KMC000050A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000050A_C01 KMC000050A_c01
cagcactgcaccataatcatgtccagcactatttcgctatcattttattttcacccacat
taaacaaaatttgatactctTGACCACAAAATGATGGTAAGACAAGTGGGCATTGCTCCC
TATAGACCACTTCATGATCAACCAGAGTATCACTCGATAAACAATTGTTTTTATTAATAA
ACAAAGCCAAAAAAAATTAAATGCCGAAGCCTACTATAATTAAAGAAACAAAAATAATAA
GTGGGTTTATCTAGTGCAATCAGTGTTCTCTGGCAAGCTTGAGCTTGAGGTTTCTGGTAA
AACTTCTGGTAGAAAAACCCAAAAAAGTAGATGATGGCACATAAAGGTCCACTTATAGAG
GGAGGAAAATGAAGACAATAATAAAAAGCACATACAGTTTTGGGTTTCATCGAAGAAACA
TCCCCAACACTGCTTGCTTCCCGACCAAATTCACGTTCTTGGGAGAAATCCCTTTCACCC
CGTCTCTCATTTTCACGCTTCCTCCTCAGATCAGCTTTTCTAGCTTCAAACTCCTCTCTA
CTCATAACGGGGGGTGGGGGTGGAACATTCATCCCCATGCTGAAGTCAGCAAGATCCCTA
TG


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000050A_C01 KMC000050A_c01
         (602 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_193471.1| hypothetical protein; protein id: At4g17410.1 [...    48  1e-04
pir||E71443 probable DNA-binding protein - Arabidopsis thaliana ...    48  1e-04
ref|NP_199554.1| DNA-binding protein-like; protein id: At5g47430...    44  0.002
ref|NP_723700.1| CG6686-PA [Drosophila melanogaster] gi|16197967...    40  0.030
ref|NP_609529.2| CG6686-PB [Drosophila melanogaster] gi|22946280...    40  0.030

>ref|NP_193471.1| hypothetical protein; protein id: At4g17410.1 [Arabidopsis
           thaliana]
          Length = 744

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 32/75 (42%), Positives = 44/75 (58%), Gaps = 6/75 (8%)
 Frame = -1

Query: 602 HRDLADFSMGMNVPPPPPVMSREEFEARKADLRRKRENE-RRGE-----RDFSQEREFGR 441
           +RDLA+    MN+  P  +M REEFEA+K +++RKRENE RR E     RD  + R    
Sbjct: 489 YRDLAEMGNRMNLQHP--IMGREEFEAKKTEMKRKRENEIRRSEGGNVVRDSEKSRIMNN 546

Query: 440 EASSVGDVSSMKPKT 396
            A +    S +KPK+
Sbjct: 547 SAVT---SSPVKPKS 558

>pir||E71443 probable DNA-binding protein - Arabidopsis thaliana
           gi|2245100|emb|CAB10522.1| DNA-binding protein homolog
           [Arabidopsis thaliana] gi|7268493|emb|CAB78744.1|
           DNA-binding protein homolog [Arabidopsis thaliana]
          Length = 459

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 32/75 (42%), Positives = 44/75 (58%), Gaps = 6/75 (8%)
 Frame = -1

Query: 602 HRDLADFSMGMNVPPPPPVMSREEFEARKADLRRKRENE-RRGE-----RDFSQEREFGR 441
           +RDLA+    MN+  P  +M REEFEA+K +++RKRENE RR E     RD  + R    
Sbjct: 204 YRDLAEMGNRMNLQHP--IMGREEFEAKKTEMKRKRENEIRRSEGGNVVRDSEKSRIMNN 261

Query: 440 EASSVGDVSSMKPKT 396
            A +    S +KPK+
Sbjct: 262 SAVT---SSPVKPKS 273

>ref|NP_199554.1| DNA-binding protein-like; protein id: At5g47430.1 [Arabidopsis
           thaliana]
          Length = 879

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 30/72 (41%), Positives = 38/72 (52%), Gaps = 5/72 (6%)
 Frame = -1

Query: 602 HRDLADFSMGMNVPPPPPVMSREEFEARKADLRRKRENERRGE-----RDFSQEREFGRE 438
           HRDLA+    MN+     +M R+E EAR A++ RKRENERR E     RD    R     
Sbjct: 581 HRDLAEMGNRMNLQRA--MMGRDEAEARNAEMLRKRENERRPEGGKMFRDGENSRMMMNN 638

Query: 437 ASSVGDVSSMKP 402
            +S    SS+ P
Sbjct: 639 GTS-ASASSINP 649

>ref|NP_723700.1| CG6686-PA [Drosophila melanogaster] gi|16197967|gb|AAL13754.1|
           LD23187p [Drosophila melanogaster]
           gi|22946281|gb|AAF53138.2| CG6686-PA [Drosophila
           melanogaster]
          Length = 970

 Score = 39.7 bits (91), Expect = 0.030
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
 Frame = -1

Query: 572 MNVPPPPPVMSREEFEARK-ADLRRKRENERRGERDFSQEREFGREASSVGDVSSMKPKT 396
           +  PPPP +    E+E+R+  ++ R+R+  +R  R+  +ER   R  S     SS KP T
Sbjct: 198 LTAPPPPQISKHAEYESRREREIERERDARKRSGRERERERNRERSRSQSPASSSRKPAT 257

>ref|NP_609529.2| CG6686-PB [Drosophila melanogaster] gi|22946280|gb|AAN10790.1|
           CG6686-PB [Drosophila melanogaster]
          Length = 964

 Score = 39.7 bits (91), Expect = 0.030
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
 Frame = -1

Query: 572 MNVPPPPPVMSREEFEARK-ADLRRKRENERRGERDFSQEREFGREASSVGDVSSMKPKT 396
           +  PPPP +    E+E+R+  ++ R+R+  +R  R+  +ER   R  S     SS KP T
Sbjct: 192 LTAPPPPQISKHAEYESRREREIERERDARKRSGRERERERNRERSRSQSPASSSRKPAT 251

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 549,144,931
Number of Sequences: 1393205
Number of extensions: 12245421
Number of successful extensions: 44249
Number of sequences better than 10.0: 43
Number of HSP's better than 10.0 without gapping: 39532
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43367
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 23711793746
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MRL026e05_f BP085055 1 354
2 GENLf002f05 BP062477 268 603




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research