KMC000044A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000044A_C02 KMC000044A_c02
tttttttttttttttGGCAAATCAAAATTACAATTTATTCATGACTGCTATGGAACTAAT
AATTCACATAAAAACTACCGTTATCATTACGGGCTGCCAGAACAAATAGTCAATGATTGA
TTCTCATATCAATATACGGTGTCCCAAATTCATGTATAGAAAAATAAAAGATGGGTAATA
AGGATTTTTCTTAAGTAACATCCAAGGAAAGAATACAGACAAAAATGGAACCTCAAAAGA
GAAAATTAATACTAACGAGTTGGCTGCTACCAAAGCCACAAGAATCTGAAGCAATAATCA
AGCTTGAAGTTAGCTGCCACCAGAAGCTGCACAGAGTTGATAAGAAGACATACAAGCAAG
GAAGCATAAGAGAAAATGGGGCATTTGCTCCTATCAAGCGGCTCCTTTCTGTTTCAAAGT
TATCTTATCCCCAAGACTGAGGGCGATTCCCTGGGTTTTACTTCTTATCCTGAGTGTATC
CACTCAACTTACCATCTGCTTGCTTTTCAATGCTCACATTCACTAAAGCATCTTCCCCAA
AGACACTCTTAGCATAAAGGTTTGCAGCTAGGAAACCACAATCCCCTTCCAATGCAGATG
GTGGGGTCAGGCATTTCATATTAGTTGACTTGATGATGTGGCTCAGAAAATCCCTCTCAT
CTTGCAATACTGTATTTACAGCAACCTTGTTTTCCCACTCAAACTCAGnccacatagttc
tgaag


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000044A_C02 KMC000044A_c02
         (725 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB17749.1| putative coatmer beta subunit (beta-coat protein...   156  3e-45
ref|NP_194876.1| putative protein; protein id: At4g31480.1 [Arab...   154  1e-44
ref|NP_194877.1| Beta-COP-like protein; protein id: At4g31490.1 ...   150  2e-43
ref|NP_203534.1| coatomer protein complex, subunit beta 1; RIKEN...   120  2e-31
ref|NP_542959.1| coatomer protein complex, subunit beta 1 [Rattu...   120  2e-31

>dbj|BAB17749.1| putative coatmer beta subunit (beta-coat protein) (beta-COP) [Oryza
            sativa (japonica cultivar-group)]
            gi|13873019|dbj|BAB44123.1| putative coatmer beta subunit
            (beta-coat protein) (beta-COP) [Oryza sativa (japonica
            cultivar-group)]
          Length = 1036

 Score =  156 bits (394), Expect(2) = 3e-45
 Identities = 72/83 (86%), Positives = 79/83 (94%)
 Frame = -2

Query: 724  FRTMWXEFEWENKVAVNTVLQDERDFLSHIIKSTNMKCLTPPSALEGDCGFLAANLYAKS 545
            FR MW EFEWENKVAVNTV+Q+E++FL HIIKSTNMKCLTPPSAL+G+CGFLAANLYAKS
Sbjct: 928  FRNMWAEFEWENKVAVNTVIQNEKEFLDHIIKSTNMKCLTPPSALDGECGFLAANLYAKS 987

Query: 544  VFGEDALVNVSIEKQADGKLSGY 476
            VFGEDALVN+SIEKQ DGKLSGY
Sbjct: 988  VFGEDALVNISIEKQFDGKLSGY 1010

 Score = 48.1 bits (113), Expect(2) = 3e-45
 Identities = 23/26 (88%), Positives = 25/26 (95%)
 Frame = -3

Query: 474  LRIRSKTQGIALSLGDKITLKQKGAA 397
            +RIRSKTQGIALSLGDKITLKQKG +
Sbjct: 1011 IRIRSKTQGIALSLGDKITLKQKGGS 1036

>ref|NP_194876.1| putative protein; protein id: At4g31480.1 [Arabidopsis thaliana]
            gi|7447850|pir||T10678 hypothetical protein F3L17.50 -
            Arabidopsis thaliana gi|5262759|emb|CAB45907.1| putative
            protein [Arabidopsis thaliana] gi|7270051|emb|CAB79866.1|
            putative protein [Arabidopsis thaliana]
          Length = 971

 Score =  154 bits (388), Expect(2) = 1e-44
 Identities = 72/83 (86%), Positives = 77/83 (92%)
 Frame = -2

Query: 724  FRTMWXEFEWENKVAVNTVLQDERDFLSHIIKSTNMKCLTPPSALEGDCGFLAANLYAKS 545
            FRTMW EFEWENKVAVNT +Q+ER+FL HIIKSTNMKCLT PSA+EG+CGFLAANLYAKS
Sbjct: 863  FRTMWAEFEWENKVAVNTTIQNEREFLDHIIKSTNMKCLTAPSAIEGECGFLAANLYAKS 922

Query: 544  VFGEDALVNVSIEKQADGKLSGY 476
            VFGEDALVNVSIEKQ DG LSGY
Sbjct: 923  VFGEDALVNVSIEKQTDGALSGY 945

 Score = 48.5 bits (114), Expect(2) = 1e-44
 Identities = 23/26 (88%), Positives = 26/26 (99%)
 Frame = -3

Query: 474  LRIRSKTQGIALSLGDKITLKQKGAA 397
            +RIRSKTQGIALSLGDKITLKQKG++
Sbjct: 946  IRIRSKTQGIALSLGDKITLKQKGSS 971

>ref|NP_194877.1| Beta-COP-like protein; protein id: At4g31490.1 [Arabidopsis thaliana]
            gi|7447851|pir||T10679 hypothetical protein F3L17.60 -
            Arabidopsis thaliana gi|5262760|emb|CAB45908.1|
            Beta-COP-like protein [Arabidopsis thaliana]
            gi|7270052|emb|CAB79867.1| Beta-COP-like protein
            [Arabidopsis thaliana]
          Length = 958

 Score =  150 bits (379), Expect(2) = 2e-43
 Identities = 70/83 (84%), Positives = 76/83 (91%)
 Frame = -2

Query: 724  FRTMWXEFEWENKVAVNTVLQDERDFLSHIIKSTNMKCLTPPSALEGDCGFLAANLYAKS 545
            FRTMW EFEWENKVAVNT +Q+ER+FL HIIKSTNMKCLT PSA+ G+CGFLAANLYAKS
Sbjct: 850  FRTMWAEFEWENKVAVNTTIQNEREFLDHIIKSTNMKCLTAPSAIAGECGFLAANLYAKS 909

Query: 544  VFGEDALVNVSIEKQADGKLSGY 476
            VFGEDALVN+SIEKQ DG LSGY
Sbjct: 910  VFGEDALVNLSIEKQTDGTLSGY 932

 Score = 48.1 bits (113), Expect(2) = 2e-43
 Identities = 23/26 (88%), Positives = 25/26 (95%)
 Frame = -3

Query: 474  LRIRSKTQGIALSLGDKITLKQKGAA 397
            +RIRSKTQGIALSLGDKITLKQKG +
Sbjct: 933  IRIRSKTQGIALSLGDKITLKQKGGS 958

>ref|NP_203534.1| coatomer protein complex, subunit beta 1; RIKEN cDNA 2610019B04 gene
            [Mus musculus] gi|13124070|sp|Q9JIF7|COPB_MOUSE Coatomer
            beta subunit (Beta-coat protein) (Beta-COP)
            gi|8571380|gb|AAF76856.1|AF231925_1 COPI coatomer
            complex, beta subunit [Mus musculus]
            gi|21410372|gb|AAH30837.1| coatomer protein complex,
            subunit beta 1 [Mus musculus]
          Length = 953

 Score =  120 bits (301), Expect(2) = 2e-31
 Identities = 55/74 (74%), Positives = 61/74 (82%)
 Frame = -2

Query: 724  FRTMWXEFEWENKVAVNTVLQDERDFLSHIIKSTNMKCLTPPSALEGDCGFLAANLYAKS 545
            FR MW EFEWENKV VNT + D  D+L HI+KSTNMKCLTP  AL G CGF+AANLYA+S
Sbjct: 840  FRQMWAEFEWENKVTVNTNMTDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARS 899

Query: 544  VFGEDALVNVSIEK 503
            +FGEDAL NVSIEK
Sbjct: 900  IFGEDALANVSIEK 913

 Score = 37.7 bits (86), Expect(2) = 2e-31
 Identities = 17/23 (73%), Positives = 21/23 (90%)
 Frame = -3

Query: 474 LRIRSKTQGIALSLGDKITLKQK 406
           +RIR+K+QG+ALSLGDKI L QK
Sbjct: 927 IRIRAKSQGMALSLGDKINLSQK 949

>ref|NP_542959.1| coatomer protein complex, subunit beta 1 [Rattus norvegicus]
            gi|116923|sp|P23514|COPB_RAT COATOMER BETA SUBUNIT
            (BETA-COAT PROTEIN) (BETA-COP) gi|111414|pir||S13520 coat
            protein beta chain, Golgi-derived - rat
            gi|55819|emb|CAA40505.1| beta COP [Rattus norvegicus]
          Length = 953

 Score =  120 bits (300), Expect(2) = 2e-31
 Identities = 55/74 (74%), Positives = 61/74 (82%)
 Frame = -2

Query: 724  FRTMWXEFEWENKVAVNTVLQDERDFLSHIIKSTNMKCLTPPSALEGDCGFLAANLYAKS 545
            FR MW EFEWENKV VNT + D  D+L HI+KSTNMKCLTP  AL G CGF+AANLYA+S
Sbjct: 840  FRQMWAEFEWENKVTVNTNVTDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARS 899

Query: 544  VFGEDALVNVSIEK 503
            +FGEDAL NVSIEK
Sbjct: 900  IFGEDALANVSIEK 913

 Score = 37.7 bits (86), Expect(2) = 2e-31
 Identities = 17/23 (73%), Positives = 21/23 (90%)
 Frame = -3

Query: 474 LRIRSKTQGIALSLGDKITLKQK 406
           +RIR+K+QG+ALSLGDKI L QK
Sbjct: 927 IRIRAKSQGMALSLGDKINLSQK 949

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 612,272,339
Number of Sequences: 1393205
Number of extensions: 13179777
Number of successful extensions: 30119
Number of sequences better than 10.0: 37
Number of HSP's better than 10.0 without gapping: 28995
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30110
length of database: 448,689,247
effective HSP length: 120
effective length of database: 281,504,647
effective search space used: 34062062287
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 SPDL081g10_f BP057080 1 582
2 MPD038c01_f AV772584 9 522
3 MRL003a11_f BP083836 16 369
4 GENLf040b02 BP064438 16 571
5 MPDL021b11_f AV777544 17 408
6 MRL005c07_f BP083949 18 417
7 SPDL056g07_f BP055545 22 623
8 MRL048c07_f BP086017 23 191
9 GENLf074f11 BP066367 24 560
10 MPDL002f03_f AV776630 25 328
11 MPDL074f07_f AV780321 26 506
12 MRL021g06_f BP084810 26 410
13 SPDL093a07_f BP057809 26 593
14 SPDL032g06_f BP054014 26 524
15 GENLf071e08 BP066186 47 389
16 SPDL013c10_f BP052784 52 561
17 SPDL099f11_f BP058243 52 576
18 SPDL009g07_f BP052550 59 595
19 SPDL076a05_f BP056680 67 464
20 GENLf060d12 BP065562 67 634
21 MRL017g05_f BP084600 71 468
22 MPDL001e11_f AV776579 100 241
23 MPDL080d10_f AV780657 111 694
24 MRL011b08_f BP084245 111 263
25 MPDL017d12_f AV777354 115 608
26 SPDL090e05_f BP057651 121 530
27 MFBL013d03_f BP041911 124 283
28 MRL048c12_f BP086019 126 582
29 GENLf010h07 BP062901 138 695
30 MFBL031h01_f BP042827 171 664
31 MRL018a03_f BP084614 178 718
32 GENLf002e03 BP062469 178 759
33 MWL010c10_f AV768736 178 722




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research