KMC000035A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000035A_C01 KMC000035A_c01
acaagatcttagagtgtggcattAGAAATTTCTAGTTACAGAAATAGATCATTTCTAAAC
CGGAATCTTATGATACAACCACTACTAGCTAGTTCATAAAACCAAACTTCAAACATTATT
TTGATTTTCGAATTACATCCAGGAGGAGGAAGCCTGATTCATATTTCAGAATTTACAACA
CATAGGGGAAGGGTCATTCTGACAGAAAGGAACCAAAACCAAATGTTTTAATTCCAAAAC
ATGACAACAGAAGAAATTCCTACCCCGGACCCTCTTCTAAAACAAAATCAGTAATTGGTA
AGGCCTCATTCTCCTAATCTCCAGTCCTGACCCCAACCAAAGACATCTACTATTTAATCA
GAGCAGCATATATGTCTACTACAAGAAATTTGGTAGTTTCATAACATGCAACACTCTGAA
ACCACCAAGGATGCTTCTGTCCCTCAGTCAGATTTATAACTCTGCGTCTGGTACGATCCT
CCATTCTGGTCCGCGCCATTTGTCAAATCTTCCTTTAACTTCCGAAGTATTTTCTTCTGA
TACCTGTAACCCTTGTCAGTTCCATAGATGTAATCACAGTATGTGAAAACTGAAGCAAAA
TTGCTTTGGCTTTGTCCTCCAACATAATGA


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000035A_C01 KMC000035A_c01
         (630 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAM64961.1| putative C-4 sterol methyl oxidase [Arabidopsis t...    87  2e-16
ref|NP_192948.1| putative C-4 sterol methyl oxidase; protein id:...    87  2e-16
ref|NP_567670.1| Expressed protein; protein id: At4g22756.1, sup...    83  3e-15
gb|AAM65428.1| putative C-4 sterol methyl oxidase [Arabidopsis t...    83  3e-15
gb|AAK61361.1| putative sterol 4-alpha-methyl-oxidase [Arabidops...    83  3e-15

>gb|AAM64961.1| putative C-4 sterol methyl oxidase [Arabidopsis thaliana]
          Length = 298

 Score = 86.7 bits (213), Expect = 2e-16
 Identities = 38/51 (74%), Positives = 42/51 (81%)
 Frame = -2

Query: 629 HYVGGQSQSNFASVFTYCDYIYGTDKGYRYQKKILRKLKEDLTNGADQNGG 477
           HYVGGQSQSNFASVFTYCDYIYGTDKGYR+QKK+L ++KE        NGG
Sbjct: 244 HYVGGQSQSNFASVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNGG 294

>ref|NP_192948.1| putative C-4 sterol methyl oxidase; protein id: At4g12110.1,
           supported by cDNA: 35110. [Arabidopsis thaliana]
           gi|21928127|gb|AAM78091.1| AT4g12110/F16J13_180
           [Arabidopsis thaliana] gi|23308291|gb|AAN18115.1|
           At4g12110/F16J13_180 [Arabidopsis thaliana]
          Length = 298

 Score = 86.7 bits (213), Expect = 2e-16
 Identities = 38/51 (74%), Positives = 42/51 (81%)
 Frame = -2

Query: 629 HYVGGQSQSNFASVFTYCDYIYGTDKGYRYQKKILRKLKEDLTNGADQNGG 477
           HYVGGQSQSNFASVFTYCDYIYGTDKGYR+QKK+L ++KE        NGG
Sbjct: 244 HYVGGQSQSNFASVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNGG 294

>ref|NP_567670.1| Expressed protein; protein id: At4g22756.1, supported by cDNA:
           39135. [Arabidopsis thaliana]
          Length = 299

 Score = 82.8 bits (203), Expect = 3e-15
 Identities = 38/54 (70%), Positives = 45/54 (82%), Gaps = 6/54 (11%)
 Frame = -2

Query: 629 HYVGGQSQSNFASVFTYCDYIYGTDKGYRYQKKILRKLKE------DLTNGADQ 486
           HYVGGQSQSNFASVFTYCDYIYGTDKGYR+QKK+L+++KE       L NG ++
Sbjct: 244 HYVGGQSQSNFASVFTYCDYIYGTDKGYRFQKKLLQQMKEKSKKSNKLVNGGEK 297

>gb|AAM65428.1| putative C-4 sterol methyl oxidase [Arabidopsis thaliana]
          Length = 299

 Score = 82.8 bits (203), Expect = 3e-15
 Identities = 38/54 (70%), Positives = 45/54 (82%), Gaps = 6/54 (11%)
 Frame = -2

Query: 629 HYVGGQSQSNFASVFTYCDYIYGTDKGYRYQKKILRKLKE------DLTNGADQ 486
           HYVGGQSQSNFASVFTYCDYIYGTDKGYR+QKK+L+++KE       L NG ++
Sbjct: 244 HYVGGQSQSNFASVFTYCDYIYGTDKGYRFQKKLLQQMKEKSKKSNKLVNGGEK 297

>gb|AAK61361.1| putative sterol 4-alpha-methyl-oxidase [Arabidopsis thaliana]
          Length = 299

 Score = 82.8 bits (203), Expect = 3e-15
 Identities = 38/54 (70%), Positives = 45/54 (82%), Gaps = 6/54 (11%)
 Frame = -2

Query: 629 HYVGGQSQSNFASVFTYCDYIYGTDKGYRYQKKILRKLKE------DLTNGADQ 486
           HYVGGQSQSNFASVFTYCDYIYGTDKGYR+QKK+L+++KE       L NG ++
Sbjct: 244 HYVGGQSQSNFASVFTYCDYIYGTDKGYRFQKKLLQQMKEKSKKSNKLVNGGEK 297

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 537,396,465
Number of Sequences: 1393205
Number of extensions: 11673030
Number of successful extensions: 24048
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 23500
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24043
length of database: 448,689,247
effective HSP length: 118
effective length of database: 284,291,057
effective search space used: 25870486187
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MR028f06_f BP078176 1 526
2 SPD028a07_f BP046184 24 491
3 MFB056a01_f BP038023 38 505
4 SPD018d06_f BP045415 39 557
5 GENf079a09 BP061726 55 237
6 MR073g05_f BP081637 72 477
7 SPD085a09_f BP050754 73 666
8 MFB008f08_f BP034500 75 667
9 GNf013g10 BP068335 76 491
10 MR007h01_f BP076511 93 521
11 GENLf002b07 BP062455 97 716
12 GNf070a07 BP072521 100 552
13 MRL041d11_f BP085716 100 497
14 MRL007b08_f BP084046 100 484
15 GENf062a03 BP060972 100 493
16 MR092e05_f BP083085 113 475




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research