KMC000041A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000041A_C02 KMC000041A_c02
acCTATACCAATAAAAATTCTAATATCAGCAGCCATATGGAAGTATACATCAAAGAACAC
ATTTTTCTTGGTGGCAAACTGGCAATCTCAAATGAAAGACAGCTTCCATGGATAATATCT
AGAGACCAAGGAAGGTGTACCAGCCTCAAAGAAACATGACTTCACAAGAAAGACTAACCA
GTACAATACAGTGGGAGAGGTGTAAAAATAGAGAGCTACTCAAATAATATTCACCGGATG
GATGAATTTATATGCAGGATCTAATATCTGCTCACATTGATCACCGACTTAAGCCAAAAG
GACAATTTCACCATGTGAACATTTTTCATAAATCTCTTTCACAAGCTTTAACGTTGAATC
AGTATCTTCAGCCAGCCTTGAGATTCTCTCCACCTCCCTGATTGCCTCAGCGGCCAAATA
TGATTTGTTCTCGGCGTCAGCAACTCTGTAGGCTGCAGTATCAGCGACATCCTTTATTAT
CTCATCACATGTCACAAAAATAGAGGTGGGGGATCGTTGTGGCCGTAAATCCTTTGGTTA
TGGCACAGGTGATTTTGGAGAGGGTAATCTCTGTCCCGATGGGGTGCCCTTTTTAATCTT
GTAGCAATTTTGTACCTTTTCAAGCTTCCACTGATGATCAAGCTTCCTTAAncttgcacc
taat


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000041A_C02 KMC000041A_c02
         (664 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAD44620.1| MYB28 protein [Oryza sativa (japonica cultivar-g...    75  8e-13
dbj|BAB92342.1| histone H1-like protein [Oryza sativa (japonica ...    75  8e-13
pir||T15038 DNA-binding protein MYB1 - parsley gi|2224899|gb|AAB...    75  1e-12
pir||T15037 DNA-binding protein MYB1 - parsley gi|2224897|gb|AAB...    75  1e-12
gb|AAL73044.1|AF461815_1 histone H1-like protein [Zea mays]            68  1e-10

>emb|CAD44620.1| MYB28 protein [Oryza sativa (japonica cultivar-group)]
          Length = 304

 Score = 75.1 bits (183), Expect = 8e-13
 Identities = 50/127 (39%), Positives = 71/127 (55%), Gaps = 4/127 (3%)
 Frame = -2

Query: 663 LGAXLRKLDHQWKLEKVQNCYKIKKG----TPSGQRLPSPKSPVP*PKDLRPQRSPTSIF 496
           L A LR+L    K+EK+   Y+I +          + PSPK      K L+  ++  S  
Sbjct: 156 LTAKLRRLIAAKKIEKIDRSYRITESYAAKVSQANKSPSPKKDPA--KPLKASQNLGSFA 213

Query: 495 VTCDEIIKDVADTAAYRVADAENKSYLAAEAIREVERISRLAEDTDSTLKLVKEIYEKCS 316
            T   +  + A  AA +VADAE KS+LA E + E ERI +LAE+T+S + L  EIYE+CS
Sbjct: 214 GTSPAL--EAAAAAAMKVADAEAKSHLANEHMTEAERIFKLAEETESLVTLATEIYERCS 271

Query: 315 HGEIVLL 295
            GEI+ +
Sbjct: 272 RGEILTI 278

>dbj|BAB92342.1| histone H1-like protein [Oryza sativa (japonica cultivar-group)]
          Length = 306

 Score = 75.1 bits (183), Expect = 8e-13
 Identities = 50/127 (39%), Positives = 71/127 (55%), Gaps = 4/127 (3%)
 Frame = -2

Query: 663 LGAXLRKLDHQWKLEKVQNCYKIKKG----TPSGQRLPSPKSPVP*PKDLRPQRSPTSIF 496
           L A LR+L    K+EK+   Y+I +          + PSPK      K L+  ++  S  
Sbjct: 158 LTAKLRRLIAAKKIEKIDRSYRITESYAAKVSQANKSPSPKKDPA--KPLKASQNLGSFA 215

Query: 495 VTCDEIIKDVADTAAYRVADAENKSYLAAEAIREVERISRLAEDTDSTLKLVKEIYEKCS 316
            T   +  + A  AA +VADAE KS+LA E + E ERI +LAE+T+S + L  EIYE+CS
Sbjct: 216 GTSPAL--EAAAAAAMKVADAEAKSHLANEHMTEAERIFKLAEETESLVTLATEIYERCS 273

Query: 315 HGEIVLL 295
            GEI+ +
Sbjct: 274 RGEILTI 280

>pir||T15038 DNA-binding protein MYB1 - parsley gi|2224899|gb|AAB61699.1|
           DNA-binding protein PcMYB1 [Petroselinum crispum]
          Length = 307

 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 44/115 (38%), Positives = 71/115 (61%)
 Frame = -2

Query: 663 LGAXLRKLDHQWKLEKVQNCYKIKKGTPSGQRLPSPKSPVP*PKDLRPQRSPTSIFVTCD 484
           L + +R+L  Q KLEKV+  +KIK    SG R+P+P+      +D +P  S  S+ +   
Sbjct: 200 LSSLVRRLTMQKKLEKVEQRFKIKN---SGTRIPTPRQ-----RDAKPGTSRKSVLLD-P 250

Query: 483 EIIKDVADTAAYRVADAENKSYLAAEAIREVERISRLAEDTDSTLKLVKEIYEKC 319
             ++     A+ R+ADAE+KS +A EA++E E I+ LAE+ +S L++ K I+E+C
Sbjct: 251 ATLEGAVSIASERLADAEHKSCVAIEAVKESENIAELAEEAESMLEIAKGIWEQC 305

>pir||T15037 DNA-binding protein MYB1 - parsley gi|2224897|gb|AAB61698.1|
           DNA-binding protein PcMYB1 [Petroselinum crispum]
          Length = 307

 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 44/115 (38%), Positives = 71/115 (61%)
 Frame = -2

Query: 663 LGAXLRKLDHQWKLEKVQNCYKIKKGTPSGQRLPSPKSPVP*PKDLRPQRSPTSIFVTCD 484
           L + +R+L  Q KLEKV+  +KIK    SG R+P+P+      +D +P  S  S+ +   
Sbjct: 200 LSSLVRRLTMQKKLEKVEQRFKIKN---SGTRIPTPRQ-----RDAKPGTSRKSVLLD-P 250

Query: 483 EIIKDVADTAAYRVADAENKSYLAAEAIREVERISRLAEDTDSTLKLVKEIYEKC 319
             ++     A+ R+ADAE+KS +A EA++E E I+ LAE+ +S L++ K I+E+C
Sbjct: 251 ATLEGAVSIASERLADAEHKSCVAIEAVKESENIAELAEEAESMLEIAKGIWEQC 305

>gb|AAL73044.1|AF461815_1 histone H1-like protein [Zea mays]
          Length = 288

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 45/134 (33%), Positives = 69/134 (50%), Gaps = 5/134 (3%)
 Frame = -2

Query: 663 LGAXLRKLDHQWKLEKVQNCYKIKKG----TPSGQRLPSPKSPVP*PKDLRPQRSPTSI- 499
           L + LR+L    K+EK+   Y++       TP+     +PK   P     +P +   +I 
Sbjct: 157 LASKLRRLADSNKIEKIDKSYRLPDSLATRTPAPMNASAPKQKDP----SKPSKVSKAIG 212

Query: 498 FVTCDEIIKDVADTAAYRVADAENKSYLAAEAIREVERISRLAEDTDSTLKLVKEIYEKC 319
             +      + A  AA +VADAE K++ A +   E ERI ++AEDT+S L +  EIY++C
Sbjct: 213 LFSASSPALEAAMAAAVKVADAEAKAHDAHDQTMEAERIFKMAEDTESLLIIAAEIYDRC 272

Query: 318 SHGEIVLLA*VGDQ 277
           S GEI  L  V  +
Sbjct: 273 SRGEITTLVPVAQR 286

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 579,059,830
Number of Sequences: 1393205
Number of extensions: 12558054
Number of successful extensions: 31798
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 29969
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31701
length of database: 448,689,247
effective HSP length: 119
effective length of database: 282,897,852
effective search space used: 28572683052
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GNf047h04 BP070869 1 167
2 GENLf078a05 BP066568 47 517
3 GNf015a11 BP068428 48 266
4 GNf097b10 BP074537 51 481
5 GNf081c01 BP073328 88 350
6 GENLf002d07 BP062465 140 691
7 GENf037h11 BP059956 204 588
8 GNf046b12 BP070741 204 354




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research