KMC000049A_c03
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000049A_C03 KMC000049A_c03
GATAAAAAGTAAGCAATCTAGCATTAAGCAATGCAAAAATAAAATCAGCAGATGAGAAAC
AAATCTTTTAAATAACACCAATTACAACCATCAAGAAATCCCTACATCTTAACCTAAAAT
TGAAAATTCAATATTGCAAGCCCAGTTCACATAGCCAACATGTCCTAATTTACTGCCAAC
AAACTGTGGAGCTGCATAATATTACCAAAAAAAGAAAATAACTTACCAAAGAAAAAAGGT
CATATACATTAATATATAGAATGCCCATACTCAAAAATGTGAAGATCACCTGCTCCTTTT
ATTCTTTCTGGAGCAATGTAAATAATGCCAATGCTGTATGAGAACAAAGGGTGAACTTAT
GTAAAGAAAGCAGAAGCCAACAACATTCCAGACCATTTTAGTTAGACACTACTAATTCAG
CTCCACGAGGCAGAATTCCATGTTTGGAAAGGTGCAGTGTAATCAAAAGAATAACAAACC
TTGAGTTAAACTAATTTGACCAGCGAGCTCATTAAGCTATTGCTCATGCATCAACTGTGG
GATAATAACCTGACGGGTAAGTCCTTCCACTTCCATTGGAATCTGCATTAGCATACAATG
GAGACTGAAGTTCCCCAGAATGGGAAGACCTTTTTGACTTGGTGTGCTTCGGAGAAGCTC
CATAATAGTCTCCAGAACTGCTTGAAGAATACATTGTTGATGAAGGTAATCCATGAATTT
TAGGCAAACCAGTTGTTTCAGGTAAACTGTATCCTCTTTCAACTGTTTCAGCTTCCATAG
GAAGCTCCTCCAAGTCCTTAAAAGCCTGCTGATAAGCTCGGAGAAGTTCTCGACAACGCT
TTCTTTTCATGGCTATTTCCTCAGGTTCTTGCAACATCTCTTCAAACAGATTGTCTCTGT
ATAGCTTTTTAATGAAGACATTGTGCAGCTCTCTCTTGGTGTTGTTTACCAAGAAGTGCA
TAATTGCTTTGGGGATAAAATCCTCAACATTTTTTCTGACAATGTCATAGTATGACTTCA
AAAGCAACTTTGTTACTGTAATTTCAATAGCTTCCGTCTCTGAATTGCTCTCAGATGGCC
TCAAGATAGTAGGTGGCTCTCTCAAATGGATCatagagaatgattgttccacactgtgaa
ctggttcagtatgtggcttgctggctatattctccttcacggacatacggct


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000049A_C03 KMC000049A_c03
         (1192 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB86118.1| putative dynamin-like protein ADL2 [Oryza sativa...   228  1e-58
ref|NP_567931.1| dynamin-like protein ADL2; protein id: At4g3365...   213  4e-54
dbj|BAB85644.1| dynamin like protein 2a [Arabidopsis thaliana]        213  4e-54
gb|AAC61784.1| similar to dynamin-like protein encoded by GenBan...   213  4e-54
pir||D84514 dynamin-like protein [imported] - Arabidopsis thaliana    200  3e-50

>dbj|BAB86118.1| putative dynamin-like protein ADL2 [Oryza sativa (japonica
            cultivar-group)]
          Length = 786

 Score =  228 bits (582), Expect = 1e-58
 Identities = 115/192 (59%), Positives = 148/192 (76%), Gaps = 1/192 (0%)
 Frame = -1

Query: 1183 SVKENIASKPHTEPVHSVEQSFSMIHLREPPTILRPSESNSETEAIEITVTKLLLKSYYD 1004
            S K+N ++K +T     +E S S I LREPP +L+PSES SE EA+EI +TKLLLKSYY+
Sbjct: 559  SAKDNSSNKSYTASTSHLEHSLSTIQLREPPVVLKPSESQSEQEALEIAITKLLLKSYYN 618

Query: 1003 IVRKNVEDFIPKAIMHFLVNNTKRELHNVFIKKLYRDNLFEEMLQEPEEIAMKRKRCREL 824
            IVRKNVEDF+PKAIMHFLVN+TKRELHN  I KLYRD+LF +ML+EP+EI +KR++ R+ 
Sbjct: 619  IVRKNVEDFVPKAIMHFLVNHTKRELHNYLITKLYRDDLFADMLREPDEITIKRRQIRDT 678

Query: 823  LRAYQQAFKDLEELPMEAETVERGYSL-PETTGLPKIHGLPSSTMYSSSSSGDYYGASPK 647
            L+  QQA+K L+E+P+EA+TVERGYSL  + TGLP+ HGL SS    SS       ++PK
Sbjct: 679  LKVLQQAYKTLDEIPLEADTVERGYSLDADATGLPRAHGLSSSFQDGSSPY-----STPK 733

Query: 646  HTKSKRSSHSGE 611
              +S++SSHSGE
Sbjct: 734  QPRSRKSSHSGE 745

>ref|NP_567931.1| dynamin-like protein ADL2; protein id: At4g33650.1, supported by
            cDNA: gi_19032334, supported by cDNA: gi_19032336
            [Arabidopsis thaliana] gi|7430320|pir||T04982
            dynamin-like protein ADL2 - Arabidopsis thaliana
            gi|3549667|emb|CAA20578.1| Arabidopsis dynamin-like
            protein ADL2 [Arabidopsis thaliana]
            gi|7270313|emb|CAB80082.1| Arabidopsis dynamin-like
            protein ADL2 [Arabidopsis thaliana]
            gi|19032335|dbj|BAB85643.1| dynamin like protein 2a
            [Arabidopsis thaliana]
          Length = 808

 Score =  213 bits (543), Expect = 4e-54
 Identities = 108/188 (57%), Positives = 144/188 (76%)
 Frame = -1

Query: 1192 SRMSVKENIASKPHTEPVHSVEQSFSMIHLREPPTILRPSESNSETEAIEITVTKLLLKS 1013
            +R   K+++ +KP +E V  +  + SMI+L+EPP +LRP+E++SE EA+EI +TKLLL+S
Sbjct: 620  TRAVTKDSLLNKPFSEAVEDMSHNLSMIYLKEPPAVLRPTETHSEQEAVEIQITKLLLRS 679

Query: 1012 YYDIVRKNVEDFIPKAIMHFLVNNTKRELHNVFIKKLYRDNLFEEMLQEPEEIAMKRKRC 833
            YYDIVRKN+ED +PKAIMHFLVN+TKRELHNVFIKKLYR+NLFEEMLQEP+EIA+KRKR 
Sbjct: 680  YYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRKRT 739

Query: 832  RELLRAYQQAFKDLEELPMEAETVERGYSLPETTGLPKIHGLPSSTMYSSSSSGDYYGAS 653
            +E L   QQA++ L+ELP+EA++V        + G+ K   L +S+ YS+SSS   Y AS
Sbjct: 740  QETLHVLQQAYRTLDELPLEADSV--------SAGMSKHQELLTSSKYSTSSS---YSAS 788

Query: 652  PKHTKSKR 629
            P  T+  R
Sbjct: 789  PSTTRRSR 796

>dbj|BAB85644.1| dynamin like protein 2a [Arabidopsis thaliana]
          Length = 808

 Score =  213 bits (543), Expect = 4e-54
 Identities = 108/188 (57%), Positives = 144/188 (76%)
 Frame = -1

Query: 1192 SRMSVKENIASKPHTEPVHSVEQSFSMIHLREPPTILRPSESNSETEAIEITVTKLLLKS 1013
            +R   K+++ +KP +E V  +  + SMI+L+EPP +LRP+E++SE EA+EI +TKLLL+S
Sbjct: 620  TRAVTKDSLLNKPFSEAVEDMSHNLSMIYLKEPPAVLRPTETHSEQEAVEIQITKLLLRS 679

Query: 1012 YYDIVRKNVEDFIPKAIMHFLVNNTKRELHNVFIKKLYRDNLFEEMLQEPEEIAMKRKRC 833
            YYDIVRKN+ED +PKAIMHFLVN+TKRELHNVFIKKLYR+NLFEEMLQEP+EIA+KRKR 
Sbjct: 680  YYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRKRT 739

Query: 832  RELLRAYQQAFKDLEELPMEAETVERGYSLPETTGLPKIHGLPSSTMYSSSSSGDYYGAS 653
            +E L   QQA++ L+ELP+EA++V        + G+ K   L +S+ YS+SSS   Y AS
Sbjct: 740  QETLHVLQQAYRTLDELPLEADSV--------SAGMSKHQELLTSSKYSTSSS---YSAS 788

Query: 652  PKHTKSKR 629
            P  T+  R
Sbjct: 789  PSTTRRSR 796

>gb|AAC61784.1| similar to dynamin-like protein encoded by GenBank Accession Number
            X99669 [Arabidopsis thaliana]
          Length = 809

 Score =  213 bits (543), Expect = 4e-54
 Identities = 108/188 (57%), Positives = 144/188 (76%)
 Frame = -1

Query: 1192 SRMSVKENIASKPHTEPVHSVEQSFSMIHLREPPTILRPSESNSETEAIEITVTKLLLKS 1013
            +R   K+++ +KP +E V  +  + SMI+L+EPP +LRP+E++SE EA+EI +TKLLL+S
Sbjct: 621  TRAVTKDSLLNKPFSEAVEDMSHNLSMIYLKEPPAVLRPTETHSEQEAVEIQITKLLLRS 680

Query: 1012 YYDIVRKNVEDFIPKAIMHFLVNNTKRELHNVFIKKLYRDNLFEEMLQEPEEIAMKRKRC 833
            YYDIVRKN+ED +PKAIMHFLVN+TKRELHNVFIKKLYR+NLFEEMLQEP+EIA+KRKR 
Sbjct: 681  YYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRKRT 740

Query: 832  RELLRAYQQAFKDLEELPMEAETVERGYSLPETTGLPKIHGLPSSTMYSSSSSGDYYGAS 653
            +E L   QQA++ L+ELP+EA++V        + G+ K   L +S+ YS+SSS   Y AS
Sbjct: 741  QETLHVLQQAYRTLDELPLEADSV--------SAGMSKHQELLTSSKYSTSSS---YSAS 789

Query: 652  PKHTKSKR 629
            P  T+  R
Sbjct: 790  PSTTRRSR 797

>pir||D84514 dynamin-like protein [imported] - Arabidopsis thaliana
          Length = 782

 Score =  200 bits (509), Expect = 3e-50
 Identities = 96/147 (65%), Positives = 123/147 (83%)
 Frame = -1

Query: 1183 SVKENIASKPHTEPVHSVEQSFSMIHLREPPTILRPSESNSETEAIEITVTKLLLKSYYD 1004
            + K N+ +KP +E    V Q+ S I+L+EPPTIL+ SE++SE E++EI +TKLLLKSYYD
Sbjct: 609  AAKNNLLNKPFSETTQEVYQNLSTIYLKEPPTILKSSETHSEQESVEIEITKLLLKSYYD 668

Query: 1003 IVRKNVEDFIPKAIMHFLVNNTKRELHNVFIKKLYRDNLFEEMLQEPEEIAMKRKRCREL 824
            IVRKNVED +PKAIMHFLVN TKRELHNVFI+KLYR+NL EE+L+EP+E+A+KRKR +E 
Sbjct: 669  IVRKNVEDLVPKAIMHFLVNYTKRELHNVFIEKLYRENLIEELLKEPDELAIKRKRTQET 728

Query: 823  LRAYQQAFKDLEELPMEAETVERGYSL 743
            LR  QQA + L+ELP+EAE+VERGY +
Sbjct: 729  LRILQQANRTLDELPLEAESVERGYKI 755

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 995,083,359
Number of Sequences: 1393205
Number of extensions: 21834015
Number of successful extensions: 60119
Number of sequences better than 10.0: 155
Number of HSP's better than 10.0 without gapping: 56139
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 59983
length of database: 448,689,247
effective HSP length: 125
effective length of database: 274,538,622
effective search space used: 74399966562
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf002f03 BP062476 1 581
2 MPDL053e08_f AV779192 9 580
3 SPDL064c10_f BP055971 13 394
4 SPDL098b09_f BP058144 22 688
5 SPDL002d07_f BP052109 38 562
6 MF051c10_f BP030969 42 490
7 MPDL004c08_f AV776710 47 596
8 MPDL073f07_f AV780265 50 585
9 MRL006d02_f BP084008 50 423
10 GENLf056c05 BP065327 53 550
11 MPDL084b10_f AV780857 53 637
12 GENLf005g08 BP062628 54 587
13 SPDL069g04_f BP056297 55 281
14 MPDL015a06_f AV777249 55 611
15 MPDL004g11_f AV776741 55 319
16 MR062a06_f BP080715 55 424
17 GENLf018e02 BP063327 55 580
18 GENLf031e11 BP063981 55 571
19 GENLf080e05 BP066697 55 588
20 GENLf028f07 BP063841 55 528
21 SPDL092a05_f BP057746 55 584
22 MPDL055a02_f AV779267 56 584
23 GNLf005f05 BP075092 56 581
24 GENLf036b10 BP064219 56 585
25 MRL035c10_f BP085438 57 525
26 MPDL058g01_f AV779463 57 584
27 MRL031f11_f BP085270 57 426
28 MFBL041e02_f BP043334 58 571
29 SPDL032f07_f BP054007 62 564
30 GENLf016e01 BP063208 67 564
31 MFBL028c12_f BP042659 67 609
32 MPDL011c06_f AV777079 68 414
33 SPDL090g06_f BP057666 68 595
34 SPDL073f06_f BP056534 84 590
35 MFBL026g12_f BP042593 272 824
36 MFB084c06_f BP040134 672 1204




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research