KMC000045A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000045A_C01 KMC000045A_c01
atcaatacccttggagaaaaaggggaaaagtggtcgccatagcaactaccacttATCTTA
ACATGATAAATTAAGTGGCAAATGAAAATATTTAACCCATTGAATTATTGACATGGTTGG
AGTATTTACAGAAGGAAAAGTGTTGGTCACTTTTCCAGAAGACATGACTCAATTGAAGAC
CAACCTCTGACTATGTACAAGAAGGTCAGCAAAAGCAGCATGCTTTTTAAGGAGGTAAAC
TATAATTTTCAGTTGATGTCAAAGGTATCTTGGATCTTCAGGGAAATGGTATTCCACGTT
CAACTTTCCCTCATCAGCATCTGTATGACGTTGAGGAAACACAACCCTTAAATCATTACA
TAAGTAGAATTTACGTTCCCCTTCTATGTCCAATCCAGCTTTTTCAGGGACAGAATTATA
TCTGCATTTTTGAACTGATCTATTGGTCCTCTTGGGAAAAGGGCAAATAAATCGGAGGTG
GAGAGCATAACGAAGTGGACCAACAATATTAGAATTCTCTTTGACCTTTGAACAGGAATT
TAATGATTTCCCTGATTCATCACATGTTTTATCCCAGCACCCCTTGCGATCATTCCTTTC
AAGTTTATCAGTAATGCATCCATGATCAAGCTTTAC


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000045A_C01 KMC000045A_c01
         (636 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB01236.1| gene_id:MDJ14.23~unknown protein [Arabidopsis th...   116  3e-25
ref|NP_566803.1| expressed protein; protein id: At3g26890.1 [Ara...   116  3e-25
ref|NP_198927.1| unknown protein; protein id: At5g41110.1 [Arabi...   105  5e-22
pir||T33124 hypothetical protein B0511.1 - Caenorhabditis elegans      35  0.83
ref|NP_492792.1| FK506 Binding protein family FKB-7 (36.2 kD) (f...    35  0.83

>dbj|BAB01236.1| gene_id:MDJ14.23~unknown protein [Arabidopsis thaliana]
          Length = 724

 Score =  116 bits (290), Expect = 3e-25
 Identities = 59/119 (49%), Positives = 79/119 (65%), Gaps = 7/119 (5%)
 Frame = -1

Query: 600 ERNDRKGCW--DKTCDESGKSLNSCSKV-----KENSNIVGPLRYALHLRFICPFPKRTN 442
           +  D++ C   D      G  L+   K+     KE +   G LRYALHLRF+CP PK+++
Sbjct: 603 KHGDKESCEGSDSVDSVEGDVLHESGKICLKPSKECNGGSGALRYALHLRFLCPLPKKSS 662

Query: 441 RSVQKCRYNSVPEKAGLDIEGERKFYLCNDLRVVFPQRHTDADEGKLNVEYHFPEDPRY 265
           +  ++    S  +K  LD +G+R+FYL NDLRVVFPQRHTD+DEGKLNVEYH+PE+PRY
Sbjct: 663 KKSEETE--STGQKKNLDSDGKRRFYLYNDLRVVFPQRHTDSDEGKLNVEYHYPENPRY 719

>ref|NP_566803.1| expressed protein; protein id: At3g26890.1 [Arabidopsis thaliana]
           gi|15293103|gb|AAK93662.1| unknown protein [Arabidopsis
           thaliana] gi|21436343|gb|AAM51341.1| unknown protein
           [Arabidopsis thaliana]
          Length = 649

 Score =  116 bits (290), Expect = 3e-25
 Identities = 59/119 (49%), Positives = 79/119 (65%), Gaps = 7/119 (5%)
 Frame = -1

Query: 600 ERNDRKGCW--DKTCDESGKSLNSCSKV-----KENSNIVGPLRYALHLRFICPFPKRTN 442
           +  D++ C   D      G  L+   K+     KE +   G LRYALHLRF+CP PK+++
Sbjct: 528 KHGDKESCEGSDSVDSVEGDVLHESGKICLKPSKECNGGSGALRYALHLRFLCPLPKKSS 587

Query: 441 RSVQKCRYNSVPEKAGLDIEGERKFYLCNDLRVVFPQRHTDADEGKLNVEYHFPEDPRY 265
           +  ++    S  +K  LD +G+R+FYL NDLRVVFPQRHTD+DEGKLNVEYH+PE+PRY
Sbjct: 588 KKSEETE--STGQKKNLDSDGKRRFYLYNDLRVVFPQRHTDSDEGKLNVEYHYPENPRY 644

>ref|NP_198927.1| unknown protein; protein id: At5g41110.1 [Arabidopsis thaliana]
           gi|9759157|dbj|BAB09713.1| gene_id:MEE6.18~unknown
           protein [Arabidopsis thaliana]
          Length = 621

 Score =  105 bits (262), Expect = 5e-22
 Identities = 58/106 (54%), Positives = 71/106 (66%), Gaps = 1/106 (0%)
 Frame = -1

Query: 579 CWDKTCDESGKSLNS-CSKVKENSNIVGPLRYALHLRFICPFPKRTNRSVQKCRYNSVPE 403
           C +K C E+ +     CSK        G LRYALHL+FICP  K+ ++  QK   +    
Sbjct: 527 CGNKNCRETYRETGQRCSKS-------GVLRYALHLKFICPLRKKASKLGQKKSLD---- 575

Query: 402 KAGLDIEGERKFYLCNDLRVVFPQRHTDADEGKLNVEYHFPEDPRY 265
            AG D  GER+FYL N+LRVVFPQRHTD+DEGKLNVEYH+PE+PRY
Sbjct: 576 -AGDD--GERRFYLYNELRVVFPQRHTDSDEGKLNVEYHYPENPRY 618

>pir||T33124 hypothetical protein B0511.1 - Caenorhabditis elegans
          Length = 360

 Score = 35.0 bits (79), Expect = 0.83
 Identities = 14/44 (31%), Positives = 27/44 (60%)
 Frame = +3

Query: 267 ILDLQGNGIPRSTFPHQHLYDVEETQPLNHYISRIYVPLLCPIQ 398
           +++++G G P S+   +HL +++   PL+  I + +VP  CP Q
Sbjct: 88  VIEIRGEGAPMSSAQIRHLEEMDNGGPLDIKIEKTFVPAKCPQQ 131

>ref|NP_492792.1| FK506 Binding protein family FKB-7 (36.2 kD) (fkb-7)
           [Caenorhabditis elegans] gi|15375226|gb|AAC17657.2|
           Fk506-binding protein family protein 7 [Caenorhabditis
           elegans]
          Length = 318

 Score = 35.0 bits (79), Expect = 0.83
 Identities = 14/44 (31%), Positives = 27/44 (60%)
 Frame = +3

Query: 267 ILDLQGNGIPRSTFPHQHLYDVEETQPLNHYISRIYVPLLCPIQ 398
           +++++G G P S+   +HL +++   PL+  I + +VP  CP Q
Sbjct: 46  VIEIRGEGAPMSSAQIRHLEEMDNGGPLDIKIEKTFVPAKCPQQ 89

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 542,939,810
Number of Sequences: 1393205
Number of extensions: 11609044
Number of successful extensions: 25270
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 24391
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25255
length of database: 448,689,247
effective HSP length: 118
effective length of database: 284,291,057
effective search space used: 26439068301
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf002e04 BP062470 1 555
2 GENLf086f12 BP067051 55 555
3 GENLf031c03 BP063963 59 530
4 GENLf086g09 BP067054 65 496
5 GENLf013f07 BP063040 66 573
6 MWL005c07_f AV768644 73 645
7 MPDL084c05_f AV780863 78 564
8 SPDL095a09_f BP057941 78 612
9 MPDL077d05_f AV780468 81 612
10 MRL018h02_f BP084658 82 585
11 GENLf052b08 BP065116 86 585
12 SPDL077f03_f BP056794 88 596
13 MFBL030g03_f BP042777 90 563
14 GENLf007d02 BP062713 113 644
15 GNLf005h06 BP075111 117 271




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research