KMC000047A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000047A_C01 KMC000047A_c01
CATGACAGTATCAGTTACAACTTTTTTTTTAACAATATCAGTTACAACTTACAAGTATGT
GTATCACTATTTCTATTAATGAATTTAATTTAATTTGAATACACCTTCAGTGTTTTACAC
TGTTTTACAACAATGTGTGTGGTCACATTATTTATCCAATAATGTGGTATAGCCATTATA
AAAGAATCAAATGCTATGCTAAAGGAGCCAAAACATTTTTCAGGACACTGCTTATATACA
ATTGTTAATTACAGGGGTGGCTTGTTTCAGATAAGTTGACTATTCGATCAAGCTGATTTG
TAACAAGGAGGTTACCATTAACATCCAAATCAATGAGGACAGTGTCACCTTGGCTTGCAC
TTTCCACAGAGGAATGCTTCACTCAATGGATCTTCAATTAGTGATGTAATGGCCCTCTTA
AGAGGCCGTGCACCATATGTTGGGTTATACCCTTCCTTGCATACAAGGTTCTTGACTGAT
TCAGACACTTCTAGATCAATTCCTAGGGACATTATCCTTTTCTTTACGTCTTGCAGCAGA
ACATCCAATATCTCAAGCAACTGTGACTTTTCAAGGGATCGAAAGACTACAATTTCATCT
ATC


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000047A_C01 KMC000047A_c01
         (603 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_568750.1| ATP-dependent Clp protease ATP-binding subunit ...   123  2e-27
gb|AAN78327.1| ATP-dependent Clp protease ATP-binding subunit pr...   114  2e-26
ref|NP_487039.1| endopeptidase Clp ATP-binding chain [Nostoc sp....    88  2e-19
pir||S71553 endopeptidase Clp (EC 3.4.21.-) ATP-binding chain cl...    92  4e-18
ref|NP_045112.1| Clp protease ATP binding subunit [Cyanidium cal...    92  7e-18

>ref|NP_568750.1| ATP-dependent Clp protease ATP-binding subunit (ClpD), ERD1 protein
            precursor; protein id: At5g51070.1, supported by cDNA:
            gi_14334877, supported by cDNA: gi_14335169, supported by
            cDNA: gi_443696 [Arabidopsis thaliana]
            gi|1169544|sp|P42762|ERD1_ARATH ERD1 protein, chloroplast
            precursor gi|541859|pir||JN0901 endopeptidase Clp
            ATP-binding chain C - Arabidopsis thaliana
            gi|497629|dbj|BAA04506.1| ERD1 protein [Arabidopsis
            thaliana] gi|14334878|gb|AAK59617.1| putative
            ATP-dependent Clp protease ATP-binding subunit ClpD, ERD1
            protein precursor [Arabidopsis thaliana]
            gi|22136916|gb|AAM91802.1| putative ATP-dependent Clp
            protease ATP-binding subunit ClpD, ERD1 protein precursor
            [Arabidopsis thaliana]
          Length = 945

 Score =  123 bits (308), Expect = 2e-27
 Identities = 54/84 (64%), Positives = 73/84 (86%)
 Frame = -2

Query: 602  IDEIVVFRSLEKSQLLEILDVLLQDVKKRIMSLGIDLEVSESVKNLVCKEGYNPTYGARP 423
            IDEIV+FR LEK+Q++EIL+++LQD+K R+++LG+ LEVSE VK L+CK+GY+P YGARP
Sbjct: 828  IDEIVIFRQLEKAQMMEILNLMLQDLKSRLVALGVGLEVSEPVKELICKQGYDPAYGARP 887

Query: 422  LKRAITSLIEDPLSEAFLCGKCKP 351
            L+R +T ++EDPLSEAFL G  KP
Sbjct: 888  LRRTVTEIVEDPLSEAFLAGSFKP 911

>gb|AAN78327.1| ATP-dependent Clp protease ATP-binding subunit precursor [Oryza
            sativa (indica cultivar-group)]
          Length = 938

 Score =  114 bits (284), Expect(2) = 2e-26
 Identities = 53/84 (63%), Positives = 74/84 (88%)
 Frame = -2

Query: 602  IDEIVVFRSLEKSQLLEILDVLLQDVKKRIMSLGIDLEVSESVKNLVCKEGYNPTYGARP 423
            IDE+VVFR LEK+Q+L ILD++LQ+VK R+++LGI LEVS+++K+L+C+EGY+ +YGARP
Sbjct: 822  IDEMVVFRPLEKTQMLAILDIILQEVKGRLLALGIGLEVSDAMKDLICEEGYDKSYGARP 881

Query: 422  LKRAITSLIEDPLSEAFLCGKCKP 351
            L+RA+T LIED +SEA L G+ KP
Sbjct: 882  LRRAVTHLIEDVISEAILFGEYKP 905

 Score = 26.9 bits (58), Expect(2) = 2e-26
 Identities = 10/28 (35%), Positives = 20/28 (70%)
 Frame = -3

Query: 349 GDTVLIDLDVNGNLLVTNQLDRIVNLSE 266
           GDT+L+D+D  G   +++  +++V LS+
Sbjct: 906 GDTILMDIDAAGKPCMSHLNEKVVQLSD 933

>ref|NP_487039.1| endopeptidase Clp ATP-binding chain [Nostoc sp. PCC 7120]
           gi|25289939|pir||AH2180 endopeptidase Clp ATP-binding
           chain [imported] - Nostoc sp.  (strain PCC 7120)
           gi|17132093|dbj|BAB74698.1| endopeptidase Clp
           ATP-binding chain [Nostoc sp. PCC 7120]
          Length = 839

 Score = 87.8 bits (216), Expect(2) = 2e-19
 Identities = 42/83 (50%), Positives = 60/83 (71%)
 Frame = -2

Query: 602 IDEIVVFRSLEKSQLLEILDVLLQDVKKRIMSLGIDLEVSESVKNLVCKEGYNPTYGARP 423
           +DEI+VFR L K ++ EI D++L++V  R+   GI LEVS+  K  + +EGY+P+YGARP
Sbjct: 725 LDEIIVFRQLSKLEVTEIADIMLKEVFGRLTEKGITLEVSDRFKGRLIEEGYSPSYGARP 784

Query: 422 LKRAITSLIEDPLSEAFLCGKCK 354
           L+RAI  L+ED L+E  L G+ K
Sbjct: 785 LRRAIMRLLEDSLAEEILSGRIK 807

 Score = 29.6 bits (65), Expect(2) = 2e-19
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = -3

Query: 349 GDTVLIDLDVNGNLLVTNQLDR 284
           GD  LID+D NGN+ VT+Q  R
Sbjct: 809 GDVALIDIDENGNVQVTSQQRR 830

>pir||S71553 endopeptidase Clp (EC 3.4.21.-) ATP-binding chain clpC [similarity]
           - Synechococcus sp. (strain PCC 7942)
           gi|755163|gb|AAB67745.1| ClpC
          Length = 839

 Score = 92.4 bits (228), Expect = 4e-18
 Identities = 43/83 (51%), Positives = 62/83 (73%)
 Frame = -2

Query: 602 IDEIVVFRSLEKSQLLEILDVLLQDVKKRIMSLGIDLEVSESVKNLVCKEGYNPTYGARP 423
           +DEI+VFR L K ++ EI D++L++V  R++  GI L V+E  K+ + +EGYNP+YGARP
Sbjct: 726 LDEIIVFRQLNKEEVKEIADIMLREVFGRMLEKGISLSVTEKFKDRLVEEGYNPSYGARP 785

Query: 422 LKRAITSLIEDPLSEAFLCGKCK 354
           L+RAI  L+ED L+E FL GK +
Sbjct: 786 LRRAIMRLLEDSLAEEFLSGKLR 808

>ref|NP_045112.1| Clp protease ATP binding subunit [Cyanidium caldarium]
           gi|14194537|sp|Q9TM05|CLPC_CYACA ATP-dependent clp
           protease ATP-binding subunit clpA homolog
           gi|6466400|gb|AAF12982.1|AF022186_105 unknown; Clp
           protease ATP binding subunit [Cyanidium caldarium]
          Length = 854

 Score = 91.7 bits (226), Expect = 7e-18
 Identities = 41/83 (49%), Positives = 62/83 (74%)
 Frame = -2

Query: 602 IDEIVVFRSLEKSQLLEILDVLLQDVKKRIMSLGIDLEVSESVKNLVCKEGYNPTYGARP 423
           +DEI+VFR L K ++ +I  ++L+++ +R+   GI L+V+E  KNL+ +EGYNP+YGARP
Sbjct: 742 VDEIIVFRQLTKDEVRDIAHIMLREIFERVKQQGISLQVTERFKNLLIEEGYNPSYGARP 801

Query: 422 LKRAITSLIEDPLSEAFLCGKCK 354
           L+RA+  L+ED L+E  L GK K
Sbjct: 802 LRRALVRLLEDSLAEEVLSGKIK 824

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 467,604,727
Number of Sequences: 1393205
Number of extensions: 9392199
Number of successful extensions: 21206
Number of sequences better than 10.0: 401
Number of HSP's better than 10.0 without gapping: 20665
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21193
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 23711793746
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GNLf011f11 BP075479 1 465
2 MFL019a03_f BP033849 1 429
3 SPDL049h02_f BP055106 5 383
4 MRL010d05_f BP084207 7 111
5 MFBL039a04_f BP043206 12 417
6 SPDL060h03_f BP055774 44 532
7 GENLf039c09 BP064391 44 571
8 SPDL013e04_f BP052798 47 511
9 GENLf002e08 BP062472 58 610
10 GENLf086f03 BP067044 69 568
11 MRL007c04_f BP084049 81 414




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research