KMC000040A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000040A_C01 KMC000040A_c01
ACTCTTATCTATAATCTATATATGTACTTCTAAGTAATGTGTAATACACTCCTTTGATAT
TAAATATTTGCAAGGAAAAAACTGCCTAGACTAGATATCCTCTCATATCCTTGAGTAGGA
GCAGCATCGACAATAATGACTGCATTTAATGAGCTTCCTAATTCAAAATGGGGAGTCGTG
CAAGTACAATAGTTATTACATGCTGATATGAGGAGATAACAAACTAACAAATGTCGAAGC
ATACACTTCCTACATCAATAATGATTATCATTTATCAGGCACTATGCTTTCTGATGCATT
GTTGAGGTAGGAGATTACAAGATCAGCTGCTTTGCAACCGGAGGCAATTGCTTTGCCAAC
TGAGAGTCCACCTCTGTGGTTACCTGCGTAGAAAAATCCGGGGAGATCTTTTTCCATTTT
GTCAATAGCTTCAAGAACTGATCCATAGTTACGGGCATACAAAGGAAAGCCTTTACTCCA
ATAGAAATGGTTGACAAATGAGGGCTCCCCTTCTGCTCCCAACAACTTTCTCAGATCAGA
AG


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000040A_C01 KMC000040A_c01
         (542 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAA76348.1| protoporphyrinogen IX oxidase [Glycine max]           170  1e-41
sp|O24164|PPOM_TOBAC Protoporphyrinogen oxidase, mitochondrial (...   142  3e-33
ref|NP_196926.2| protoporphyrinogen oxidase - like protein; prot...   140  1e-32
pir||T48595 protoporphyrinogen oxidase-like protein - Arabidopsi...   140  1e-32
dbj|BAB08301.1| protoporphyrinogen IX oxidase [Arabidopsis thali...   140  1e-32

>dbj|BAA76348.1| protoporphyrinogen IX oxidase [Glycine max]
          Length = 502

 Score =  170 bits (430), Expect = 1e-41
 Identities = 79/90 (87%), Positives = 88/90 (97%)
 Frame = -3

Query: 540 SDLRKLLGAEGEPSFVNHFYWSKGFPLYARNYGSVLEAIDKMEKDLPGFFYAGNHRGGLS 361
           SDLRKLLGAEGEP+FVNHFYWSKGFPLY RNYGSVL+AIDK+EKDLPGFF+AGN++GGLS
Sbjct: 413 SDLRKLLGAEGEPTFVNHFYWSKGFPLYGRNYGSVLQAIDKIEKDLPGFFFAGNYKGGLS 472

Query: 360 VGKAIASGCKAADLVISYLNNASESIVPDK 271
           VGKAIASGCKAADLVISYLN+AS++ VPDK
Sbjct: 473 VGKAIASGCKAADLVISYLNSASDNTVPDK 502

>sp|O24164|PPOM_TOBAC Protoporphyrinogen oxidase, mitochondrial (PPO II)
           (Protoporphyrinogen IX oxidase isozyme II) (PPX II)
           (PX-2) gi|7489194|pir||T04076 protoporphyrinogen oxidase
           (EC 1.3.3.4) IX, mitochondrial [validated] - common
           tobacco gi|2370335|emb|CAA73866.1| protoporphyrinogen
           oxidase [Nicotiana tabacum] gi|3929920|dbj|BAA34712.1|
           mitochondrial protoporphyrinogen oxidase [Nicotiana
           tabacum] gi|4105188|gb|AAD02291.1| protoporphyrinogen
           oxidase PX-2 [Nicotiana tabacum]
          Length = 504

 Score =  142 bits (358), Expect = 3e-33
 Identities = 65/83 (78%), Positives = 74/83 (88%)
 Frame = -3

Query: 540 SDLRKLLGAEGEPSFVNHFYWSKGFPLYARNYGSVLEAIDKMEKDLPGFFYAGNHRGGLS 361
           SDL++LLGAEGEP++VNH YWSK FPLY  NY SVL+AIDKMEK+LPG FYAGNHRGGLS
Sbjct: 415 SDLKQLLGAEGEPTYVNHLYWSKAFPLYGHNYDSVLDAIDKMEKNLPGLFYAGNHRGGLS 474

Query: 360 VGKAIASGCKAADLVISYLNNAS 292
           VGKA++SGC AADLVISYL + S
Sbjct: 475 VGKALSSGCNAADLVISYLESVS 497

>ref|NP_196926.2| protoporphyrinogen oxidase - like protein; protein id: At5g14220.1,
           supported by cDNA: gi_18700120, supported by cDNA:
           gi_20856026 [Arabidopsis thaliana]
           gi|18700121|gb|AAL77672.1| AT5g14220/MUA22_22
           [Arabidopsis thaliana] gi|20856027|gb|AAM26644.1|
           AT5g14220/MUA22_22 [Arabidopsis thaliana]
          Length = 508

 Score =  140 bits (353), Expect = 1e-32
 Identities = 66/89 (74%), Positives = 74/89 (82%)
 Frame = -3

Query: 540 SDLRKLLGAEGEPSFVNHFYWSKGFPLYARNYGSVLEAIDKMEKDLPGFFYAGNHRGGLS 361
           SDL++LLG EGEP  VNH+YW K FPLY  +Y SV+EAIDKME DLPGFFYAGNHRGGLS
Sbjct: 417 SDLQRLLGVEGEPVSVNHYYWRKAFPLYDSSYDSVMEAIDKMENDLPGFFYAGNHRGGLS 476

Query: 360 VGKAIASGCKAADLVISYLNNASESIVPD 274
           VGK+IASGCKAADLVISYL + S    P+
Sbjct: 477 VGKSIASGCKAADLVISYLESCSNDKKPN 505

>pir||T48595 protoporphyrinogen oxidase-like protein - Arabidopsis thaliana
           gi|7573447|emb|CAB87761.1| protoporphyrinogen
           oxidase-like protein [Arabidopsis thaliana]
          Length = 501

 Score =  140 bits (353), Expect = 1e-32
 Identities = 66/89 (74%), Positives = 74/89 (82%)
 Frame = -3

Query: 540 SDLRKLLGAEGEPSFVNHFYWSKGFPLYARNYGSVLEAIDKMEKDLPGFFYAGNHRGGLS 361
           SDL++LLG EGEP  VNH+YW K FPLY  +Y SV+EAIDKME DLPGFFYAGNHRGGLS
Sbjct: 410 SDLQRLLGVEGEPVSVNHYYWRKAFPLYDSSYDSVMEAIDKMENDLPGFFYAGNHRGGLS 469

Query: 360 VGKAIASGCKAADLVISYLNNASESIVPD 274
           VGK+IASGCKAADLVISYL + S    P+
Sbjct: 470 VGKSIASGCKAADLVISYLESCSNDKKPN 498

>dbj|BAB08301.1| protoporphyrinogen IX oxidase [Arabidopsis thaliana]
          Length = 547

 Score =  140 bits (353), Expect = 1e-32
 Identities = 66/89 (74%), Positives = 74/89 (82%)
 Frame = -3

Query: 540 SDLRKLLGAEGEPSFVNHFYWSKGFPLYARNYGSVLEAIDKMEKDLPGFFYAGNHRGGLS 361
           SDL++LLG EGEP  VNH+YW K FPLY  +Y SV+EAIDKME DLPGFFYAGNHRGGLS
Sbjct: 456 SDLQRLLGVEGEPVSVNHYYWRKAFPLYDSSYDSVMEAIDKMENDLPGFFYAGNHRGGLS 515

Query: 360 VGKAIASGCKAADLVISYLNNASESIVPD 274
           VGK+IASGCKAADLVISYL + S    P+
Sbjct: 516 VGKSIASGCKAADLVISYLESCSNDKKPN 544

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 435,806,525
Number of Sequences: 1393205
Number of extensions: 8884352
Number of successful extensions: 23866
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 23478
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23863
length of database: 448,689,247
effective HSP length: 115
effective length of database: 288,470,672
effective search space used: 18750593680
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf035d11 BP064183 1 376
2 MF066d07_f BP031815 1 439
3 GENLf002c05 BP062460 10 544
4 GENLf035b05 BP064164 28 544




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research