KMC000046A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000046A_C01 KMC000046A_c01
gaTAGTTTTACCATTAAATACATTCAAGCAAACATGTAAACACACAAAGTACCACAATTC
AGGGAAAGTATAAGTAACATAATCAAAAGAGATGGAACAAAGTTACAACTTCTTCAAGAT
AGATTACAGGGTGTATACATGAACCCGGTATCTATTTAGCTGGACCATTCTCCGTAACTG
CATCATATGTCCTGCATCAGTATCTCCAAGCCTCCTAAATGTAGCCTTATAGAAGTCAAA
TCGCCAGCAACAAACCTCACCCTTTAGGCCAAAATGGGTATGTCTTTCGCCTCATATCTC
ACCAATGGAGTATCAAAGAATTTCTCATTGGGTCCAAGATCCATTTGGAAGTAGAACATT
TATTTGCATGAGGCAAGGGTCCGAAATAATTTCACACCGTAAGTAAAGAAATTAAGTTAA
TACTAACAATTAAACCCTATCATAGTTAAGAAAAACACAGAACAAAGCAGGGGTTCGGGA
GCATTGATGAGATCAGCAATGAGATCAACATTCCAAATCAACTGCTCACAACGCAGCTCT
TCGACTTCATCATCATCTTCTTCATCTTCACTAACTAAATCAATAGTCATATCATTGCCT
TCATCCTCAGAAAATATATCATTATTGGCACGGCTTGGACCTGCAGCGGTACGAACAGGA
TGACCAGTGTTCATCCTGTAGTGAATCTCATTGAGCTGCACATCATAAATTCTGATGCTA
AACTTAGGTTCACCTTGAAAAACAAACTGAATCATCATAGTTTCCTGACTTTGGTGGACT
GCCCGCAACACCGGAATCTTGCTTCACCATCATTGTAATAAAAACTCACAGTGAATCTGT
TCCCTACAGGATCTTGTAATTCAACAAACTCATCGAGTTCTTCACCAAAACGCTGTAAGA
AACGTCTCTCCCACAT


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000046A_C01 KMC000046A_c01
         (916 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAA98791.1| Gallus gallus vitellogenin                              37  0.32
pir||VJCH2 vitellogenin II precursor [validated] - chicken gi|21...    37  0.32
sp|P02845|VIT2_CHICK Vitellogenin II precursor (Major vitellogen...    37  0.32
ref|ZP_00065776.1| hypothetical protein [Microbulbifer degradans...    36  0.93
gb|AAO50987.1| hypothetical protein [Dictyostelium discoideum]         35  1.2

>gb|AAA98791.1| Gallus gallus vitellogenin
          Length = 247

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 25/68 (36%), Positives = 43/68 (62%)
 Frame = +1

Query: 454 NTEQSRGSGALMRSAMRSTFQINCSQRSSSTSSSSSSSSLTKSIVISLPSSSENISLLAR 633
           ++  S+ S +  RS+ +S+   N S+RSSS+SSSSSSSS + S   S  S+S++ S  ++
Sbjct: 78  SSRSSKSSNSSKRSSSKSS---NSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSK 134

Query: 634 LGPAAVRT 657
              ++ R+
Sbjct: 135 SSSSSSRS 142

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 23/58 (39%), Positives = 35/58 (59%)
 Frame = +1

Query: 448 KKNTEQSRGSGALMRSAMRSTFQINCSQRSSSTSSSSSSSSLTKSIVISLPSSSENIS 621
           K+++  S  S +  RS+  S+   + S+ SSS+S SSSSSS ++S   S  SSS + S
Sbjct: 100 KRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSS 157

 Score = 33.1 bits (74), Expect = 6.0
 Identities = 22/56 (39%), Positives = 34/56 (60%)
 Frame = +1

Query: 454 NTEQSRGSGALMRSAMRSTFQINCSQRSSSTSSSSSSSSLTKSIVISLPSSSENIS 621
           ++  S+ S +  +S+  S+   + S+ SSS+SSSSSSSS   S   S  SSS++ S
Sbjct: 122 SSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKSSS 177

>pir||VJCH2 vitellogenin II precursor [validated] - chicken
            gi|212881|gb|AAA49139.1| vitellogenin
          Length = 1852

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 25/68 (36%), Positives = 43/68 (62%)
 Frame = +1

Query: 454  NTEQSRGSGALMRSAMRSTFQINCSQRSSSTSSSSSSSSLTKSIVISLPSSSENISLLAR 633
            ++  S+ S +  RS+ +S+   N S+RSSS+SSSSSSSS + S   S  S+S++ S  ++
Sbjct: 1171 SSRSSKSSNSSKRSSSKSS---NSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSK 1227

Query: 634  LGPAAVRT 657
               ++ R+
Sbjct: 1228 SSSSSSRS 1235

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 23/58 (39%), Positives = 35/58 (59%)
 Frame = +1

Query: 448  KKNTEQSRGSGALMRSAMRSTFQINCSQRSSSTSSSSSSSSLTKSIVISLPSSSENIS 621
            K+++  S  S +  RS+  S+   + S+ SSS+S SSSSSS ++S   S  SSS + S
Sbjct: 1193 KRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSS 1250

 Score = 33.1 bits (74), Expect = 6.0
 Identities = 22/56 (39%), Positives = 34/56 (60%)
 Frame = +1

Query: 454  NTEQSRGSGALMRSAMRSTFQINCSQRSSSTSSSSSSSSLTKSIVISLPSSSENIS 621
            ++  S+ S +  +S+  S+   + S+ SSS+SSSSSSSS   S   S  SSS++ S
Sbjct: 1215 SSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKSSS 1270

>sp|P02845|VIT2_CHICK Vitellogenin II precursor (Major vitellogenin) [Contains:
            Lipovitellin I (LVI); Phosvitin (PV); Lipovitellin II
            (LVII); YGP40] gi|63887|emb|CAA31942.1| vitellogenin
            [Gallus gallus]
          Length = 1850

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 25/68 (36%), Positives = 43/68 (62%)
 Frame = +1

Query: 454  NTEQSRGSGALMRSAMRSTFQINCSQRSSSTSSSSSSSSLTKSIVISLPSSSENISLLAR 633
            ++  S+ S +  RS+ +S+   N S+RSSS+SSSSSSSS + S   S  S+S++ S  ++
Sbjct: 1169 SSRSSKSSNSSKRSSSKSS---NSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSK 1225

Query: 634  LGPAAVRT 657
               ++ R+
Sbjct: 1226 SSSSSSRS 1233

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 23/58 (39%), Positives = 35/58 (59%)
 Frame = +1

Query: 448  KKNTEQSRGSGALMRSAMRSTFQINCSQRSSSTSSSSSSSSLTKSIVISLPSSSENIS 621
            K+++  S  S +  RS+  S+   + S+ SSS+S SSSSSS ++S   S  SSS + S
Sbjct: 1191 KRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSS 1248

 Score = 33.1 bits (74), Expect = 6.0
 Identities = 22/56 (39%), Positives = 34/56 (60%)
 Frame = +1

Query: 454  NTEQSRGSGALMRSAMRSTFQINCSQRSSSTSSSSSSSSLTKSIVISLPSSSENIS 621
            ++  S+ S +  +S+  S+   + S+ SSS+SSSSSSSS   S   S  SSS++ S
Sbjct: 1213 SSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSSSSSSKSSS 1268

>ref|ZP_00065776.1| hypothetical protein [Microbulbifer degradans 2-40]
          Length = 867

 Score = 35.8 bits (81), Expect = 0.93
 Identities = 24/60 (40%), Positives = 33/60 (55%)
 Frame = +1

Query: 442 IVKKNTEQSRGSGALMRSAMRSTFQINCSQRSSSTSSSSSSSSLTKSIVISLPSSSENIS 621
           I +   E   G+G ++ S   S+   + S  SSS+SSSSSSSS + S   S  SSS + S
Sbjct: 698 IGRTTCESQSGNGGVINSCGTSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSSS 757

>gb|AAO50987.1| hypothetical protein [Dictyostelium discoideum]
          Length = 1126

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 21/52 (40%), Positives = 31/52 (59%)
 Frame = +1

Query: 454 NTEQSRGSGALMRSAMRSTFQINCSQRSSSTSSSSSSSSLTKSIVISLPSSS 609
           NT  S  S +   S+  S+   + S  SSS+SSSSSSSS + S + ++ S+S
Sbjct: 373 NTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNIATMTSAS 424

 Score = 33.5 bits (75), Expect = 4.6
 Identities = 22/55 (40%), Positives = 29/55 (52%)
 Frame = +1

Query: 493 SAMRSTFQINCSQRSSSTSSSSSSSSLTKSIVISLPSSSENISLLARLGPAAVRT 657
           S+  S+   + S  SSS+SSSSSSSS + S   S  SSS NI+ +         T
Sbjct: 376 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNIATMTSASTTTTST 430

 Score = 33.5 bits (75), Expect = 4.6
 Identities = 28/80 (35%), Positives = 39/80 (48%), Gaps = 6/80 (7%)
 Frame = +1

Query: 436 PIIVKKNTEQSRGS------GALMRSAMRSTFQINCSQRSSSTSSSSSSSSLTKSIVISL 597
           PI+  K T     S       +L  +   S+   + S  SSS+SSSSSSSS + S   S 
Sbjct: 348 PIVELKKTSSWMSSFFTKVLPSLSTNTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 407

Query: 598 PSSSENISLLARLGPAAVRT 657
            SSS + S +A +  A+  T
Sbjct: 408 SSSSSSSSNIATMTSASTTT 427

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 758,791,915
Number of Sequences: 1393205
Number of extensions: 16706964
Number of successful extensions: 87749
Number of sequences better than 10.0: 88
Number of HSP's better than 10.0 without gapping: 50390
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 69472
length of database: 448,689,247
effective HSP length: 123
effective length of database: 277,325,032
effective search space used: 50195830792
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 SPDL007a05_f BP052384 1 484
2 MRL013h09_f BP084407 3 521
3 GNLf014e03 BP075623 342 803
4 SPDL062a03_f BP055835 346 771
5 GENLf049a08 BP064938 346 801
6 MWL029f11_f AV769054 347 876
7 MRL018h10_f BP084662 347 637
8 GENLf002e05 BP062471 348 904
9 SPDL073f05_f BP056533 349 886
10 GENLf029b06 BP063861 405 920




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research