KMC000042A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000042A_C01 KMC000042A_c01
taaaatattagccataaatccgattaacatgtACGTACAAATGAATAAAATCATTAGGAA
TCAAATATCTAGTCGGCCATGGCTAATTTAAATATCCACGTCAAGCCATAAAAAAGCCAT
AAAAAAACTAAGAGGTTTCCCAATTAATTCAAAGTATTTAAACACAGTATGAGACAAAAC
ATAGCGTTAAAGATTTTTCTAGGAATAGCTCAACAAATGACAGAAAAAGTAAAACAACCA
ACAAAATTGTCCTCTTGACACGATAAGGGCCTCAACAATTTAGCTAATAGATGAAGCACG
CTTAGGACTTCTTGCTTGCTGCAAGCTGCGTCTCAGGCTCCTTCTTGACAGGCTCTTCCT
TTTCAGACAAAATCAATTCTATGTGGCAAGGAGATGACATGTAAGGGTTGATTCTCCCGT
GGGCTCGGTATGTTCTGCGCCTTTGCTTCTGTGCCTGATTGACTTGGACATGAGTGATGT
AAAGAGCATCAACATCCAAACCTTTGACTTCAGCATTGCTCTCGGCATTCTTAAGCAAGT
CTAGGATGAATTTAGCTGACTTGGCAGGCCAGCGTCCTTGTCCATTGGAGTGCCTGTTCT
TGGCTTGGGCTGTCCTCCCAAnACCACGACAGAAACGTCTGAATGGAATGGCCTGTTTGT
GAGCAAGCACATCCTCTAA


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000042A_C01 KMC000042A_c01
         (679 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_176910.1| ribosomal protein, putative; protein id: At1g67...   235  5e-61
gb|AAF99734.1|AC004557_13 F17L21.19 [Arabidopsis thaliana]            234  6e-61
ref|NP_174060.1| putative 60S ribosomal protein L17; protein id:...   234  6e-61
gb|AAL09401.1|AF307336_1 ribosomal protein [Petunia x hybrida]        230  2e-59
gb|AAG49551.1|AF264022_1 ribosomal protein L17-1 [Poa secunda]        228  8e-59

>ref|NP_176910.1| ribosomal protein, putative; protein id: At1g67430.1, supported by
           cDNA: gi_14596148, supported by cDNA: gi_20148390
           [Arabidopsis thaliana] gi|27735241|sp|P51413|R172_ARATH
           60S ribosomal protein L17-2 gi|7440980|pir||T02163
           ribosomal protein L17, cytosolic - Arabidopsis thaliana
           gi|3176668|gb|AAC18792.1|AAC18792 Similar to ribosomal
           protein L17 gb|X62724 from Hordeum vulgare.  ESTs
           gb|Z34728, gb|F19974, gb|T75677 and gb|Z33937 come from
           this gene. [Arabidopsis thaliana]
           gi|14596149|gb|AAK68802.1| ribosomal protein L17-like
           protein [Arabidopsis thaliana]
           gi|20148391|gb|AAM10086.1| unknown protein [Arabidopsis
           thaliana]
          Length = 175

 Score =  235 bits (599), Expect = 5e-61
 Identities = 115/126 (91%), Positives = 122/126 (96%), Gaps = 1/126 (0%)
 Frame = -1

Query: 679 LEDVLAHKQAIPFRRFCRGXGRTAQAKNRHSNGQGRWPAKSAKFILDLLKNAESNAEVKG 500
           LEDV+AHKQAIPF RFCRG GRTAQAKNRHSNGQGRWPAKSA+F+LDLLKNAESNAEVKG
Sbjct: 48  LEDVIAHKQAIPFTRFCRGVGRTAQAKNRHSNGQGRWPAKSAQFVLDLLKNAESNAEVKG 107

Query: 499 LDVDALYITHVQVNQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEEPVKKEPETQLA 320
           LDVDAL+I+H+QVNQA KQRRRTYRAHGRINPYMS+PCHIELILSEKEEPVKKEPETQLA
Sbjct: 108 LDVDALFISHIQVNQAAKQRRRTYRAHGRINPYMSNPCHIELILSEKEEPVKKEPETQLA 167

Query: 319 A-SKKS 305
           A SKKS
Sbjct: 168 AKSKKS 173

>gb|AAF99734.1|AC004557_13 F17L21.19 [Arabidopsis thaliana]
          Length = 172

 Score =  234 bits (598), Expect = 6e-61
 Identities = 112/124 (90%), Positives = 119/124 (95%)
 Frame = -1

Query: 679 LEDVLAHKQAIPFRRFCRGXGRTAQAKNRHSNGQGRWPAKSAKFILDLLKNAESNAEVKG 500
           LEDV+AHKQAIPF RFCRG GRTAQAKNRHSNGQGRWPAKSA+F+LDLLKNAESNAEVKG
Sbjct: 44  LEDVIAHKQAIPFTRFCRGVGRTAQAKNRHSNGQGRWPAKSAQFVLDLLKNAESNAEVKG 103

Query: 499 LDVDALYITHVQVNQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEEPVKKEPETQLA 320
           LDVDAL+I+H+QVNQA KQRRRTYRAHGRINPYMS+PCHIELILSEKEEPVKKEPETQLA
Sbjct: 104 LDVDALFISHIQVNQAAKQRRRTYRAHGRINPYMSNPCHIELILSEKEEPVKKEPETQLA 163

Query: 319 ASKK 308
           A  K
Sbjct: 164 AKSK 167

>ref|NP_174060.1| putative 60S ribosomal protein L17; protein id: At1g27400.1,
           supported by cDNA: 749., supported by cDNA: gi_14335139,
           supported by cDNA: gi_16226208, supported by cDNA:
           gi_16226629, supported by cDNA: gi_18655346 [Arabidopsis
           thaliana] gi|27734446|sp|Q93VI3|R171_ARATH 60S ribosomal
           protein L17-1 gi|14335140|gb|AAK59850.1|
           At1g27400/F17L21_20 [Arabidopsis thaliana]
           gi|16226209|gb|AAL16103.1|AF428271_1 At1g27400/F17L21_20
           [Arabidopsis thaliana]
           gi|16226630|gb|AAL16218.1|AF428449_1 At1g27400/F17L21_20
           [Arabidopsis thaliana] gi|18655347|gb|AAL76129.1|
           At1g27400/F17L21_20 [Arabidopsis thaliana]
           gi|21594923|gb|AAM66056.1| putative 60S ribosomal
           protein L17 [Arabidopsis thaliana]
          Length = 176

 Score =  234 bits (598), Expect = 6e-61
 Identities = 112/124 (90%), Positives = 119/124 (95%)
 Frame = -1

Query: 679 LEDVLAHKQAIPFRRFCRGXGRTAQAKNRHSNGQGRWPAKSAKFILDLLKNAESNAEVKG 500
           LEDV+AHKQAIPF RFCRG GRTAQAKNRHSNGQGRWPAKSA+F+LDLLKNAESNAEVKG
Sbjct: 48  LEDVIAHKQAIPFTRFCRGVGRTAQAKNRHSNGQGRWPAKSAQFVLDLLKNAESNAEVKG 107

Query: 499 LDVDALYITHVQVNQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEEPVKKEPETQLA 320
           LDVDAL+I+H+QVNQA KQRRRTYRAHGRINPYMS+PCHIELILSEKEEPVKKEPETQLA
Sbjct: 108 LDVDALFISHIQVNQAAKQRRRTYRAHGRINPYMSNPCHIELILSEKEEPVKKEPETQLA 167

Query: 319 ASKK 308
           A  K
Sbjct: 168 AKSK 171

>gb|AAL09401.1|AF307336_1 ribosomal protein [Petunia x hybrida]
          Length = 175

 Score =  230 bits (586), Expect = 2e-59
 Identities = 111/123 (90%), Positives = 116/123 (94%)
 Frame = -1

Query: 679 LEDVLAHKQAIPFRRFCRGXGRTAQAKNRHSNGQGRWPAKSAKFILDLLKNAESNAEVKG 500
           LEDVLAHKQAIPF RFCRG GRTAQAKNRHSNGQGRWP KSA FILDLLKNAESNAEVKG
Sbjct: 48  LEDVLAHKQAIPFTRFCRGVGRTAQAKNRHSNGQGRWPVKSANFILDLLKNAESNAEVKG 107

Query: 499 LDVDALYITHVQVNQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEEPVKKEPETQLA 320
           LDVD+LYI+H+QVNQAQKQRRRTYRAHGRINPYMS+PCHIELILSEKEE V+KEPETQLA
Sbjct: 108 LDVDSLYISHIQVNQAQKQRRRTYRAHGRINPYMSNPCHIELILSEKEESVRKEPETQLA 167

Query: 319 ASK 311
             K
Sbjct: 168 PRK 170

>gb|AAG49551.1|AF264022_1 ribosomal protein L17-1 [Poa secunda]
          Length = 171

 Score =  228 bits (580), Expect = 8e-59
 Identities = 109/123 (88%), Positives = 117/123 (94%)
 Frame = -1

Query: 679 LEDVLAHKQAIPFRRFCRGXGRTAQAKNRHSNGQGRWPAKSAKFILDLLKNAESNAEVKG 500
           LEDVLAHKQAIPFRR+CRG GRTAQAKNR  NGQGRWPAKSA+F+LDLLKNAESNAEVKG
Sbjct: 48  LEDVLAHKQAIPFRRYCRGVGRTAQAKNRQPNGQGRWPAKSAQFVLDLLKNAESNAEVKG 107

Query: 499 LDVDALYITHVQVNQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEEPVKKEPETQLA 320
           LDVDALYI+H+QVNQAQKQRRRTYRAHGRINPYMS+PCHIELILSEKEEPVKKE E+Q+A
Sbjct: 108 LDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSNPCHIELILSEKEEPVKKEAESQIA 167

Query: 319 ASK 311
             K
Sbjct: 168 PRK 170

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 542,040,841
Number of Sequences: 1393205
Number of extensions: 10889384
Number of successful extensions: 28732
Number of sequences better than 10.0: 259
Number of HSP's better than 10.0 without gapping: 27791
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28638
length of database: 448,689,247
effective HSP length: 119
effective length of database: 282,897,852
effective search space used: 29987172312
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MPD024e11_f AV771652 1 360
2 GENLf045f12 BP064736 33 559
3 MPD034f04_f AV772342 39 526
4 MFB059d08_f BP038270 40 503
5 MFB072g02_f BP039263 40 598
6 GENLf002d08 BP062466 119 680




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research