPI 216

Query: 363 PD--VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           PD  +  +     V+ LS N  TG +P  LA +K    + +S N   G IP
Sbjct: 217 PDNNISFNLPMLQVISLSLNNFTGPIPIGLASSKQARIISLSQNLFTGPIP 267

 Score = 80.5 bits (197), Expect = 9e-14
 Identities = 55/194 (28%), Positives = 92/194 (47%), Gaps = 37/194 (19%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           + LS N   G +P+   +L  L+  L   N+L+GTIP  +  +  L+ LD S  ++ G I
Sbjct: 255 ISLSQNLFTGPIPTWLAELPLLTGILFGGNELVGTIPAVLGNLTMLSRLDFSFCKLYGEI 314

Query: 219 PVRLGKMRVLSTLKLDGNSMT---------GQIPSTLLSN-------------------- 311
           PV+LGK++ L+ L+L  N ++         G +P++  SN                    
Sbjct: 315 PVQLGKLKNLTILELSVNRLSGSFLLFLLIGSVPASFGSNMISLEQFDVGENHLQGDLGF 374

Query: 312 -------TGMGILNLSRNGFEGTIPDVFGSKS-YFMVLDLSFNKLTGRVPNSLAKAKFMG 467
                    + +L+L  N F G +PD  G+ S   +V D+  N+LTG +P++++    + 
Sbjct: 375 FAALSNCRELQLLSLHTNSFTGRLPDYVGNLSRNLVVFDVDSNRLTGGIPSTISNLSSLS 434

Query: 468 HLDISNNHLCGNIP 509
            L + NN L   IP
Sbjct: 435 SLILLNNQLSQEIP 448

 Score = 79.0 bits (193), Expect = 3e-13
 Identities = 49/172 (28%), Positives = 85/172 (49%), Gaps = 3/172 (1%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELP--SDFGKLRKLSRALLSRNQLIGTIPDSVLKMNR-LADLDLSMN 200
           L   D+  N + G+L   +     R+L    L  N   G +PD V  ++R L   D+  N
Sbjct: 358 LEQFDVGENHLQGDLGFFAALSNCRELQLLSLHTNSFTGRLPDYVGNLSRNLVVFDVDSN 417

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           R+TG IP  +  +  LS+L L  N ++ +IP ++++   +  ++++RN F G IP   G 
Sbjct: 418 RLTGGIPSTISNLSSLSSLILLNNQLSQEIPESVMTMESLERIDIARNNFAGPIPAKIGF 477

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLD 536
               + L L  N+ +G +P  +     + ++ +S N+L   +P G    HLD
Sbjct: 478 LGRLVQLYLYNNEFSGSIPEGIGNLTNLEYISLSQNNLSSGLPTG--LFHLD 527

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 54/180 (30%), Positives = 82/180 (45%), Gaps = 12/180 (6%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSD--FGKLRKLSRALLSRNQLIGTIPDSVLKMNRL 176
           P +I  +SGL  L ++NN + G +P +     L  L    LS N   G IP  +    + 
Sbjct: 193 PPAIFNMSGLRMLYMANNNLTGPIPDNNISFNLPMLQVISLSLNNFTGPIPIGLASSKQA 252

Query: 177 ADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEG 356
             + LS N  TG IP  L ++ +L+ +   GN + G IP+ L + T +  L+ S     G
Sbjct: 253 RIISLSQNLFTGPIPTWLAELPLLTGILFGGNELVGTIPAVLGNLTMLSRLDFSFCKLYG 312

Query: 357 TIPDVFGSKSYFMVLDLSFNKLT---------GRVPNSLAKAKF-MGHLDISNNHLCGNI 506
            IP   G      +L+LS N+L+         G VP S       +   D+  NHL G++
Sbjct: 313 EIPVQLGKLKNLTILELSVNRLSGSFLLFLLIGSVPASFGSNMISLEQFDVGENHLQGDL 372

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 43/141 (30%), Positives = 74/141 (52%), Gaps = 3/141 (2%)
 Frame = +3

Query: 96  RKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLST--LKLDG 269
           ++++   L    L G +   +  ++ LA L+L+   ITG IP  LG++R LS   L L  
Sbjct: 77  QRVTSLALPGTPLHGQLSPHLANLSFLAVLNLTGAGITGPIPPDLGRLRRLSIQFLDLSI 136

Query: 270 NSMTGQIPSTLLSNT-GMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSL 446
           NS++G+IP+ L   T  +  +N + +   G+IP    S      L++  N L+G +P ++
Sbjct: 137 NSLSGEIPAQLFDTTPELSHVNFANDTLSGSIPPAIASLPKLDFLNMQINHLSGEIPPAI 196

Query: 447 AKAKFMGHLDISNNHLCGNIP 509
                +  L ++NN+L G IP
Sbjct: 197 FNMSGLRMLYMANNNLTGPIP 217

[174][TOP]
>UniRef100_A2WU15 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
            RepID=A2WU15_ORYSI
          Length = 1065

 Score =  122 bits (306), Expect = 2e-26
 Identities = 71/194 (36%), Positives = 109/194 (56%), Gaps = 2/194 (1%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P+SI  +  L  +D S+N+++G +P++ GK    +  L + N+L G IPDS+  ++RL  
Sbjct: 504  PVSITEMKDLEMIDFSSNELVGTIPANIGKSNLFALGL-AYNKLHGPIPDSISNLSRLQT 562

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPST--LLSNTGMGILNLSRNGFEG 356
            L+LS N++T ++P+ L  ++ +  L L GN++TG +P    L + T M   NLS N F G
Sbjct: 563  LELSNNQLTSAVPMGLWGLQNIVGLDLAGNALTGSLPEVENLKATTFM---NLSSNRFSG 619

Query: 357  TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLD 536
             +P   G  S    LDLS+N  +G +P S A    +  L++S N L G IP G  F ++ 
Sbjct: 620  NLPASLGLFSTLTYLDLSYNSFSGTIPKSFANLSPLTTLNLSFNRLDGQIPNGGVFSNIT 679

Query: 537  AASFSNNDCLCGNP 578
              S   N  LCG P
Sbjct: 680  LQSLRGNTALCGLP 693

 Score =  108 bits (271), Expect = 2e-22
 Identities = 64/158 (40%), Positives = 90/158 (56%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+L   Q+ G L  + G+L  LS   LS  +L G IPD +  + RL  LDLS NR++G++
Sbjct: 82  LELPGVQLAGSLAPELGELTFLSTLNLSDARLSGPIPDGIGNLPRLLSLDLSSNRLSGNL 141

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFM 395
           P  LG + VL  L LD N++TG+IP  L +   +  L LSRN   G IP  +F   S  +
Sbjct: 142 PSSLGNLTVLEILDLDSNNLTGEIPPDLHNLKNIMYLRLSRNELSGQIPRGMFNGTSQLV 201

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            L L++NKLTG +P ++     +  L +S N L G IP
Sbjct: 202 FLSLAYNKLTGSIPGAIGFLPNIQVLVLSGNQLSGPIP 239

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 56/170 (32%), Positives = 86/170 (50%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG-KLRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P S+  +S L+ + L  N + G +P++    L  L    L+ N L G +P    +   L 
Sbjct: 239 PASLFNMSSLVRMYLGKNNLSGSIPNNGSFNLPMLQTVNLNTNHLTGIVPQGFGECKNLQ 298

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
           +  L  N  TG IP  L  M  L  + L GN ++G+IP++L + TG+  L+ +R+   G 
Sbjct: 299 EFILFSNGFTGGIPPWLASMPQLVNVSLGGNDLSGEIPASLGNLTGLTHLDFTRSNLHGK 358

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP   G  +    L+L  N LTG +P S+     +  LDIS N L G++P
Sbjct: 359 IPPELGQLTQLRWLNLEMNNLTGSIPASIRNMSMISILDISFNSLTGSVP 408

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 60/175 (34%), Positives = 89/175 (50%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L +L ++ N   G +PS  G L  L      +NQ+ G IPD   K N L  +DL  NR T
Sbjct: 442 LKYLVMNTNYFTGSIPSSIGNLSSLQIFRAFKNQITGNIPDMTNKSNMLF-MDLRNNRFT 500

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G IPV + +M+ L  +    N + G IP+  +  + +  L L+ N   G IPD   + S 
Sbjct: 501 GEIPVSITEMKDLEMIDFSSNELVGTIPAN-IGKSNLFALGLAYNKLHGPIPDSISNLSR 559

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSN 554
              L+LS N+LT  VP  L   + +  LD++ N L G++P     ++L A +F N
Sbjct: 560 LQTLELSNNQLTSAVPMGLWGLQNIVGLDLAGNALTGSLP---EVENLKATTFMN 611

 Score = 93.6 bits (231), Expect = 1e-17
 Identities = 57/167 (34%), Positives = 89/167 (53%), Gaps = 1/167 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  L+LS+ ++ G +P   G L +L    LS N+L G +P S+  +  L  LDL  N +T
Sbjct: 103 LSTLNLSDARLSGPIPDGIGNLPRLLSLDLSSNRLSGNLPSSLGNLTVLEILDLDSNNLT 162

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTG-MGILNLSRNGFEGTIPDVFGSKS 386
           G IP  L  ++ +  L+L  N ++GQIP  + + T  +  L+L+ N   G+IP   G   
Sbjct: 163 GEIPPDLHNLKNIMYLRLSRNELSGQIPRGMFNGTSQLVFLSLAYNKLTGSIPGAIGFLP 222

Query: 387 YFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFD 527
              VL LS N+L+G +P SL     +  + +  N+L G+IP    F+
Sbjct: 223 NIQVLVLSGNQLSGPIPASLFNMSSLVRMYLGKNNLSGSIPNNGSFN 269

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 52/159 (32%), Positives = 81/159 (50%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L  ++L+ N + G +P  FG+ + L   +L  N   G IP  +  M +L ++ L  N ++
Sbjct: 273 LQTVNLNTNHLTGIVPQGFGECKNLQEFILFSNGFTGGIPPWLASMPQLVNVSLGGNDLS 332

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G IP  LG +  L+ L    +++ G+IP  L   T +  LNL  N   G+IP    + S 
Sbjct: 333 GEIPASLGNLTGLTHLDFTRSNLHGKIPPELGQLTQLRWLNLEMNNLTGSIPASIRNMSM 392

Query: 390 FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
             +LD+SFN LTG VP  +     +  L I  N L G++
Sbjct: 393 ISILDISFNSLTGSVPRPIF-GPALSELYIDENKLSGDV 430

 Score = 84.0 bits (206), Expect = 8e-15
 Identities = 60/196 (30%), Positives = 97/196 (49%), Gaps = 27/196 (13%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFG------------------------KLRKLSR 110
           P  I  +  L+ LDLS+N++ G LPS  G                         L+ +  
Sbjct: 118 PDGIGNLPRLLSLDLSSNRLSGNLPSSLGNLTVLEILDLDSNNLTGEIPPDLHNLKNIMY 177

Query: 111 ALLSRNQLIGTIPDSVLK-MNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQ 287
             LSRN+L G IP  +    ++L  L L+ N++TGSIP  +G +  +  L L GN ++G 
Sbjct: 178 LRLSRNELSGQIPRGMFNGTSQLVFLSLAYNKLTGSIPGAIGFLPNIQVLVLSGNQLSGP 237

Query: 288 IPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV--LDLSFNKLTGRVPNSLAKAKF 461
           IP++L + + +  + L +N   G+IP+  GS +  M+  ++L+ N LTG VP    + K 
Sbjct: 238 IPASLFNMSSLVRMYLGKNNLSGSIPN-NGSFNLPMLQTVNLNTNHLTGIVPQGFGECKN 296

Query: 462 MGHLDISNNHLCGNIP 509
           +    + +N   G IP
Sbjct: 297 LQEFILFSNGFTGGIP 312

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 56/196 (28%), Positives = 92/196 (46%), Gaps = 25/196 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELP-------------------------SDFGKLRKLS 107
           P SI  +S +  LD+S N + G +P                         +D    + L 
Sbjct: 384 PASIRNMSMISILDISFNSLTGSVPRPIFGPALSELYIDENKLSGDVDFMADLSGCKSLK 443

Query: 108 RALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQ 287
             +++ N   G+IP S+  ++ L       N+ITG+IP    K  +L  + L  N  TG+
Sbjct: 444 YLVMNTNYFTGSIPSSIGNLSSLQIFRAFKNQITGNIPDMTNKSNML-FMDLRNNRFTGE 502

Query: 288 IPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
           IP ++     + +++ S N   GTIP   G KS    L L++NKL G +P+S++    + 
Sbjct: 503 IPVSITEMKDLEMIDFSSNELVGTIPANIG-KSNLFALGLAYNKLHGPIPDSISNLSRLQ 561

Query: 468 HLDISNNHLCGNIPIG 515
            L++SNN L   +P+G
Sbjct: 562 TLELSNNQLTSAVPMG 577

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 40/115 (34%), Positives = 61/115 (53%)
 Frame = +3

Query: 171 RLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGF 350
           R+  L+L   ++ GS+   LG++  LSTL L    ++G IP  + +   +  L+LS N  
Sbjct: 78  RVTALELPGVQLAGSLAPELGELTFLSTLNLSDARLSGPIPDGIGNLPRLLSLDLSSNRL 137

Query: 351 EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG 515
            G +P   G+ +   +LDL  N LTG +P  L   K + +L +S N L G IP G
Sbjct: 138 SGNLPSSLGNLTVLEILDLDSNNLTGEIPPDLHNLKNIMYLRLSRNELSGQIPRG 192

[175][TOP]
>UniRef100_UPI000198440C PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
            RepID=UPI000198440C
          Length = 1060

 Score =  122 bits (305), Expect = 3e-26
 Identities = 70/192 (36%), Positives = 101/192 (52%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I  +  L  + L NN++ G +PS    L +L   LL  N L  +IP ++  +  L  
Sbjct: 538  PNEICLLRNLGEMVLRNNKLSGSIPSCIENLSQLQIMLLDSNSLSSSIPSNLWSLENLWF 597

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N + GS+   +  M++L T+ L  N ++G IP+ L +   +  LNLS N F G+I
Sbjct: 598  LNLSFNSLGGSLHANMRSMKMLQTMDLSWNRISGDIPTILGAFESLSSLNLSGNLFWGSI 657

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P+  G       +DLS N L+G +P SL     + HL++S N L G IP    F +  AA
Sbjct: 658  PESLGELITLDYMDLSHNNLSGSIPKSLVALSHLRHLNLSFNKLSGEIPRDGCFAYFTAA 717

Query: 543  SFSNNDCLCGNP 578
            SF  N  LCG P
Sbjct: 718  SFLENQALCGQP 729

 Score =  103 bits (258), Expect = 7e-21
 Identities = 61/170 (35%), Positives = 88/170 (51%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P++I  IS L  +   +N + G LP+    L   L +  L+RN+L G IP  +   ++L 
Sbjct: 393 PLTIFNISTLEQILSEDNSLSGTLPATLCLLLPNLDKVRLARNKLSGVIPLYLSNCSQLI 452

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            LDL  NR TG +P  +G    L TL LDGN +TG IP  + S T + +L+LS N   G 
Sbjct: 453 HLDLGANRFTGEVPGNIGHSEQLQTLLLDGNQLTGSIPRGIGSLTNLTLLSLSNNNLGGA 512

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           IP           L L  N+L   +PN +   + +G + + NN L G+IP
Sbjct: 513 IPSTIKGMKSLQRLYLGGNQLVDSIPNEICLLRNLGEMVLRNNKLSGSIP 562

 Score = 95.5 bits (236), Expect = 3e-18
 Identities = 54/168 (32%), Positives = 87/168 (51%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P+ +   S L+HLDL  N+  GE+P + G   +L   LL  NQL G+IP  +  +  L  
Sbjct: 442 PLYLSNCSQLIHLDLGANRFTGEVPGNIGHSEQLQTLLLDGNQLTGSIPRGIGSLTNLTL 501

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L LS N + G+IP  +  M+ L  L L GN +   IP+ +     +G + L  N   G+I
Sbjct: 502 LSLSNNNLGGAIPSTIKGMKSLQRLYLGGNQLVDSIPNEICLLRNLGEMVLRNNKLSGSI 561

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           P    + S   ++ L  N L+  +P++L   + +  L++S N L G++
Sbjct: 562 PSCIENLSQLQIMLLDSNSLSSSIPSNLWSLENLWFLNLSFNSLGGSL 609

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 53/163 (32%), Positives = 84/163 (51%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L+ LDL NN   G L  +   L +L   +L +N L G IP+S+    +L  + L+ N
Sbjct: 255 LSFLVGLDLRNNSFHGHLIPEISHLNRLRGLILQQNMLEGLIPESMQHCQKLKVISLTEN 314

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
             TG IP  L  +  L  L L  N++TG IP +L +N+ +  L L +N   GTIP+  G+
Sbjct: 315 EFTGVIPNWLSNLPSLRVLYLGWNNLTGTIPPSLGNNSNLEWLGLEQNHLHGTIPNEIGN 374

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
               M ++ + N  TG +P ++     +  +   +N L G +P
Sbjct: 375 LQNLMGINFADNNFTGLIPLTIFNISTLEQILSEDNSLSGTLP 417

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 62/212 (29%), Positives = 93/212 (43%), Gaps = 26/212 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+     L  + L+ N+  G +P+    L  L    L  N L GTIP S+   + L  
Sbjct: 297 PESMQHCQKLKVISLTENEFTGVIPNWLSNLPSLRVLYLGWNNLTGTIPPSLGNNSNLEW 356

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTL---------------LSNT- 314
           L L  N + G+IP  +G ++ L  +    N+ TG IP T+               LS T 
Sbjct: 357 LGLEQNHLHGTIPNEIGNLQNLMGINFADNNFTGLIPLTIFNISTLEQILSEDNSLSGTL 416

Query: 315 ---------GMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
                     +  + L+RN   G IP    + S  + LDL  N+ TG VP ++  ++ + 
Sbjct: 417 PATLCLLLPNLDKVRLARNKLSGVIPLYLSNCSQLIHLDLGANRFTGEVPGNIGHSEQLQ 476

Query: 468 HLDISNNHLCGNIPIG-SPFDHLDAASFSNND 560
            L +  N L G+IP G     +L   S SNN+
Sbjct: 477 TLLLDGNQLTGSIPRGIGSLTNLTLLSLSNNN 508

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 46/158 (29%), Positives = 71/158 (44%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L +  + G +    G L  L    L  N   G +   +  +NRL  L L  N + G I
Sbjct: 237 LSLGHMGLQGTISPYVGNLSFLVGLDLRNNSFHGHLIPEISHLNRLRGLILQQNMLEGLI 296

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  +   + L  + L  N  TG IP+ L +   + +L L  N   GTIP   G+ S    
Sbjct: 297 PESMQHCQKLKVISLTENEFTGVIPNWLSNLPSLRVLYLGWNNLTGTIPPSLGNNSNLEW 356

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           L L  N L G +PN +   + +  ++ ++N+  G IP+
Sbjct: 357 LGLEQNHLHGTIPNEIGNLQNLMGINFADNNFTGLIPL 394

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 52/191 (27%), Positives = 82/191 (42%), Gaps = 25/191 (13%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           I  ++ L  L L  N + G +P      +KL    L+ N+  G IP+ +  +  L  L L
Sbjct: 276 ISHLNRLRGLILQQNMLEGLIPESMQHCQKLKVISLTENEFTGVIPNWLSNLPSLRVLYL 335

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP-D 368
             N +TG+IP  LG    L  L L+ N + G IP+ + +   +  +N + N F G IP  
Sbjct: 336 GWNNLTGTIPPSLGNNSNLEWLGLEQNHLHGTIPNEIGNLQNLMGINFADNNFTGLIPLT 395

Query: 369 VFGSKSYFMVLD------------------------LSFNKLTGRVPNSLAKAKFMGHLD 476
           +F   +   +L                         L+ NKL+G +P  L+    + HLD
Sbjct: 396 IFNISTLEQILSEDNSLSGTLPATLCLLLPNLDKVRLARNKLSGVIPLYLSNCSQLIHLD 455

Query: 477 ISNNHLCGNIP 509
           +  N   G +P
Sbjct: 456 LGANRFTGEVP 466

[176][TOP]
>UniRef100_UPI000198434B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
            RepID=UPI000198434B
          Length = 1092

 Score =  122 bits (305), Expect = 3e-26
 Identities = 67/192 (34%), Positives = 104/192 (54%)
 Frame = +3

Query: 3    PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
            P  I  +S L  ++L +N++ G +PS  G L  L   LL+ N L  +IP S+  +  L  
Sbjct: 536  PREICVLSNLGEMELQSNRLSGSIPSCIGNLSHLLILLLNSNSLSLSIPPSLWNLENLLS 595

Query: 183  LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            L+LS N + GS+   +  +++L ++ L  N  +G +P+ L     +  LNLS N F G I
Sbjct: 596  LNLSSNSLGGSLHGNMRVLKMLQSIDLSRNKFSGNLPTILGGFQSLSSLNLSHNSFWGPI 655

Query: 363  PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
            P+ F        +DLS N ++G +P S+     + +L++S N+L G IP   PF +  AA
Sbjct: 656  PESFRELITLDYMDLSHNNISGSIPKSMVALSHLQYLNLSFNNLSGEIPSEGPFANFTAA 715

Query: 543  SFSNNDCLCGNP 578
            SF  N+ LCG P
Sbjct: 716  SFVENEALCGLP 727

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 57/163 (34%), Positives = 86/163 (52%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L+  DL NN   G L  + G LR+L    + RN + G IP S+ +  +L  + LS N
Sbjct: 197 LSFLVKFDLYNNSFHGHLIPEIGHLRRLVVLNMHRNLMEGAIPTSLHQCQKLEVISLSTN 256

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           + TG IP  L  +  L TL L  N+ +G IP++L +N+ +  L L RN   G+IP+   +
Sbjct: 257 KFTGVIPNWLSSLPSLHTLFLGRNNFSGTIPASLGNNSKLQWLGLERNNLHGSIPNEIEN 316

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                 +DL  N LT  +P ++     +  L +S NHL G +P
Sbjct: 317 LQNLKGIDLHANNLTALIPLAIFNISSLQILSLSQNHLSGTLP 359

 Score = 86.3 bits (212), Expect = 2e-15
 Identities = 54/167 (32%), Positives = 87/167 (52%), Gaps = 1/167 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRN-QLIGTIPDSVLKMNRLADL 185
           S+ R   L  L +S N + G LP   G L    +  ++ + Q+ G IP  +  +  L  L
Sbjct: 441 SLTRCRSLEKLYISGNPLNGLLPVSIGNLSSSLQDFVAYSCQIKGPIPKEIGSLRNLNQL 500

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           DLS N +TGSIP  +  M+ L  L L GN +   IP  +   + +G + L  N   G+IP
Sbjct: 501 DLSENNMTGSIPSTIKGMKSLQRLYLHGNQLEQSIPREICVLSNLGEMELQSNRLSGSIP 560

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
              G+ S+ ++L L+ N L+  +P SL   + +  L++S+N L G++
Sbjct: 561 SCIGNLSHLLILLLNSNSLSLSIPPSLWNLENLLSLNLSSNSLGGSL 607

 Score = 81.3 bits (199), Expect = 5e-14
 Identities = 53/187 (28%), Positives = 86/187 (45%), Gaps = 2/187 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+ +   L  + LS N+  G +P+    L  L    L RN   GTIP S+   ++L  
Sbjct: 239 PTSLHQCQKLEVISLSTNKFTGVIPNWLSSLPSLHTLFLGRNNFSGTIPASLGNNSKLQW 298

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N + GSIP  +  ++ L  + L  N++T  IP  + + + + IL+LS+N   GT+
Sbjct: 299 LGLERNNLHGSIPNEIENLQNLKGIDLHANNLTALIPLAIFNISSLQILSLSQNHLSGTL 358

Query: 363 PDVFGS-KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIG-SPFDHLD 536
           P  FG        L L  N  +G +P  ++    + ++ +  N   G +P      +HL 
Sbjct: 359 PSSFGLWLPNLEQLYLGINYFSGNIPLYISNCSQLKYIQLPLNQFSGPVPTSLGQLEHLQ 418

Query: 537 AASFSNN 557
                 N
Sbjct: 419 ELDLEIN 425

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 50/158 (31%), Positives = 74/158 (46%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L N  + G +    G L  L +  L  N   G +   +  + RL  L++  N + G+I
Sbjct: 179 LSLRNMGLQGTISPHVGNLSFLVKFDLYNNSFHGHLIPEIGHLRRLVVLNMHRNLMEGAI 238

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  L + + L  + L  N  TG IP+ L S   +  L L RN F GTIP   G+ S    
Sbjct: 239 PTSLHQCQKLEVISLSTNKFTGVIPNWLSSLPSLHTLFLGRNNFSGTIPASLGNNSKLQW 298

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           L L  N L G +PN +   + +  +D+  N+L   IP+
Sbjct: 299 LGLERNNLHGSIPNEIENLQNLKGIDLHANNLTALIPL 336

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 61/202 (30%), Positives = 88/202 (43%), Gaps = 33/202 (16%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGK-LRKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P++I  IS L  L LS N + G LPS FG  L  L +  L  N   G IP  +   ++L 
Sbjct: 335 PLAIFNISSLQILSLSQNHLSGTLPSSFGLWLPNLEQLYLGINYFSGNIPLYISNCSQLK 394

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLS----------------- 308
            + L +N+ +G +P  LG++  L  L L+ N +T Q  S  LS                 
Sbjct: 395 YIQLPLNQFSGPVPTSLGQLEHLQELDLEINQLTSQSDSLELSFLTSLTRCRSLEKLYIS 454

Query: 309 --------NTGMGILNLSRNGF-------EGTIPDVFGSKSYFMVLDLSFNKLTGRVPNS 443
                      +G L+ S   F       +G IP   GS      LDLS N +TG +P++
Sbjct: 455 GNPLNGLLPVSIGNLSSSLQDFVAYSCQIKGPIPKEIGSLRNLNQLDLSENNMTGSIPST 514

Query: 444 LAKAKFMGHLDISNNHLCGNIP 509
           +   K +  L +  N L  +IP
Sbjct: 515 IKGMKSLQRLYLHGNQLEQSIP 536

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 48/162 (29%), Positives = 80/162 (49%), Gaps = 1/162 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L+ L++  N + G +P+   + +KL    LS N+  G IP+ +  +  L  L L  N  +
Sbjct: 224 LVVLNMHRNLMEGAIPTSLHQCQKLEVISLSTNKFTGVIPNWLSSLPSLHTLFLGRNNFS 283

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G+IP  LG    L  L L+ N++ G IP+ + +   +  ++L  N     IP    + S 
Sbjct: 284 GTIPASLGNNSKLQWLGLERNNLHGSIPNEIENLQNLKGIDLHANNLTALIPLAIFNISS 343

Query: 390 FMVLDLSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIPI 512
             +L LS N L+G +P+S       +  L +  N+  GNIP+
Sbjct: 344 LQILSLSQNHLSGTLPSSFGLWLPNLEQLYLGINYFSGNIPL 385

[177][TOP]
>UniRef100_B9IMA7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IMA7_POPTR
          Length = 860

 Score =  122 bits (305), Expect = 3e-26
 Identities = 77/215 (35%), Positives = 105/215 (48%), Gaps = 25/215 (11%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++  IS L  LDLS N++ G +P  F  L +L R  L  NQL GTIP S+ +   L  
Sbjct: 254 PAALANISHLGLLDLSKNKLTGSIPDSFAYLSQLRRLFLYENQLSGTIPPSLGQCVNLEI 313

Query: 183 LDLSMNRITGSIP-------------------------VRLGKMRVLSTLKLDGNSMTGQ 287
           LDLS N I+G+IP                         + L KM ++  + L  N+++G 
Sbjct: 314 LDLSSNDISGTIPREVAGLRSLKLYLNLSRNHLHGPLPLELSKMDMVLAIDLSSNNLSGT 373

Query: 288 IPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
           +P  L S   +  LNLS N  EG +P   G   Y   LD+S N+L+G +P S+  +  + 
Sbjct: 374 VPPQLGSCIALEYLNLSGNVLEGLLPATIGQLPYLKELDVSSNQLSGNIPQSIEASPTLK 433

Query: 468 HLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLCG 572
           HL+ S N   GNI     F  L   SF  ND LCG
Sbjct: 434 HLNFSFNKFSGNISNKGAFSSLTIDSFLGNDGLCG 468

 Score =  107 bits (266), Expect = 9e-22
 Identities = 65/170 (38%), Positives = 97/170 (57%), Gaps = 1/170 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +  L  L+LS+N + G +P +  ++ KL R  LS N L G IP ++  ++ L  
Sbjct: 206 PSHISNLVNLTLLNLSSNLLNGTIPPELCRMGKLERVYLSNNSLSGEIPAALANISHLGL 265

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           LDLS N++TGSIP     +  L  L L  N ++G IP +L     + IL+LS N   GTI
Sbjct: 266 LDLSKNKLTGSIPDSFAYLSQLRRLFLYENQLSGTIPPSLGQCVNLEILDLSSNDISGTI 325

Query: 363 P-DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P +V G +S  + L+LS N L G +P  L+K   +  +D+S+N+L G +P
Sbjct: 326 PREVAGLRSLKLYLNLSRNHLHGPLPLELSKMDMVLAIDLSSNNLSGTVP 375

 Score =  105 bits (261), Expect = 3e-21
 Identities = 62/166 (37%), Positives = 94/166 (56%), Gaps = 1/166 (0%)
 Frame = +3

Query: 15  VRISGLMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADLDL 191
           V  S L  L+L+ N + GE+P   G L  K  +  L  N L G+IP  +  +  L  L+L
Sbjct: 161 VNSSNLQELELAGNNLFGEIPPIIGDLSTKCVQIHLDENILYGSIPSHISNLVNLTLLNL 220

Query: 192 SMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDV 371
           S N + G+IP  L +M  L  + L  NS++G+IP+ L + + +G+L+LS+N   G+IPD 
Sbjct: 221 SSNLLNGTIPPELCRMGKLERVYLSNNSLSGEIPAALANISHLGLLDLSKNKLTGSIPDS 280

Query: 372 FGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           F   S    L L  N+L+G +P SL +   +  LD+S+N + G IP
Sbjct: 281 FAYLSQLRRLFLYENQLSGTIPPSLGQCVNLEILDLSSNDISGTIP 326

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 59/169 (34%), Positives = 88/169 (52%), Gaps = 1/169 (0%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRAL-LSRNQLIGTIPDSVLKMNRLA 179
           P S+ +   L  LDLS+N I G +P +   LR L   L LSRN L G +P  + KM+ + 
Sbjct: 302 PPSLGQCVNLEILDLSSNDISGTIPREVAGLRSLKLYLNLSRNHLHGPLPLELSKMDMVL 361

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGT 359
            +DLS N ++G++P +LG    L  L L GN + G +P+T+     +  L++S N   G 
Sbjct: 362 AIDLSSNNLSGTVPPQLGSCIALEYLNLSGNVLEGLLPATIGQLPYLKELDVSSNQLSGN 421

Query: 360 IPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
           IP    +      L+ SFNK +G + N  A +       + N+ LCG I
Sbjct: 422 IPQSIEASPTLKHLNFSFNKFSGNISNKGAFSSLTIDSFLGNDGLCGQI 470

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 62/178 (34%), Positives = 92/178 (51%), Gaps = 2/178 (1%)
 Frame = +3

Query: 33  MHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITG 212
           +HLD   N + G +PS    L  L+   LS N L GTIP  + +M +L  + LS N ++G
Sbjct: 194 IHLD--ENILYGSIPSHISNLVNLTLLNLSSNLLNGTIPPELCRMGKLERVYLSNNSLSG 251

Query: 213 SIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYF 392
            IP  L  +  L  L L  N +TG IP +    + +  L L  N   GTIP   G     
Sbjct: 252 EIPAALANISHLGLLDLSKNKLTGSIPDSFAYLSQLRRLFLYENQLSGTIPPSLGQCVNL 311

Query: 393 MVLDLSFNKLTGRVPNSLAKAKFMG-HLDISNNHLCGNIPIG-SPFDHLDAASFSNND 560
            +LDLS N ++G +P  +A  + +  +L++S NHL G +P+  S  D + A   S+N+
Sbjct: 312 EILDLSSNDISGTIPREVAGLRSLKLYLNLSRNHLHGPLPLELSKMDMVLAIDLSSNN 369

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 64/184 (34%), Positives = 93/184 (50%), Gaps = 18/184 (9%)
 Frame = +3

Query: 12  IVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSV----------L 161
           +  +S L+ LDLS N   G +P++ G L +L +  LS N L G IP+ +          L
Sbjct: 95  LANLSSLLVLDLSRNFFEGHIPAELGDLLQLRQLSLSWNFLGGNIPEELGFLHQLVYLDL 154

Query: 162 KMNRLA-------DLDLSMNRITGSIPVRLGKMRVLST-LKLDGNSMTGQIPSTLLSNTG 317
             NRLA       +L+L+ N + G IP  +G +      + LD N + G IPS + +   
Sbjct: 155 GNNRLAVNSSNLQELELAGNNLFGEIPPIIGDLSTKCVQIHLDENILYGSIPSHISNLVN 214

Query: 318 MGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLC 497
           + +LNLS N   GTIP           + LS N L+G +P +LA    +G LD+S N L 
Sbjct: 215 LTLLNLSSNLLNGTIPPELCRMGKLERVYLSNNSLSGEIPAALANISHLGLLDLSKNKLT 274

Query: 498 GNIP 509
           G+IP
Sbjct: 275 GSIP 278

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 46/160 (28%), Positives = 77/160 (48%)
 Frame = +3

Query: 33  MHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITG 212
           ++L+LS N + G LP +  K+  +    LS N L GT+P  +     L  L+LS N + G
Sbjct: 337 LYLNLSRNHLHGPLPLELSKMDMVLAIDLSSNNLSGTVPPQLGSCIALEYLNLSGNVLEG 396

Query: 213 SIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYF 392
            +P  +G++  L  L +  N ++G IP ++ ++  +  LN S N F G I +     S  
Sbjct: 397 LLPATIGQLPYLKELDVSSNQLSGNIPQSIEASPTLKHLNFSFNKFSGNISNKGAFSSLT 456

Query: 393 MVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           +   L  + L G++       K M +    N HL   +P+
Sbjct: 457 IDSFLGNDGLCGQI-------KGMPNCRRRNAHLSFILPV 489

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 32/83 (38%), Positives = 44/83 (53%)
 Frame = +3

Query: 255 LKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRV 434
           L L G S+ G+I   L + + + +L+LSRN FEG IP   G       L LS+N L G +
Sbjct: 80  LDLSGLSLRGRISPVLANLSSLLVLDLSRNFFEGHIPAELGDLLQLRQLSLSWNFLGGNI 139

Query: 435 PNSLAKAKFMGHLDISNNHLCGN 503
           P  L     + +LD+ NN L  N
Sbjct: 140 PEELGFLHQLVYLDLGNNRLAVN 162

[178][TOP]
>UniRef100_A7R1A7 Chromosome undetermined scaffold_343, whole genome shotgun sequence
            n=1 Tax=Vitis vinifera RepID=A7R1A7_VITVI
          Length = 849

 Score =  122 bits (305), Expect = 3e-26
 Identities = 69/181 (38%), Positives = 105/181 (58%), Gaps = 1/181 (0%)
 Frame = +3

Query: 39   LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
            +D++NN + GE+PS  G L  L   +LS N+L G IP S+     +   DL  NR++G++
Sbjct: 578  VDMANNSLSGEIPSSMGTLNSLMFLILSGNKLSGEIPSSLQNCKIMDSFDLGDNRLSGNL 637

Query: 219  PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
            P  +G+M+  S + L  N+++G++P  L + + +G LNLS N   G IP+  GS S    
Sbjct: 638  PSWIGEMQ--SFIDLSDNNLSGKLPE-LRNLSRLGTLNLSINHLTGNIPEDIGSLSQLET 694

Query: 399  LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHL-DAASFSNNDCLCGN 575
            LDLS N+L+G +P S+     + HL++S N L G IP  + F    D + + NN  LCG 
Sbjct: 695  LDLSRNQLSGPIPPSMVSLTSLNHLNLSYNKLSGKIPTSNQFQTFNDPSIYKNNLVLCGE 754

Query: 576  P 578
            P
Sbjct: 755  P 755

 Score = 94.0 bits (232), Expect = 8e-18
 Identities = 61/164 (37%), Positives = 91/164 (55%), Gaps = 4/164 (2%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLR-KLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRI 206
           L  L L+N +I   +P  F KL  +L+   ++ NQL G +P+S LK  + A +DLS NR 
Sbjct: 476 LKTLVLNNARISDTIPDWFWKLDLQLNLLDVANNQLSGRVPNS-LKFPKNAVVDLSSNRF 534

Query: 207 TGSIP---VRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFG 377
            G IP     L K+  L++L L  N ++G+IP        + I++++ N   G IP   G
Sbjct: 535 HGPIPHFSSNLSKITGLASLVLSNNHLSGEIPLIWNDKPDLYIVDMANNSLSGEIPSSMG 594

Query: 378 SKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           + +  M L LS NKL+G +P+SL   K M   D+ +N L GN+P
Sbjct: 595 TLNSLMFLILSGNKLSGEIPSSLQNCKIMDSFDLGDNRLSGNLP 638

 Score = 77.8 bits (190), Expect = 6e-13
 Identities = 59/179 (32%), Positives = 84/179 (46%), Gaps = 8/179 (4%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           ++ L  LDLSNN     +P        L+   L+ N L G++PD    +  L  +DLS N
Sbjct: 243 VTSLSMLDLSNNGFNSSIPHWLFNFSSLAYLDLNSNNLQGSVPDGFGFLISLKYIDLSSN 302

Query: 201 R-ITGSIPVRLGKMRVLSTLKLDGNSMTGQIP------STLLSNTGMGILNLSRNG-FEG 356
             I G +P  LGK+  L TLKL  NS++G+I       S  ++ + +  L+L  N    G
Sbjct: 303 LFIGGHLPGNLGKLCNLRTLKLSFNSISGEITGFMDGLSECVNGSSLESLDLGFNDKLGG 362

Query: 357 TIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHL 533
            +PD  G       L L  N   G +PNS+     +    IS N + G IP  S F +L
Sbjct: 363 FLPDALGHLKNLKFLRLWSNSFVGSIPNSIGNLSSLKEFYISENQMNGIIPESSHFSNL 421

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 57/182 (31%), Positives = 92/182 (50%), Gaps = 3/182 (1%)
 Frame = +3

Query: 39   LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIP---DSVLKMNRLADLDLSMNRIT 209
            LD++NNQ+ G +P+   K  K +   LS N+  G IP    ++ K+  LA L LS N ++
Sbjct: 504  LDVANNQLSGRVPNSL-KFPKNAVVDLSSNRFHGPIPHFSSNLSKITGLASLVLSNNHLS 562

Query: 210  GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
            G IP+       L  + +  NS++G+IPS++ +   +  L LS N   G IP    +   
Sbjct: 563  GEIPLIWNDKPDLYIVDMANNSLSGEIPSSMGTLNSLMFLILSGNKLSGEIPSSLQNCKI 622

Query: 390  FMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAASFSNNDCLC 569
                DL  N+L+G +P+ +   +    +D+S+N+L G +P       L   + S N  L 
Sbjct: 623  MDSFDLGDNRLSGNLPSWI--GEMQSFIDLSDNNLSGKLPELRNLSRLGTLNLSINH-LT 679

Query: 570  GN 575
            GN
Sbjct: 680  GN 681

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 49/176 (27%), Positives = 85/176 (48%), Gaps = 7/176 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P ++  +  L  L L +N  +G +P+  G L  L    +S NQ+ G IP+S    N    
Sbjct: 365 PDALGHLKNLKFLRLWSNSFVGSIPNSIGNLSSLKEFYISENQMNGIIPESSHFSNLTNL 424

Query: 183 LDLSMNRITGSIPVRLGKMR------VLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRN 344
            +L++ +++ ++ +             L+ L+L    +  + P+ L +   +  L L+  
Sbjct: 425 TELAIKKVSPNVTLAFNVSSKWIPPFKLNYLELRTCQLGPKFPAWLRNQNQLKTLVLNNA 484

Query: 345 GFEGTIPDVFGSKSYFM-VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
               TIPD F      + +LD++ N+L+GRVPNSL   K    +D+S+N   G IP
Sbjct: 485 RISDTIPDWFWKLDLQLNLLDVANNQLSGRVPNSLKFPK-NAVVDLSSNRFHGPIP 539

 Score = 58.2 bits (139), Expect = 5e-07
 Identities = 43/143 (30%), Positives = 70/143 (48%), Gaps = 8/143 (5%)
 Frame = +3

Query: 30  LMHLDLSNNQIIG-ELPSDFGKLRKLSRALLSRNQLIGTIP------DSVLKMNRLADLD 188
           L ++DLS+N  IG  LP + GKL  L    LS N + G I          +  + L  LD
Sbjct: 294 LKYIDLSSNLFIGGHLPGNLGKLCNLRTLKLSFNSISGEITGFMDGLSECVNGSSLESLD 353

Query: 189 LSMN-RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           L  N ++ G +P  LG ++ L  L+L  NS  G IP+++ + + +    +S N   G IP
Sbjct: 354 LGFNDKLGGFLPDALGHLKNLKFLRLWSNSFVGSIPNSIGNLSSLKEFYISENQMNGIIP 413

Query: 366 DVFGSKSYFMVLDLSFNKLTGRV 434
           +     +   + +L+  K++  V
Sbjct: 414 ESSHFSNLTNLTELAIKKVSPNV 436

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 30/67 (44%), Positives = 42/67 (62%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L  L+LS N + G +P D G L +L    LSRNQL G IP S++ +  L  L+LS N
Sbjct: 665 LSRLGTLNLSINHLTGNIPEDIGSLSQLETLDLSRNQLSGPIPPSMVSLTSLNHLNLSYN 724

Query: 201 RITGSIP 221
           +++G IP
Sbjct: 725 KLSGKIP 731

[179][TOP]
>UniRef100_A7Q693 Chromosome chr11 scaffold_56, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7Q693_VITVI
          Length = 941

 Score =  122 bits (305), Expect = 3e-26
 Identities = 67/192 (34%), Positives = 104/192 (54%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  +S L  ++L +N++ G +PS  G L  L   LL+ N L  +IP S+  +  L  
Sbjct: 385 PREICVLSNLGEMELQSNRLSGSIPSCIGNLSHLLILLLNSNSLSLSIPPSLWNLENLLS 444

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+LS N + GS+   +  +++L ++ L  N  +G +P+ L     +  LNLS N F G I
Sbjct: 445 LNLSSNSLGGSLHGNMRVLKMLQSIDLSRNKFSGNLPTILGGFQSLSSLNLSHNSFWGPI 504

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P+ F        +DLS N ++G +P S+     + +L++S N+L G IP   PF +  AA
Sbjct: 505 PESFRELITLDYMDLSHNNISGSIPKSMVALSHLQYLNLSFNNLSGEIPSEGPFANFTAA 564

Query: 543 SFSNNDCLCGNP 578
           SF  N+ LCG P
Sbjct: 565 SFVENEALCGLP 576

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 57/163 (34%), Positives = 86/163 (52%)
 Frame = +3

Query: 21  ISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMN 200
           +S L+  DL NN   G L  + G LR+L    + RN + G IP S+ +  +L  + LS N
Sbjct: 98  LSFLVKFDLYNNSFHGHLIPEIGHLRRLVVLNMHRNLMEGAIPTSLHQCQKLEVISLSTN 157

Query: 201 RITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGS 380
           + TG IP  L  +  L TL L  N+ +G IP++L +N+ +  L L RN   G+IP+   +
Sbjct: 158 KFTGVIPNWLSSLPSLHTLFLGRNNFSGTIPASLGNNSKLQWLGLERNNLHGSIPNEIEN 217

Query: 381 KSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
                 +DL  N LT  +P ++     +  L +S NHL G +P
Sbjct: 218 LQNLKGIDLHANNLTALIPLAIFNISSLQILSLSQNHLSGTLP 260

 Score = 86.3 bits (212), Expect = 2e-15
 Identities = 54/167 (32%), Positives = 87/167 (52%), Gaps = 1/167 (0%)
 Frame = +3

Query: 9   SIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRN-QLIGTIPDSVLKMNRLADL 185
           S+ R   L  L +S N + G LP   G L    +  ++ + Q+ G IP  +  +  L  L
Sbjct: 290 SLTRCRSLEKLYISGNPLNGLLPVSIGNLSSSLQDFVAYSCQIKGPIPKEIGSLRNLNQL 349

Query: 186 DLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIP 365
           DLS N +TGSIP  +  M+ L  L L GN +   IP  +   + +G + L  N   G+IP
Sbjct: 350 DLSENNMTGSIPSTIKGMKSLQRLYLHGNQLEQSIPREICVLSNLGEMELQSNRLSGSIP 409

Query: 366 DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNI 506
              G+ S+ ++L L+ N L+  +P SL   + +  L++S+N L G++
Sbjct: 410 SCIGNLSHLLILLLNSNSLSLSIPPSLWNLENLLSLNLSSNSLGGSL 456

 Score = 84.0 bits (206), Expect = 8e-15
 Identities = 56/174 (32%), Positives = 86/174 (49%), Gaps = 4/174 (2%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P S+ +   L  + LS N+  G +P+    L  L    L RN   GTIP S+   ++L  
Sbjct: 140 PTSLHQCQKLEVISLSTNKFTGVIPNWLSSLPSLHTLFLGRNNFSGTIPASLGNNSKLQW 199

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L L  N + GSIP  +  ++ L  + L  N++T  IP  + + + + IL+LS+N   GT+
Sbjct: 200 LGLERNNLHGSIPNEIENLQNLKGIDLHANNLTALIPLAIFNISSLQILSLSQNHLSGTL 259

Query: 363 PDVFGS-KSYFMVLDLSFNKLTGRVP---NSLAKAKFMGHLDISNNHLCGNIPI 512
           P  FG        L L  N  +G +P    SL + + +  L IS N L G +P+
Sbjct: 260 PSSFGLWLPNLEQLYLGINYFSGNIPFFLTSLTRCRSLEKLYISGNPLNGLLPV 313

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 50/158 (31%), Positives = 74/158 (46%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L L N  + G +    G L  L +  L  N   G +   +  + RL  L++  N + G+I
Sbjct: 80  LSLRNMGLQGTISPHVGNLSFLVKFDLYNNSFHGHLIPEIGHLRRLVVLNMHRNLMEGAI 139

Query: 219 PVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMV 398
           P  L + + L  + L  N  TG IP+ L S   +  L L RN F GTIP   G+ S    
Sbjct: 140 PTSLHQCQKLEVISLSTNKFTGVIPNWLSSLPSLHTLFLGRNNFSGTIPASLGNNSKLQW 199

Query: 399 LDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPI 512
           L L  N L G +PN +   + +  +D+  N+L   IP+
Sbjct: 200 LGLERNNLHGSIPNEIENLQNLKGIDLHANNLTALIPL 237

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 48/161 (29%), Positives = 79/161 (49%), Gaps = 1/161 (0%)
 Frame = +3

Query: 30  LMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRIT 209
           L+ L++  N + G +P+   + +KL    LS N+  G IP+ +  +  L  L L  N  +
Sbjct: 125 LVVLNMHRNLMEGAIPTSLHQCQKLEVISLSTNKFTGVIPNWLSSLPSLHTLFLGRNNFS 184

Query: 210 GSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSY 389
           G+IP  LG    L  L L+ N++ G IP+ + +   +  ++L  N     IP    + S 
Sbjct: 185 GTIPASLGNNSKLQWLGLERNNLHGSIPNEIENLQNLKGIDLHANNLTALIPLAIFNISS 244

Query: 390 FMVLDLSFNKLTGRVPNSLAK-AKFMGHLDISNNHLCGNIP 509
             +L LS N L+G +P+S       +  L +  N+  GNIP
Sbjct: 245 LQILSLSQNHLSGTLPSSFGLWLPNLEQLYLGINYFSGNIP 285

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 54/175 (30%), Positives = 83/175 (47%), Gaps = 6/175 (3%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSV-LKMNRLA 179
           P  I  +  L  +DL  N +   +P     +  L    LS+N L GT+P S  L +  L 
Sbjct: 212 PNEIENLQNLKGIDLHANNLTALIPLAIFNISSLQILSLSQNHLSGTLPSSFGLWLPNLE 271

Query: 180 DLDLSMNRITGSIP---VRLGKMRVLSTLKLDGNSMTGQIPSTL--LSNTGMGILNLSRN 344
            L L +N  +G+IP     L + R L  L + GN + G +P ++  LS++    +  S  
Sbjct: 272 QLYLGINYFSGNIPFFLTSLTRCRSLEKLYISGNPLNGLLPVSIGNLSSSLQDFVAYSCQ 331

Query: 345 GFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
             +G IP   GS      LDLS N +TG +P+++   K +  L +  N L  +IP
Sbjct: 332 -IKGPIPKEIGSLRNLNQLDLSENNMTGSIPSTIKGMKSLQRLYLHGNQLEQSIP 385

[180][TOP]
>UniRef100_C0LGE4 Probable LRR receptor-like serine/threonine-protein kinase
           At1g12460 n=1 Tax=Arabidopsis thaliana RepID=Y1124_ARATH
          Length = 882

 Score =  122 bits (305), Expect = 3e-26
 Identities = 68/192 (35%), Positives = 101/192 (52%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  ++    L  LDL +N++ G +P   GK+  LS   L  N + G IP  +  +  L  
Sbjct: 301 PTGVMGCKSLKLLDLESNKLNGSIPGSIGKMESLSVIRLGNNSIDGVIPRDIGSLEFLQV 360

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           L+L    + G +P  +   RVL  L + GN + G+I   LL+ T + IL+L RN   G+I
Sbjct: 361 LNLHNLNLIGEVPEDISNCRVLLELDVSGNDLEGKISKKLLNLTNIKILDLHRNRLNGSI 420

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIPIGSPFDHLDAA 542
           P   G+ S    LDLS N L+G +P+SL     + H ++S N+L G IP         ++
Sbjct: 421 PPELGNLSKVQFLDLSQNSLSGPIPSSLGSLNTLTHFNVSYNNLSGVIPPVPMIQAFGSS 480

Query: 543 SFSNNDCLCGNP 578
           +FSNN  LCG+P
Sbjct: 481 AFSNNPFLCGDP 492

 Score = 85.1 bits (209), Expect = 4e-15
 Identities = 57/194 (29%), Positives = 86/194 (44%), Gaps = 25/194 (12%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKL-RKLSRALLSRNQLIGTIPDSVLKMNRLA 179
           P  I  +S L  LDLS N   GE+P    K   K     L+ N + G+IP S++  N L 
Sbjct: 132 PEFISELSSLRFLDLSKNGFTGEIPVSLFKFCDKTKFVSLAHNNIFGSIPASIVNCNNLV 191

Query: 180 DLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQI----------------------- 290
             D S N + G +P R+  + VL  + +  N ++G +                       
Sbjct: 192 GFDFSYNNLKGVLPPRICDIPVLEYISVRNNLLSGDVSEEIQKCQRLILVDLGSNLFHGL 251

Query: 291 -PSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMG 467
            P  +L+   +   N+S N F G I ++         LD S N+LTGR+P  +   K + 
Sbjct: 252 APFAVLTFKNITYFNVSWNRFGGEIGEIVDCSESLEFLDASSNELTGRIPTGVMGCKSLK 311

Query: 468 HLDISNNHLCGNIP 509
            LD+ +N L G+IP
Sbjct: 312 LLDLESNKLNGSIP 325

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 45/169 (26%), Positives = 78/169 (46%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P  I  I  L ++ + NN + G++  +  K ++L    L  N   G  P +VL    +  
Sbjct: 205 PPRICDIPVLEYISVRNNLLSGDVSEEIQKCQRLILVDLGSNLFHGLAPFAVLTFKNITY 264

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
            ++S NR  G I   +     L  L    N +TG+IP+ ++    + +L+L  N   G+I
Sbjct: 265 FNVSWNRFGGEIGEIVDCSESLEFLDASSNELTGRIPTGVMGCKSLKLLDLESNKLNGSI 324

Query: 363 PDVFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
           P   G      V+ L  N + G +P  +   +F+  L++ N +L G +P
Sbjct: 325 PGSIGKMESLSVIRLGNNSIDGVIPRDIGSLEFLQVLNLHNLNLIGEVP 373

 Score = 74.7 bits (182), Expect = 5e-12
 Identities = 54/175 (30%), Positives = 81/175 (46%), Gaps = 3/175 (1%)
 Frame = +3

Query: 3   PMSIVRISGLMHLDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLAD 182
           P SIV  + L+  D S N + G LP     +  L    +  N L G + + + K  RL  
Sbjct: 181 PASIVNCNNLVGFDFSYNNLKGVLPPRICDIPVLEYISVRNNLLSGDVSEEIQKCQRLIL 240

Query: 183 LDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTI 362
           +DL  N   G  P  +   + ++   +  N   G+I   +  +  +  L+ S N   G I
Sbjct: 241 VDLGSNLFHGLAPFAVLTFKNITYFNVSWNRFGGEIGEIVDCSESLEFLDASSNELTGRI 300

Query: 363 PD-VFGSKSYFMVLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP--IGS 518
           P  V G KS   +LDL  NKL G +P S+ K + +  + + NN + G IP  IGS
Sbjct: 301 PTGVMGCKS-LKLLDLESNKLNGSIPGSIGKMESLSVIRLGNNSIDGVIPRDIGS 354

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 47/158 (29%), Positives = 78/158 (49%), Gaps = 1/158 (0%)
 Frame = +3

Query: 39  LDLSNNQIIGELPSDFGKLRKLSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSI 218
           L+L  N+  G LP D+ KL+ L    +S N L G IP+ + +++ L  LDLS N  TG I
Sbjct: 96  LNLFGNRFTGNLPLDYFKLQTLWTINVSSNALSGPIPEFISELSSLRFLDLSKNGFTGEI 155

Query: 219 PVRLGKM-RVLSTLKLDGNSMTGQIPSTLLSNTGMGILNLSRNGFEGTIPDVFGSKSYFM 395
           PV L K       + L  N++ G IP+++++   +   + S N  +G +P          
Sbjct: 156 PVSLFKFCDKTKFVSLAHNNIFGSIPASIVNCNNLVGFDFSYNNLKGVLPPRICDIPVLE 215

Query: 396 VLDLSFNKLTGRVPNSLAKAKFMGHLDISNNHLCGNIP 509
            + +  N L+G V   + K + +  +D+ +N   G  P
Sbjct: 216 YISVRNNLLSGDVSEEIQKCQRLILVDLGSNLFHGLAP 253

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 39/137 (28%), Positives = 71/137 (51%), Gaps = 1/137 (0%)
 Frame = +3

Query: 102 LSRALLSRNQLIGTIPDSVLKMNRLADLDLSMNRITGSIPVRLGKMRVLSTLKLDGNSMT 281
           + + +L    L GT+   +  +  +  L+L  NR TG++P+   K++ L T+ +  N+++
Sbjct: 69  VDKIVLWNTSLAGTLAPGLSNLKFIRVLNLFGNRFTGNLPLDYFKLQTLWTINVSSNALS 128

Query: 282 GQIPSTLLSNTGMGILNLSRNGFEGTIP-DVFGSKSYFMVLDLSFNKLTGRVPNSLAKAK 458