KMC000043A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000043A_C01 KMC000043A_c01
agttttttttttttgggttTGGCAGAATTCAAGTGGATAACTGTGTAAAATATGTTTACA
CCGTGATGGTGCACATCCCTTTAGTTCTTACAACAAATTCAAATTCAAGGACAACTTCAA
AATTTTCAAGTAAATAGCCATTTCCAAATATGTTTTTTTTTCTAAGAAAAATGAGATCCT
AGTTTTTAGAGCTTTCATGACCAATGGCTAAGTTCTCGTGGTCTTATTCTAATGGTTTGG
CCTTATGTACAATGCTGCAGATATAGAAGCAAAACCTATTACACAAACAGTACACCGGTA
AAAACTTATTATACAAACACATAATAATAACAACTGATTTTTCACCTCTTCCCCCTCATA
AATGGGGGAAAGATAGCGTGCTTGGTGAATCAACCCTCACGATAATATCTTCTTCAACAG
CAGAATCATCACTTGAATCATCTCTGTGATGCTCTCTACGCTCTGTGCTTTGTGGAGGGG
GATTTGTAACATCTTGGTTGAACCGTGTCACTTGATGACCCTTCTGGTCAGTTGCAGCAC
CTTCTGATTTGACCGAAGTAAGCGGACGGTCTTGATACGACGCCATGTTTGGATATGACA
GACTCTGAGGTGGTGGTGGTCTAGCACGATTCATCGACAAACTTCTTCTCTGGAGTGGGA
TGT


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000043A_C01 KMC000043A_c01
         (663 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAD20320.1| putative Na/H antiporter [Cymodocea nodosa]            44  0.003
ref|NP_178307.2| putative Na+/H+ antiporter; protein id: At2g019...    35  1.2
pir||E84431 probable Na+/H+ antiporter [imported] - Arabidopsis ...    35  1.2
ref|NP_006314.1| SEC24 (S. cerevisiae) homolog B; secretory prot...    34  1.5
dbj|BAC42528.1| putative deaminase [Arabidopsis thaliana]              34  1.5

>emb|CAD20320.1| putative Na/H antiporter [Cymodocea nodosa]
          Length = 1145

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 26/65 (40%), Positives = 37/65 (56%), Gaps = 3/65 (4%)
 Frame = -3

Query: 565  PLTSVKSEGAATDQKGHQVTRFNQDVTNPPPQSTERREHHR---DDSSDDSAVEEDIIVR 395
            PL S +SEG +  ++  Q  R    +  PPP+        +   D+SSD+S  EE+IIVR
Sbjct: 1079 PLVSTRSEGESLGKRLGQ--REKPKLLPPPPKPVTGASESKPAEDNSSDESGAEEEIIVR 1136

Query: 394  VDSPS 380
            +DSPS
Sbjct: 1137 IDSPS 1141

>ref|NP_178307.2| putative Na+/H+ antiporter; protein id: At2g01980.1, supported by
            cDNA: gi_17065339 [Arabidopsis thaliana]
            gi|8515714|gb|AAF76139.1|AF256224_1 putative Na+/H+
            antiporter SOS1 [Arabidopsis thaliana]
            gi|17065340|gb|AAL32824.1| putative Na+/H+ antiporter
            [Arabidopsis thaliana]
          Length = 1146

 Score = 34.7 bits (78), Expect = 1.2
 Identities = 23/79 (29%), Positives = 38/79 (47%)
 Frame = -3

Query: 604  SLSYPNMASYQDRPLTSVKSEGAATDQKGHQVTRFNQDVTNPPPQSTERREHHRDDSSDD 425
            +L Y  +     + L S KSE +   +K  Q+         P    +  R++   +SSD+
Sbjct: 1066 NLLYKKLPLNPAQGLVSAKSESSIVTKK--QLETRKHACQLPLKGESSTRQNTMVESSDE 1123

Query: 424  SAVEEDIIVRVDSPSTLSF 368
               +E I+VR+DSPS + F
Sbjct: 1124 EDEDEGIVVRIDSPSKIVF 1142

>pir||E84431 probable Na+/H+ antiporter [imported] - Arabidopsis thaliana
            gi|4406781|gb|AAD20091.1| putative Na+/H+ antiporter
            [Arabidopsis thaliana]
          Length = 1162

 Score = 34.7 bits (78), Expect = 1.2
 Identities = 23/79 (29%), Positives = 38/79 (47%)
 Frame = -3

Query: 604  SLSYPNMASYQDRPLTSVKSEGAATDQKGHQVTRFNQDVTNPPPQSTERREHHRDDSSDD 425
            +L Y  +     + L S KSE +   +K  Q+         P    +  R++   +SSD+
Sbjct: 1082 NLLYKKLPLNPAQGLVSAKSESSIVTKK--QLETRKHACQLPLKGESSTRQNTMVESSDE 1139

Query: 424  SAVEEDIIVRVDSPSTLSF 368
               +E I+VR+DSPS + F
Sbjct: 1140 EDEDEGIVVRIDSPSKIVF 1158

>ref|NP_006314.1| SEC24 (S. cerevisiae) homolog B; secretory protein 24;
           Sec24-related protein B; protein transport protein
           Sec24B [Homo sapiens] gi|13124510|sp|O95487|S24B_HUMAN
           Protein transport protein Sec24B (SEC24-related protein
           B) gi|3947690|emb|CAA10335.1| Sec24B protein [Homo
           sapiens]
          Length = 1268

 Score = 34.3 bits (77), Expect = 1.5
 Identities = 22/83 (26%), Positives = 36/83 (42%), Gaps = 2/83 (2%)
 Frame = -3

Query: 592 PNMASYQDRPLTSVKSEGAATDQKGHQVTRF--NQDVTNPPPQSTERREHHRDDSSDDSA 419
           P  A++   P+TSV        QKG Q   +  NQ  + P P S+   +   ++  +++ 
Sbjct: 330 PPTANHPVEPVTSVTQPSELLQQKGVQYGEYVNNQASSAPTPLSSTSDDEEEEEEDEEAG 389

Query: 418 VEEDIIVRVDSPSTLSFPHL*GG 350
           V+        SP   S+  L GG
Sbjct: 390 VDSSSTTSSASPMPNSYDALEGG 412

>dbj|BAC42528.1| putative deaminase [Arabidopsis thaliana]
          Length = 1307

 Score = 34.3 bits (77), Expect = 1.5
 Identities = 19/59 (32%), Positives = 29/59 (48%)
 Frame = -3

Query: 622  RPPPPQSLSYPNMASYQDRPLTSVKSEGAATDQKGHQVTRFNQDVTNPPPQSTERREHH 446
            +PPPP    +P M   +      ++SE A T Q+  Q+ R  +D  + PP  T+   HH
Sbjct: 1236 KPPPPVHPFHPKMTIRRG----VLESECAQTMQQFFQLRRKKKDKNSDPPTPTDHHHHH 1290

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 586,098,153
Number of Sequences: 1393205
Number of extensions: 12428486
Number of successful extensions: 40170
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 37996
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40059
length of database: 448,689,247
effective HSP length: 119
effective length of database: 282,897,852
effective search space used: 28572683052
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MPDL038a10_f AV778405 1 568
2 MRL010f10_f BP084220 13 467
3 GENLf002d10 BP062467 144 663




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research