KMC000048A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000048A_C01 KMC000048A_c01
CGGCAACAGAATTTAATCAAGCAGGAGAACAGTCCAAATCTTTTACATGATGGTAATTGG
CTTACTATATATATGAGGTGACAGATTAAGAATCAAGAATCCTAAGAACTGAAATAGATT
CTGTGGTTACAATTACGAATGGAAGTCTCATCTCTCTATACTTAAATATGAAGAACAAAA
CAACAGGAGGCTTGTGAAGCAGCTATTTATCTACAACCCTTCAACAAATACGAAGAAGGG
CTAGAGAATGTCACACCTGAGGATTGGCTCTTATCATCGCCCGGAGTTTCACATTCGCTG
AAGTCAAGTATGCGACGCTCCACAGGCTGATTATTAGGATCATGGTTTTCCTGTTCCTCA
TCCCGGTCATTTCCAGATGCATCTCTGGGTAACAACGCCTTATGAGTTGGGTTTTCCAAA
ATCTCATGAGCATTGGCATATTGAACTGCGGTTTGTTCACTGACCTGTTTCATCAGTCCG
ATTGCATCGTAGCTTCTATCACCTGGGCTCAACAAATACCCAAAATCCTCAATCGTAAGT
TCAGTGCCAGGCCTGGGGCTA


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000048A_C01 KMC000048A_c01
         (561 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB70511.1| Myb [Nicotiana tabacum]                               112  3e-24
dbj|BAB70510.1| Myb [Nicotiana tabacum]                               106  2e-22
ref|NP_195000.1| putative protein; protein id: At4g32740.1 [Arab...    97  1e-19
ref|NP_568249.1| MYB like protein; protein id: At5g11510.1, supp...    89  4e-17
pir||T48510 MYB like protein - Arabidopsis thaliana gi|7573408|e...    65  6e-10

>dbj|BAB70511.1| Myb [Nicotiana tabacum]
          Length = 1042

 Score =  112 bits (280), Expect = 3e-24
 Identities = 63/121 (52%), Positives = 77/121 (63%), Gaps = 4/121 (3%)
 Frame = -2

Query: 560  SPRPGTELTIEDFGYLLSPGDRSYDAIGLMKQVSEQTAVQYANAHEILENPTHKALLPRD 381
            SPR   EL  ED    +SPGDRSYDAIGLMKQ+SEQTA  +A+A E+L   T +++L   
Sbjct: 922  SPRLDNELNFEDLALFMSPGDRSYDAIGLMKQLSEQTAGAFADAQEVLGGETPESILRGR 981

Query: 380  ASGNDRDEEQENHDPNNQPVERRILDFSECETPGDDKSQ----SSGVTFSSPSSYLLKGC 213
             S N + +E  +    N   ERR LDFSEC +PG  K      +S  +FSSPSSYLLKGC
Sbjct: 982  NSKNQKADENHSLLSANVMSERRTLDFSECGSPGKGKETENFCTSNNSFSSPSSYLLKGC 1041

Query: 212  R 210
            R
Sbjct: 1042 R 1042

>dbj|BAB70510.1| Myb [Nicotiana tabacum]
          Length = 1003

 Score =  106 bits (265), Expect = 2e-22
 Identities = 62/121 (51%), Positives = 75/121 (61%), Gaps = 4/121 (3%)
 Frame = -2

Query: 560  SPRPGTELTIEDFGYLLSPGDRSYDAIGLMKQVSEQTAVQYANAHEILENPTHKALLPRD 381
            S R  TEL  EDF   +SPGDRSYDAIGLMKQ+SEQTA   A+AH+IL + T +  L + 
Sbjct: 883  STRYDTELEFEDFALFMSPGDRSYDAIGLMKQLSEQTAPSIADAHQILGSETPETNLSKR 942

Query: 380  ASGNDRDEEQENHDPNNQPVERRILDFSECETPGDDKSQ----SSGVTFSSPSSYLLKGC 213
             S   + +E      +N   ERR LDF+EC  PG  K      S+  +FSSPSSYLLK C
Sbjct: 943  NSKKPKADENCTLLASNATSERRTLDFNECGIPGKGKETTKFGSNNNSFSSPSSYLLKYC 1002

Query: 212  R 210
            R
Sbjct: 1003 R 1003

>ref|NP_195000.1| putative protein; protein id: At4g32740.1 [Arabidopsis thaliana]
           gi|7459226|pir||T04451 hypothetical protein F4D11.60 -
           Arabidopsis thaliana gi|3063696|emb|CAA18587.1| putative
           protein [Arabidopsis thaliana]
           gi|7270221|emb|CAB79991.1| putative protein [Arabidopsis
           thaliana]
          Length = 235

 Score = 97.1 bits (240), Expect = 1e-19
 Identities = 54/113 (47%), Positives = 71/113 (62%), Gaps = 6/113 (5%)
 Frame = -2

Query: 530 EDFGYLLSPGDRSYDAIGLMKQVSEQTAVQYANAHEILENPTHKALLPRDASGNDRDEEQ 351
           +D G  +SPG+RSYDAIGLMK +SE +A  YA+A E+L N T +++L +         ++
Sbjct: 123 QDIGCFMSPGERSYDAIGLMKHLSEHSATAYADALEVLGNDTPESILKKRQLNKSIQGKE 182

Query: 350 ENHDPNNQ-----PVERRILDFSECETPGDDKSQS-SGVTFSSPSSYLLKGCR 210
             H P++Q      VE R LDFS+C TPG  K  S S   +SSPSSYLLK CR
Sbjct: 183 NQHQPHDQLGNRSQVECRALDFSDCGTPGKAKVPSASPGGYSSPSSYLLKSCR 235

>ref|NP_568249.1| MYB like protein; protein id: At5g11510.1, supported by cDNA:
            gi_15375298 [Arabidopsis thaliana]
            gi|15375299|gb|AAK54739.2|AF371975_1 putative c-myb-like
            transcription factor MYB3R-4 [Arabidopsis thaliana]
          Length = 961

 Score = 89.0 bits (219), Expect = 4e-17
 Identities = 51/119 (42%), Positives = 76/119 (63%), Gaps = 2/119 (1%)
 Frame = -2

Query: 560  SPRPGTELTIEDFGYLLSPGDRSYDAIGLMKQVSEQTA--VQYANAHEILENPTHKALLP 387
            SPR  T+LTIED GY+ SPG+RSY++IG+M Q++E T+    +A+A E+  +PT+     
Sbjct: 859  SPRFDTDLTIEDMGYIFSPGERSYESIGVMTQINEHTSAFAAFADAMEVSISPTN----- 913

Query: 386  RDASGNDRDEEQENHDPNNQPVERRILDFSECETPGDDKSQSSGVTFSSPSSYLLKGCR 210
             D +   ++ ++EN+DP     ERR+LDF++CE+P     +         SSYLLKGCR
Sbjct: 914  -DDARQKKELDKENNDP--LLAERRVLDFNDCESPIKATEE--------VSSYLLKGCR 961

>pir||T48510 MYB like protein - Arabidopsis thaliana gi|7573408|emb|CAB87711.1|
            MYB like protein [Arabidopsis thaliana]
          Length = 952

 Score = 65.1 bits (157), Expect = 6e-10
 Identities = 33/77 (42%), Positives = 53/77 (67%), Gaps = 2/77 (2%)
 Frame = -2

Query: 560  SPRPGTELTIEDFGYLLSPGDRSYDAIGLMKQVSEQTA--VQYANAHEILENPTHKALLP 387
            SPR  T+LTIED GY+ SPG+RSY++IG+M Q++E T+    +A+A E+  +PT+     
Sbjct: 859  SPRFDTDLTIEDMGYIFSPGERSYESIGVMTQINEHTSAFAAFADAMEVSISPTN----- 913

Query: 386  RDASGNDRDEEQENHDP 336
             D +   ++ ++EN+DP
Sbjct: 914  -DDARQKKELDKENNDP 929

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 483,003,320
Number of Sequences: 1393205
Number of extensions: 10255578
Number of successful extensions: 27685
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 26582
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27622
length of database: 448,689,247
effective HSP length: 116
effective length of database: 287,077,467
effective search space used: 20095422690
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf022c01 BP063496 1 512
2 SPDL073e01_f BP056524 1 499
3 GENLf002e10 BP062473 5 562
4 MPDL031c03_f AV778026 18 528
5 SPDL008b03_f BP052453 28 544




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research