KMC000037A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000037A_C01 KMC000037A_c01
gtgtgatagaaaaaaataaatattatagctataaaagcacaaggttcacttgcaacatat
tacattataaaattaacataTCTAAATAGAAAAAAATTAGATGAAACATCAACACCTGAT
ATTATAGTTGTAAAACACAGGGTTTCACTTGCAAAATATAGTAGTGTATCCAAACATAGC
TAAAATTCCATAATCCATGTTCATAGATACTTAGCCTACCACAAAAGAGAAAGGCTCACT
TAGCCTACCACAAAACAGAGGCTCCAAACACATGAGAAGGCTTGTGATAAAAGCCTCCCA
ATATTCAAGCCCTACGGCTAATAAGATAAGGTCTTCAACATAGGTTAACACAGAAAAGCT
AGTTAGGAACTTAGTTATATGTACAGCATTCTTGTCTAAGGCGCTTATAGGCCTCAAACA
AAGAACATAGAGTTGCAAACATTATCCTGCAATTTGGGCAGTTGAGGGACAGGAACAGCT
CCAGCAGCACTCAGTCCACCATGGCTTGATGATGTCTCAGATTTGTCCTCGAATTTCATG
AACTGGCCCAACTGGGTTGCAGCCAAGTGGGCATAGCATATAGGAGCAACAACAGAAATT
GCAGTGGTGCTCCTCTGATACACATATGATAGACTGTGTACAAGCTCCTGCAGTTCATCA
GGAGAGAAACCAGCC


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000037A_C01 KMC000037A_c01
         (675 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||A84668 Argonaute (AGO1)-like protein [imported] - Arabidops...   142  5e-33
ref|NP_565633.1| Argonaute (AGO1)-like protein; protein id: At2g...   142  5e-33
dbj|BAA88176.1| unnamed protein product [Oryza sativa (japonica ...   132  6e-30
ref|NP_197613.1| zwille/pinhead-like protein; protein id: At5g21...   132  6e-30
emb|CAD66636.1| ARGONAUTE9 protein [Arabidopsis thaliana]             128  6e-29

>pir||A84668 Argonaute (AGO1)-like protein [imported] - Arabidopsis thaliana
          Length = 930

 Score =  142 bits (357), Expect = 5e-33
 Identities = 69/84 (82%), Positives = 76/84 (90%)
 Frame = -2

Query: 671  GFSPDELQELVHSLSYVYQRSTTAISVVAPICYAHLAATQLGQFMKFEDKSETSSSHGGL 492
            GFS DELQELVHSLSYVYQRST+AISVVAPICYAHLAA QLG FMKFED+SETSSSHGG+
Sbjct: 846  GFSADELQELVHSLSYVYQRSTSAISVVAPICYAHLAAAQLGTFMKFEDQSETSSSHGGI 905

Query: 491  SAAGAVPVPQLPKLQDNVCNSMFF 420
            +A G + V QLP+L+DNV NSMFF
Sbjct: 906  TAPGPISVAQLPRLKDNVANSMFF 929

>ref|NP_565633.1| Argonaute (AGO1)-like protein; protein id: At2g27040.1, supported by
            cDNA: gi_14334815, supported by cDNA: gi_15293198
            [Arabidopsis thaliana] gi|14334816|gb|AAK59586.1|
            putative Argonaute (AGO1) protein [Arabidopsis thaliana]
            gi|15293199|gb|AAK93710.1| putative argonaute AGO1
            protein [Arabidopsis thaliana] gi|20197419|gb|AAC77862.2|
            Argonaute (AGO1)-like protein [Arabidopsis thaliana]
          Length = 924

 Score =  142 bits (357), Expect = 5e-33
 Identities = 69/84 (82%), Positives = 76/84 (90%)
 Frame = -2

Query: 671  GFSPDELQELVHSLSYVYQRSTTAISVVAPICYAHLAATQLGQFMKFEDKSETSSSHGGL 492
            GFS DELQELVHSLSYVYQRST+AISVVAPICYAHLAA QLG FMKFED+SETSSSHGG+
Sbjct: 840  GFSADELQELVHSLSYVYQRSTSAISVVAPICYAHLAAAQLGTFMKFEDQSETSSSHGGI 899

Query: 491  SAAGAVPVPQLPKLQDNVCNSMFF 420
            +A G + V QLP+L+DNV NSMFF
Sbjct: 900  TAPGPISVAQLPRLKDNVANSMFF 923

>dbj|BAA88176.1| unnamed protein product [Oryza sativa (japonica cultivar-group)]
          Length = 904

 Score =  132 bits (331), Expect = 6e-30
 Identities = 63/84 (75%), Positives = 75/84 (89%)
 Frame = -2

Query: 671  GFSPDELQELVHSLSYVYQRSTTAISVVAPICYAHLAATQLGQFMKFEDKSETSSSHGGL 492
            GFS D+LQELVHSLSYVYQRSTTAISVVAPICYAHLAA Q+ QF+KF++ SETSSSHGG 
Sbjct: 820  GFSADDLQELVHSLSYVYQRSTTAISVVAPICYAHLAAAQVSQFIKFDEMSETSSSHGGH 879

Query: 491  SAAGAVPVPQLPKLQDNVCNSMFF 420
            ++AG+ PVP+LP+L + V +SMFF
Sbjct: 880  TSAGSAPVPELPRLHNKVRSSMFF 903

>ref|NP_197613.1| zwille/pinhead-like protein; protein id: At5g21150.1 [Arabidopsis
            thaliana] gi|29294055|gb|AAO73892.1| PAZ (Piwi Argonaut
            and Zwille) family [Arabidopsis thaliana]
          Length = 892

 Score =  132 bits (331), Expect = 6e-30
 Identities = 62/84 (73%), Positives = 73/84 (86%)
 Frame = -2

Query: 671  GFSPDELQELVHSLSYVYQRSTTAISVVAPICYAHLAATQLGQFMKFEDKSETSSSHGGL 492
            GF+ D+LQELVHSLSYVYQRSTTAISVVAP+CYAHLAA Q+G  MK+E+ SETSSSHGG+
Sbjct: 808  GFATDDLQELVHSLSYVYQRSTTAISVVAPVCYAHLAAAQMGTVMKYEELSETSSSHGGI 867

Query: 491  SAAGAVPVPQLPKLQDNVCNSMFF 420
            +  GAVPVP +P+L +NV  SMFF
Sbjct: 868  TTPGAVPVPPMPQLHNNVSTSMFF 891

>emb|CAD66636.1| ARGONAUTE9 protein [Arabidopsis thaliana]
          Length = 896

 Score =  128 bits (322), Expect = 6e-29
 Identities = 60/84 (71%), Positives = 72/84 (85%)
 Frame = -2

Query: 671  GFSPDELQELVHSLSYVYQRSTTAISVVAPICYAHLAATQLGQFMKFEDKSETSSSHGGL 492
            GF+ D+LQELVHSLS+VYQRSTTAISVVAP+CYAHLAA Q+G  MK+E+ SETSSSHGG+
Sbjct: 812  GFATDDLQELVHSLSHVYQRSTTAISVVAPVCYAHLAAAQMGTVMKYEELSETSSSHGGI 871

Query: 491  SAAGAVPVPQLPKLQDNVCNSMFF 420
            +  G VPVP +P+L +NV  SMFF
Sbjct: 872  TTPGTVPVPPMPQLHNNVSTSMFF 895

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 545,794,902
Number of Sequences: 1393205
Number of extensions: 11327561
Number of successful extensions: 27113
Number of sequences better than 10.0: 74
Number of HSP's better than 10.0 without gapping: 26191
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27094
length of database: 448,689,247
effective HSP length: 119
effective length of database: 282,897,852
effective search space used: 29704274460
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MPDL087g07_f AV781071 1 498
2 SPD004b01_f BP044289 85 671
3 SPDL094g10_f BP057928 99 604
4 MWM195c12_f AV767718 104 377
5 GENLf002b09 BP062457 105 630
6 SPDL096b04_f BP058012 106 443
7 SPDL020e06_f BP053250 112 662
8 MRL023h09_f BP084930 120 639
9 MPDL068h06_f AV779999 121 641
10 GENLf026a09 BP063683 126 657
11 GENLf081e03 BP066756 126 510
12 MRL001e08_f BP083738 127 531
13 MRL002h03_f BP083821 127 514
14 SPDL007f11_f BP052430 127 554
15 GENLf078g01 BP066609 127 554
16 MRL015g02_f BP084498 127 659
17 GNLf006c05 BP075134 128 315
18 MWL045g01_f AV769340 129 663
19 GENLf075h12 BP066439 129 609
20 SPDL079e07_f BP056919 131 648
21 GENLf070g12 BP066143 134 621
22 MRL005b12_f BP083945 147 533
23 SPDL076b03_f BP056685 152 679
24 MRL005f11_f BP083972 153 448
25 MPDL028c01_f AV777892 170 688
26 SPDL065e10_f BP056047 171 663
27 MFBL006e12_f BP041589 207 561




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research