KMC000038A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000038A_C02 KMC000038A_c02
atctgaaagccttGCTAAAATAAAGCCAAAGCCGCCTTGGATTTCCTAGATATCATAATC
TCAGTGCACTGGAAAACAAATCAGTACATGGTCAATACGAAGCAGTACAGATTACAAGAA
AATTAATAGCAGGTTACGCTGAAAAATGCCATCAAACTAGAACATGCTAGAACTGTGATT
TGGTTCTCATAAAGATCATCGTGGAGCACCATAAACTTGGGCAGTGTCATATTGGGGATA
AGCAGCAGCTGGAGCACTTGCTGCAGGTACAGCTGCATAGCCTGCTGATTGTTCATAACC
AGTTTGAGTTGGTGTGGGTTGAGCATAACCTGGCTGCCCACTTTGTGCTGCACTATATGC
TGGAGCAGCAGCACTGCCGTAACTAGGATCTTGGGGCGCTTGGTAGCCATAAACTGCATT
GTTAGGAGCTGACTGCTCAGGGTAAGTTTGCTGAGATGGGTATGATCCATAACCTTGAGC
ATAACTAGCTGCAGGCTGGGCGCTTGGCTGGCTATAAGTAGGTTGTCCACCAGGCTGGGC
ATAGACCGGTCCAGATGCAGCGGGCGGGTGATTGTAACCATCTGCAGCTGGTG


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000038A_C02 KMC000038A_c02
         (593 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||T04011 hypothetical protein T5L19.200 - Arabidopsis thalian...    74  1e-12
ref|NP_192745.2| KH domain protein; protein id: At4g10070.1 [Ara...    74  1e-12
gb|AAN71223.1| GM32356p [Drosophila melanogaster]                      63  2e-09
ref|NP_695271.1| narrowly conserved hypothetical protein [Bifido...    60  2e-08
gb|AAC47010.1| fibroin-3                                               60  2e-08

>pir||T04011 hypothetical protein T5L19.200 - Arabidopsis thaliana
           gi|4539010|emb|CAB39631.1| putative DNA-directed RNA
           polymerase [Arabidopsis thaliana]
           gi|7267703|emb|CAB78130.1| putative DNA-directed RNA
           polymerase [Arabidopsis thaliana]
          Length = 748

 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 59/146 (40%), Positives = 69/146 (46%), Gaps = 15/146 (10%)
 Frame = -3

Query: 591 PAADGYNH--PPAASGPVYAQPGGQP---TYSQPSAQPAASYAQGYGSYPSQQTYPEQSA 427
           P +D YN+     A+GP Y Q   QP   TY Q  AQ AA  A GYG          Q A
Sbjct: 628 PPSDAYNNGTQTPATGPAYQQQSVQPASSTYDQTGAQQAA--AAGYGG---------QVA 676

Query: 426 PNNAVYGYQAPQDPSYGSAAAPAYSAAQSGQPGYAQPTPTQTGYE-----QSAGYAAVPA 262
           P    Y Y   Q P+YGS AA            Y+Q  PTQTGYE     Q+A YA  P 
Sbjct: 677 PTGG-YTYPTSQ-PAYGSQAA------------YSQAAPTQTGYEQQPATQAAVYATAPG 722

Query: 261 AS-----APAAAYPQYDTAQVYGAPR 199
            +     +P +AY QYD +QVY  PR
Sbjct: 723 TAPVKTQSPQSAYAQYDASQVYATPR 748

 Score = 39.3 bits (90), Expect = 0.038
 Identities = 41/134 (30%), Positives = 50/134 (36%), Gaps = 17/134 (12%)
 Frame = -3

Query: 564 PAASGPVYAQPGGQPTYSQPSAQPAASYAQGYG-SYPSQQTYPEQS---APNNAVYGYQA 397
           P  SGPV +   G P  SQ S     S+   YG + P  QT  +Q+         Y    
Sbjct: 468 PPPSGPVPSPAFGGPPLSQVSYGYGQSHGPEYGHAAPYSQTGYQQTYGQTYEQPKYDSNP 527

Query: 396 PQDPSYGSAAAPAYSAAQSG-----QPGY----AQPTPTQTGYEQSAGYAAVPAASAP-- 250
           P  P YG +  PA    QSG     QPG      Q  P Q GY      AA  +   P  
Sbjct: 528 PMQPPYGGSYPPA-GGGQSGYYQMQQPGVRPYGMQQGPVQQGYGPPQPAAAASSGDVPYQ 586

Query: 249 --AAAYPQYDTAQV 214
               A P Y +  +
Sbjct: 587 GATPAAPSYGSTNM 600

 Score = 36.6 bits (83), Expect = 0.25
 Identities = 39/137 (28%), Positives = 43/137 (30%), Gaps = 18/137 (13%)
 Frame = -3

Query: 576 YNHPPAASGPVYAQPGGQPTYSQPSAQPAASYAQGYG-SYP----SQQTYPEQSAPNNAV 412
           Y H    S   Y Q  GQ TY QP           YG SYP     Q  Y +   P    
Sbjct: 499 YGHAAPYSQTGYQQTYGQ-TYEQPKYDSNPPMQPPYGGSYPPAGGGQSGYYQMQQPGVRP 557

Query: 411 YG---------YQAPQDPSYGSAAAPAYSAAQSGQPGYAQ----PTPTQTGYEQSAGYAA 271
           YG         Y  PQ  +  S+    Y  A    P Y      P   Q GY  S G   
Sbjct: 558 YGMQQGPVQQGYGPPQPAAAASSGDVPYQGATPAAPSYGSTNMAPQQQQYGYTSSDG--- 614

Query: 270 VPAASAPAAAYPQYDTA 220
                     YP Y +A
Sbjct: 615 ----PVQQQTYPSYSSA 627

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 42/145 (28%), Positives = 49/145 (32%), Gaps = 45/145 (31%)
 Frame = -3

Query: 579 GYNHPPAASGPVYAQPGGQPTYSQPSAQPAASYAQGY---GSYPSQQTY---------PE 436
           GYN P  A  P    PGG P +   S  P A +   Y   G Y SQ +Y         P 
Sbjct: 377 GYNQP--AYRP--QGPGGPPQWG--SRGPHAPHPYDYHPRGPYSSQGSYYNSPGFGGYPP 430

Query: 435 QSAPNNAVYGYQAPQDPSY----------------------GSAAAPA----------YS 352
           Q  P    YG    Q P Y                      G   +PA          Y 
Sbjct: 431 QHMPPRGGYGTDWDQRPPYSGPYNYYGRQGAQSAGPVPPPSGPVPSPAFGGPPLSQVSYG 490

Query: 351 AAQSGQPGYAQPTP-TQTGYEQSAG 280
             QS  P Y    P +QTGY+Q+ G
Sbjct: 491 YGQSHGPEYGHAAPYSQTGYQQTYG 515

>ref|NP_192745.2| KH domain protein; protein id: At4g10070.1 [Arabidopsis thaliana]
          Length = 725

 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 59/146 (40%), Positives = 69/146 (46%), Gaps = 15/146 (10%)
 Frame = -3

Query: 591 PAADGYNH--PPAASGPVYAQPGGQP---TYSQPSAQPAASYAQGYGSYPSQQTYPEQSA 427
           P +D YN+     A+GP Y Q   QP   TY Q  AQ AA  A GYG          Q A
Sbjct: 605 PPSDAYNNGTQTPATGPAYQQQSVQPASSTYDQTGAQQAA--AAGYGG---------QVA 653

Query: 426 PNNAVYGYQAPQDPSYGSAAAPAYSAAQSGQPGYAQPTPTQTGYE-----QSAGYAAVPA 262
           P    Y Y   Q P+YGS AA            Y+Q  PTQTGYE     Q+A YA  P 
Sbjct: 654 PTGG-YTYPTSQ-PAYGSQAA------------YSQAAPTQTGYEQQPATQAAVYATAPG 699

Query: 261 AS-----APAAAYPQYDTAQVYGAPR 199
            +     +P +AY QYD +QVY  PR
Sbjct: 700 TAPVKTQSPQSAYAQYDASQVYATPR 725

 Score = 39.3 bits (90), Expect = 0.038
 Identities = 41/134 (30%), Positives = 50/134 (36%), Gaps = 17/134 (12%)
 Frame = -3

Query: 564 PAASGPVYAQPGGQPTYSQPSAQPAASYAQGYG-SYPSQQTYPEQS---APNNAVYGYQA 397
           P  SGPV +   G P  SQ S     S+   YG + P  QT  +Q+         Y    
Sbjct: 445 PPPSGPVPSPAFGGPPLSQVSYGYGQSHGPEYGHAAPYSQTGYQQTYGQTYEQPKYDSNP 504

Query: 396 PQDPSYGSAAAPAYSAAQSG-----QPGY----AQPTPTQTGYEQSAGYAAVPAASAP-- 250
           P  P YG +  PA    QSG     QPG      Q  P Q GY      AA  +   P  
Sbjct: 505 PMQPPYGGSYPPA-GGGQSGYYQMQQPGVRPYGMQQGPVQQGYGPPQPAAAASSGDVPYQ 563

Query: 249 --AAAYPQYDTAQV 214
               A P Y +  +
Sbjct: 564 GATPAAPSYGSTNM 577

 Score = 36.6 bits (83), Expect = 0.25
 Identities = 39/137 (28%), Positives = 43/137 (30%), Gaps = 18/137 (13%)
 Frame = -3

Query: 576 YNHPPAASGPVYAQPGGQPTYSQPSAQPAASYAQGYG-SYP----SQQTYPEQSAPNNAV 412
           Y H    S   Y Q  GQ TY QP           YG SYP     Q  Y +   P    
Sbjct: 476 YGHAAPYSQTGYQQTYGQ-TYEQPKYDSNPPMQPPYGGSYPPAGGGQSGYYQMQQPGVRP 534

Query: 411 YG---------YQAPQDPSYGSAAAPAYSAAQSGQPGYAQ----PTPTQTGYEQSAGYAA 271
           YG         Y  PQ  +  S+    Y  A    P Y      P   Q GY  S G   
Sbjct: 535 YGMQQGPVQQGYGPPQPAAAASSGDVPYQGATPAAPSYGSTNMAPQQQQYGYTSSDG--- 591

Query: 270 VPAASAPAAAYPQYDTA 220
                     YP Y +A
Sbjct: 592 ----PVQQQTYPSYSSA 604

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 42/145 (28%), Positives = 49/145 (32%), Gaps = 45/145 (31%)
 Frame = -3

Query: 579 GYNHPPAASGPVYAQPGGQPTYSQPSAQPAASYAQGY---GSYPSQQTY---------PE 436
           GYN P  A  P    PGG P +   S  P A +   Y   G Y SQ +Y         P 
Sbjct: 354 GYNQP--AYRP--QGPGGPPQWG--SRGPHAPHPYDYHPRGPYSSQGSYYNSPGFGGYPP 407

Query: 435 QSAPNNAVYGYQAPQDPSY----------------------GSAAAPA----------YS 352
           Q  P    YG    Q P Y                      G   +PA          Y 
Sbjct: 408 QHMPPRGGYGTDWDQRPPYSGPYNYYGRQGAQSAGPVPPPSGPVPSPAFGGPPLSQVSYG 467

Query: 351 AAQSGQPGYAQPTP-TQTGYEQSAG 280
             QS  P Y    P +QTGY+Q+ G
Sbjct: 468 YGQSHGPEYGHAAPYSQTGYQQTYG 492

>gb|AAN71223.1| GM32356p [Drosophila melanogaster]
          Length = 391

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 46/115 (40%), Positives = 54/115 (46%), Gaps = 6/115 (5%)
 Frame = -3

Query: 528 GQPTYSQPSAQPAASYAQGYGSYPSQ-QTYP--EQSAPNNAVYGYQAPQDPSYGSAA--A 364
           GQ  Y  P+ Q  +    GYG  P+   T P  E + P +   GY AP  P+Y + A  A
Sbjct: 143 GQNNYVAPAPQSPSYGGDGYGVLPNGGYTKPDTEYNGPGDGDAGYVAPAAPAYEAPAPPA 202

Query: 363 PAYSAAQSGQPGYAQPTPTQTGYEQSAGYAAVPAASAPAAAYPQYDT-AQVYGAP 202
           PAY A     P Y  P P    YE  A   A PA  APA A P Y+T A  Y AP
Sbjct: 203 PAYEAPAPPAPVYEAPAPAAPAYEAPA--PAAPAYEAPAPAAPAYETPATDYSAP 255

 Score = 42.4 bits (98), Expect = 0.005
 Identities = 44/141 (31%), Positives = 55/141 (38%), Gaps = 11/141 (7%)
 Frame = -3

Query: 591 PAADGYNHP---------PAASGPVYAQPG-GQPTYSQPSAQPAASYAQGYGSYPSQQT- 445
           PAA  Y  P         PA   PVY  P    P Y  P A  A +Y     + P+ +T 
Sbjct: 190 PAAPAYEAPAPPAPAYEAPAPPAPVYEAPAPAAPAYEAP-APAAPAYEAPAPAAPAYETP 248

Query: 444 YPEQSAPNNAVYGYQAPQDPSYGSAAAPAYSAAQSGQPGYAQPTPTQTGYEQSAGYAAVP 265
             + SAP      Y+ P      S+    YS  Q  QP Y    P Q  Y Q   Y + P
Sbjct: 249 ATDYSAPAPPAPAYEPP-----ASSYTQGYS--QPAQPSYVGAPPAQIVY-QPIIYLSTP 300

Query: 264 AASAPAAAYPQYDTAQVYGAP 202
            AS  + +  +YD  Q Y  P
Sbjct: 301 LASKSSTSQVEYDD-QKYVTP 320

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 37/128 (28%), Positives = 44/128 (33%), Gaps = 35/128 (27%)
 Frame = -3

Query: 591 PAADGYNHPPAASGPVYAQPGGQPTYSQPSAQ----PAASYAQGYGSYPSQQTY----PE 436
           PAA  Y   PA + P Y  P    +   P A     PA+SY QGY S P+Q +Y    P 
Sbjct: 230 PAAPAYE-APAPAAPAYETPATDYSAPAPPAPAYEPPASSYTQGY-SQPAQPSYVGAPPA 287

Query: 435 QSAPNNAVY-------------------GYQAPQDPSYGSAAAPAYSA--------AQSG 337
           Q      +Y                    Y  P  P      AP Y A        A   
Sbjct: 288 QIVYQPIIYLSTPLASKSSTSQVEYDDQKYVTPTAPPSPPPPAPVYEAPSQSCYQPAAPP 347

Query: 336 QPGYAQPT 313
            P YA P+
Sbjct: 348 APNYATPS 355

>ref|NP_695271.1| narrowly conserved hypothetical protein [Bifidobacterium longum
           NCC2705] gi|23325229|gb|AAN23907.1|AE014618_4 narrowly
           conserved hypothetical protein [Bifidobacterium longum
           NCC2705]
          Length = 216

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 50/121 (41%), Positives = 57/121 (46%), Gaps = 3/121 (2%)
 Frame = -3

Query: 555 SGPVYAQPG--GQPTYSQPSAQPAASYAQGYGSYPSQQTYPEQSAPNNAVYGYQAPQDPS 382
           S P  AQP    QP+Y Q +AQ      QGYG+ P    Y + +A +   YG Q PQ   
Sbjct: 24  SVPQPAQPAQPAQPSYGQDAAQQP----QGYGA-PQPAAYAQPAAGS---YGQQQPQ--- 72

Query: 381 YGSAAAPAYSAAQSGQPGYAQPTPTQTGYEQSAGYAAVPAASAP-AAAYPQYDTAQVYGA 205
           YG  A  AY+  Q GQP Y QP     GY Q  GY    A   P A A PQY  A    A
Sbjct: 73  YGQPAG-AYAQPQYGQPQYGQPAQPAAGYGQQPGYG--QAYQQPNAYAQPQYTAAPYAAA 129

Query: 204 P 202
           P
Sbjct: 130 P 130

>gb|AAC47010.1| fibroin-3
          Length = 636

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 49/120 (40%), Positives = 54/120 (44%)
 Frame = -3

Query: 588 AADGYNHPPAASGPVYAQPGGQPTYSQPSAQPAASYAQGYGSYPSQQTYPEQSAPNNAVY 409
           AA GY  P +  GP    PGGQ  Y  P A  AA+ A GYG    QQ  P Q  P     
Sbjct: 169 AAGGYG-PGSGQGPGQQGPGGQGPYG-PGASAAAAAAGGYGPGSGQQG-PGQQGPGQQGP 225

Query: 408 GYQAPQDPSYGSAAAPAYSAAQSGQPGYAQPTPTQTGYEQSAGYAAVPAASAPAAAYPQY 229
           G Q P    YG  A+ A +AA    PGY Q  P Q G      Y   P ASA +AA   Y
Sbjct: 226 GGQGP----YGPGASAAAAAAGGYGPGYGQQGPGQQGPGGQGPYG--PGASAASAASGGY 279

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 48/121 (39%), Positives = 50/121 (40%), Gaps = 1/121 (0%)
 Frame = -3

Query: 588 AADGYNHPPAASGPVYAQPGGQPTYSQPSAQPAASYAQGYGSYPSQQTYPEQSAPNNAVY 409
           AA GY       GP    PGGQ  Y  P A  AA+ A GYG  P     P Q  P     
Sbjct: 135 AAGGYGPGSGQQGPGQQGPGGQGPYG-PGASAAAAAAGGYG--PGSGQGPGQQGP----- 186

Query: 408 GYQAPQDPSYGSAAAPAYS-AAQSGQPGYAQPTPTQTGYEQSAGYAAVPAASAPAAAYPQ 232
           G Q P  P   +AAA A      SGQ G  Q  P Q G      Y   P ASA AAA   
Sbjct: 187 GGQGPYGPGASAAAAAAGGYGPGSGQQGPGQQGPGQQGPGGQGPYG--PGASAAAAAAGG 244

Query: 231 Y 229
           Y
Sbjct: 245 Y 245

 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 43/123 (34%), Positives = 46/123 (36%), Gaps = 5/123 (4%)
 Frame = -3

Query: 588 AADGYNHPPAASGPVYAQPGGQPTYSQPSAQPAASYAQGYGSYPSQQ----TYPEQSAPN 421
           A+ GY       GP    PGGQ  Y  P A  AA+ A GYG    QQ      P Q  P 
Sbjct: 275 ASGGYGPGSGQQGPGQQGPGGQGPYG-PGASAAAAAAGGYGPGSGQQGPGQQGPGQQGPG 333

Query: 420 NAVYGYQAPQDPSYGSAAAPAYS-AAQSGQPGYAQPTPTQTGYEQSAGYAAVPAASAPAA 244
               G Q P  P   +AAA A      SGQ G  Q  P Q G  Q       P    P  
Sbjct: 334 QQGPGGQGPYGPGASAAAAAAGGYGPGSGQQGPGQQGPGQQGPGQQGPGQQGPGQQGPGQ 393

Query: 243 AYP 235
             P
Sbjct: 394 QGP 396

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 47/126 (37%), Positives = 51/126 (40%), Gaps = 6/126 (4%)
 Frame = -3

Query: 588 AADGYN-----HPPAASGPVYAQPGGQPTYSQPSAQPAASYAQGYGSYPSQQTYPEQSAP 424
           AA GY        P+  GP    PGGQ  Y  P A  AA+ A GYG    QQ       P
Sbjct: 36  AAGGYGPGSGQQGPSQQGPGQQGPGGQGPYG-PGASAAAAAAGGYGPGSGQQ------GP 88

Query: 423 NNAVYGYQAPQDPSYGSAAAPAY-SAAQSGQPGYAQPTPTQTGYEQSAGYAAVPAASAPA 247
                G Q P  P   +AAA A  +   SGQ G  Q  P Q G          P ASA A
Sbjct: 89  -----GGQGPYGPGSSAAAAAAGGNGPGSGQQGAGQQGPGQQG----------PGASAAA 133

Query: 246 AAYPQY 229
           AA   Y
Sbjct: 134 AAAGGY 139

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 40/116 (34%), Positives = 43/116 (36%)
 Frame = -3

Query: 564 PAASGPVYAQPGGQPTYSQPSAQPAASYAQGYGSYPSQQTYPEQSAPNNAVYGYQAPQDP 385
           P   GP    PG Q  Y  P A  AA+ A GYG    QQ  P Q  P     G Q P   
Sbjct: 10  PGQQGPGQQGPGQQGPYG-PGASAAAAAAGGYGPGSGQQG-PSQQGPGQQGPGGQGP--- 64

Query: 384 SYGSAAAPAYSAAQSGQPGYAQPTPTQTGYEQSAGYAAVPAASAPAAAYPQYDTAQ 217
            YG  A+ A +AA    PG  Q  P   G       AA  AA        Q    Q
Sbjct: 65  -YGPGASAAAAAAGGYGPGSGQQGPGGQGPYGPGSSAAAAAAGGNGPGSGQQGAGQ 119

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 49/154 (31%), Positives = 52/154 (32%), Gaps = 22/154 (14%)
 Frame = -3

Query: 564 PAASGPVYAQPGGQPTYSQPSAQPAASYAQGYGSYPSQQ-------------------TY 442
           P   GP    PGGQ  Y  P A  AA  A GYG    QQ                     
Sbjct: 396 PGQQGPGQQGPGGQGAYG-PGASAAAGAAGGYGPGSGQQGPGQQGPGQQGPGQQGPGQQG 454

Query: 441 PEQSAPNNAVYGYQAPQDPSYGSAAAPAYS-AAQSGQPGYAQPTPTQTGYEQSAGY--AA 271
           P Q  P     G Q P  P   +AAA A      SGQ G  Q  P Q G      Y   A
Sbjct: 455 PGQQGPGQQGPGQQGPYGPGASAAAAAAGGYGPGSGQQGPGQQGPGQQGPGGQGPYGPGA 514

Query: 270 VPAASAPAAAYPQYDTAQVYGAPR*SL*EPNHSS 169
             AA +     PQ  +  V  A    L  P  SS
Sbjct: 515 ASAAVSVGGYGPQSSSVPVASAVASRLSSPAASS 548

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 44/141 (31%), Positives = 47/141 (33%), Gaps = 31/141 (21%)
 Frame = -3

Query: 564 PAASGPVYAQPGGQPTYSQPSAQPAASYAQGYGSYPSQQTYPEQSAPNNAVYGYQAP--- 394
           P   GP    PGGQ  Y  P A  AA+ A GYG    QQ  P Q  P     G Q P   
Sbjct: 327 PGQQGPGQQGPGGQGPYG-PGASAAAAAAGGYGPGSGQQG-PGQQGPGQQGPGQQGPGQQ 384

Query: 393 -------------------QDP----SYGSAAAPAYSAAQ-----SGQPGYAQPTPTQTG 298
                              Q P    +YG  A+ A  AA      SGQ G  Q  P Q G
Sbjct: 385 GPGQQGPGQQGPGQQGPGQQGPGGQGAYGPGASAAAGAAGGYGPGSGQQGPGQQGPGQQG 444

Query: 297 YEQSAGYAAVPAASAPAAAYP 235
             Q       P    P    P
Sbjct: 445 PGQQGPGQQGPGQQGPGQQGP 465

 Score = 36.2 bits (82), Expect = 0.32
 Identities = 30/77 (38%), Positives = 32/77 (40%), Gaps = 1/77 (1%)
 Frame = -3

Query: 456 SQQTYPEQSAPNNAVYGYQAPQDPSYGSAAAPAYS-AAQSGQPGYAQPTPTQTGYEQSAG 280
           S Q  P Q  P     G Q P  P   +AAA A      SGQ G +Q  P Q G      
Sbjct: 5   SGQQGPGQQGPGQQGPGQQGPYGPGASAAAAAAGGYGPGSGQQGPSQQGPGQQGPGGQGP 64

Query: 279 YAAVPAASAPAAAYPQY 229
           Y   P ASA AAA   Y
Sbjct: 65  YG--PGASAAAAAAGGY 79

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 535,327,507
Number of Sequences: 1393205
Number of extensions: 11905392
Number of successful extensions: 57557
Number of sequences better than 10.0: 1906
Number of HSP's better than 10.0 without gapping: 43890
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52573
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 22854740960
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf085f05 BP066986 1 471
2 MRL041a09_f BP085693 9 162
3 GENLf086d02 BP067030 16 431
4 GENLf045b03 BP064698 17 472
5 GENLf002b11 BP062458 17 542
6 MFBL041a09_f BP043314 17 469
7 SPDL044f11_f BP054784 17 593
8 MRL007e02_f BP084059 22 373
9 SPDL027c11_f BP053664 39 503




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research