KMC000051A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000051A_C01 KMC000051A_c01
AGAAAAAAAAGATATGTCACACCAATGCACAAAAGCAATTTACAAAATTTTATTCATGTA
CAATATACCGTTCTACCAAAATTGGTATTAGAAGCTTCCAATCTACAAAAGAATTCATCT
ACACAACGGCGCTTCATGTACAACCAAAAGTTTAAGCTGGATAAACAGCTTCAACTCTAT
GTATATGAATATAGTACTCTGGTATTTTCACTCTTTACTATATGAGTGGGCAAAGTCTTG
GATCCTTAGCTGGATATTCTCTAGTTCTGGGTGAAGCACAACAAATATTTTCTTCAGTCT
CTTATGTCTCTGCAAGGGTCCACAACGACGATAGGATTCCTTCAGCTGTTCTAAGATGTC
ATAATATCTATCCATATCCCTGCCTTTAGCATATACTAAATCATCTCCTAGTTGTTGAAA
CTCATTCCTGTAACTCTCCAAAATCTGGTACAGGGAGCAGTAACTATCATATTTATCACC
ATACTCCGGCACATATTCTTTATATGGTGAAAAAGTCATTATAGGCCCCTTCAATTC


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000051A_C01 KMC000051A_c01
         (537 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_566681.1| expressed protein; protein id: At3g21290.1, sup...   132  2e-30
gb|AAK64031.1| unknown protein [Arabidopsis thaliana]                 132  2e-30
dbj|BAB01722.1| gene_id:MXL8.16~unknown protein [Arabidopsis tha...    95  5e-19
gb|AAL13036.1| ELL [Drosophila melanogaster]                           42  0.006
ref|NP_649155.2| CG32217-PA [Drosophila melanogaster] gi|2309309...    42  0.006

>ref|NP_566681.1| expressed protein; protein id: At3g21290.1, supported by cDNA:
            gi_14532605 [Arabidopsis thaliana]
          Length = 1192

 Score =  132 bits (333), Expect = 2e-30
 Identities = 64/109 (58%), Positives = 87/109 (79%)
 Frame = -1

Query: 537  ELKGPIMTFSPYKEYVPEYGDKYDSYCSLYQILESYRNEFQQLGDDLVYAKGRDMDRYYD 358
            ELKGPI     YK Y+ EY DKYDSY S+ +ILES+RN+FQ+LG DL +AKGRD++RY  
Sbjct: 1086 ELKGPISDHLQYKAYMQEYNDKYDSYHSINKILESHRNDFQKLGQDLGFAKGRDVERYNK 1145

Query: 357  ILEQLKESYRRCGPLQRHKRLKKIFVVLHPELENIQLRIQDFAHSYSKE 211
            I+EQ+KESY + G  +RHKRLKK+FVVLH EL++++ R++D+A S+ K+
Sbjct: 1146 IVEQIKESYCKYG--ERHKRLKKVFVVLHEELKHLKQRMRDYASSHGKD 1192

>gb|AAK64031.1| unknown protein [Arabidopsis thaliana]
          Length = 1192

 Score =  132 bits (333), Expect = 2e-30
 Identities = 64/109 (58%), Positives = 87/109 (79%)
 Frame = -1

Query: 537  ELKGPIMTFSPYKEYVPEYGDKYDSYCSLYQILESYRNEFQQLGDDLVYAKGRDMDRYYD 358
            ELKGPI     YK Y+ EY DKYDSY S+ +ILES+RN+FQ+LG DL +AKGRD++RY  
Sbjct: 1086 ELKGPISDHLQYKAYMQEYNDKYDSYHSINKILESHRNDFQKLGQDLGFAKGRDVERYNK 1145

Query: 357  ILEQLKESYRRCGPLQRHKRLKKIFVVLHPELENIQLRIQDFAHSYSKE 211
            I+EQ+KESY + G  +RHKRLKK+FVVLH EL++++ R++D+A S+ K+
Sbjct: 1146 IVEQIKESYCKYG--ERHKRLKKVFVVLHEELKHLKQRMRDYASSHGKD 1192

>dbj|BAB01722.1| gene_id:MXL8.16~unknown protein [Arabidopsis thaliana]
          Length = 1261

 Score = 95.1 bits (235), Expect = 5e-19
 Identities = 45/73 (61%), Positives = 57/73 (77%)
 Frame = -1

Query: 537  ELKGPIMTFSPYKEYVPEYGDKYDSYCSLYQILESYRNEFQQLGDDLVYAKGRDMDRYYD 358
            ELKGPI     YK Y+ EY DKYDSY S+ +ILES+RN+FQ+LG DL +AKGRD++RY  
Sbjct: 1183 ELKGPISDHLQYKAYMQEYNDKYDSYHSINKILESHRNDFQKLGQDLGFAKGRDVERYNK 1242

Query: 357  ILEQLKESYRRCG 319
            I+EQ+KESY + G
Sbjct: 1243 IVEQIKESYCKYG 1255

>gb|AAL13036.1| ELL [Drosophila melanogaster]
          Length = 1060

 Score = 41.6 bits (96), Expect = 0.006
 Identities = 30/100 (30%), Positives = 43/100 (43%), Gaps = 2/100 (2%)
 Frame = -1

Query: 525  PIMTFSPYKEYVPEYGDKYDSYCSLYQILESYRNEFQQLGDDLVYAKGRD--MDRYYDIL 352
            PI T    + Y  E+   YD Y  L   +E  RN FQ L + L  A+  D     Y  I 
Sbjct: 836  PIQTLEVRRRYKTEFESDYDEYRKLLTRVEDVRNRFQDLSERLESARRCDNGYGDYDHIK 895

Query: 351  EQLKESYRRCGPLQRHKRLKKIFVVLHPELENIQLRIQDF 232
             Q+   Y R    +     K+ F  LH +L +I+  + D+
Sbjct: 896  RQIVCEYERINNDRTIGEDKERFDYLHAKLAHIKQLVMDY 935

>ref|NP_649155.2| CG32217-PA [Drosophila melanogaster] gi|23093097|gb|AAF49098.2|
           CG32217-PA [Drosophila melanogaster]
          Length = 625

 Score = 41.6 bits (96), Expect = 0.006
 Identities = 30/100 (30%), Positives = 43/100 (43%), Gaps = 2/100 (2%)
 Frame = -1

Query: 525 PIMTFSPYKEYVPEYGDKYDSYCSLYQILESYRNEFQQLGDDLVYAKGRD--MDRYYDIL 352
           PI T    + Y  E+   YD Y  L   +E  RN FQ L + L  A+  D     Y  I 
Sbjct: 401 PIQTLEVRRRYKTEFESDYDEYRKLLTRVEDVRNRFQDLSERLESARRCDNGYGDYDHIK 460

Query: 351 EQLKESYRRCGPLQRHKRLKKIFVVLHPELENIQLRIQDF 232
            Q+   Y R    +     K+ F  LH +L +I+  + D+
Sbjct: 461 RQIVCEYERINNDRTIGEDKERFDYLHAKLAHIKQLVMDY 500

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 458,483,521
Number of Sequences: 1393205
Number of extensions: 9612023
Number of successful extensions: 26523
Number of sequences better than 10.0: 29
Number of HSP's better than 10.0 without gapping: 25812
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26465
length of database: 448,689,247
effective HSP length: 115
effective length of database: 288,470,672
effective search space used: 18173652336
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 SPDL068g11_f BP056243 1 445
2 GENLf075a11 BP066390 1 467
3 SPDL038b01_f BP054376 5 380
4 GENLf002f08 BP062478 30 537




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research