KMC000034A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000034A_C01 KMC000034A_c01
gttttatctcggcatactactactattaatacattattacatcactcaagcacaactggg
gccatggctaccactgagatGGTATTGTCACTCTTCTGAGCCTCACAATTATTACAAAAC
TAACTCAAACGGATGCAACATAACTGAAAGGAGGGCAAAAATATCTTTGAAACATTTCTA
CACAAATATGGTACATTTAAAAAATGGATTGGAAAATATTTACATATGATCTAAACAATA
AATAATCACGAGGGACATTTAATAAAAAACAACTCTAAGTACATTTAGTCACAGGAACAA
ATGTTCTGTCATCTCTTCTCAACCATATGGTGGAACGGGTTTTCTTCACATGGTCTGCAA
AAAGGCGATACCTTTGATACTCCAGTTTCTGAGTAACTATGCCATTCAACAATAGTTCTG
AACTGTATATCACAGCCCCCTTTTCAAGGAAAGGCACACAAGTGGCATAATCTTCTTCAC
AAGACAGGATCAGCAGATCATCTGGAATTTTTTTGTCCTTCATAGCAGATCTGCCAACTC
TCTCCACTGCCTGGCCCTGAACCGCCATTACTAAACTTGAAATAATATCTTTACTAGGTT
TAGTATTTGGGGTGATCAATACTCTTCGACCCTTTAGAAGTGGGTGTTCAGATGCACGTG
CTAGTGACACTGGCAGGCTGAAACCAAACTCCTTTTCCTTTTTGGCATCCCTCAATATGT
AATTTCTCTCATCAAGA


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000034A_C01 KMC000034A_c01
         (737 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB02343.1| gb|AAD14441.1~gene_id:MIL23.5~similar to unknown...   199  3e-50
ref|NP_188785.1| unknown protein; protein id: At3g21480.1 [Arabi...   181  1e-44
ref|NP_192222.1| hypothetical protein; protein id: At4g03130.1 [...   110  2e-23
dbj|BAB89727.1| P0504E02.29 [Oryza sativa (japonica cultivar-gro...   103  3e-21
gb|AAH08328.1|AAH08328 Unknown (protein for IMAGE:3503689) [Homo...    85  1e-15

>dbj|BAB02343.1| gb|AAD14441.1~gene_id:MIL23.5~similar to unknown protein [Arabidopsis
            thaliana]
          Length = 1041

 Score =  199 bits (506), Expect = 3e-50
 Identities = 94/140 (67%), Positives = 121/140 (86%)
 Frame = -2

Query: 736  LDERNYILRDAKKEKEFGFSLPVSLARASEHPLLKGRRVLITPNTKPSKDIISSLVMAVQ 557
            +DE  YILRD+KKEKEF F++ VSLARA + PLL+GRRV ITPNTKP+ + I++LV AV 
Sbjct: 891  VDEDMYILRDSKKEKEFCFNMGVSLARARQFPLLQGRRVFITPNTKPALNTITTLVKAVH 950

Query: 556  GQAVERVGRSAMKDKKIPDDLLILSCEEDYATCVPFLEKGAVIYSSELLLNGIVTQKLEY 377
            G  VER+GRS++ + K+P++LL+LSCEED A C+PFLE+GA +YSSELLLNGIVTQ+LEY
Sbjct: 951  GLPVERLGRSSLSEDKVPENLLVLSCEEDRAICIPFLERGAEVYSSELLLNGIVTQRLEY 1010

Query: 376  QRYRLFADHVKKTRSTIWLR 317
            +RYRLF DHV++TRSTIW++
Sbjct: 1011 ERYRLFTDHVRRTRSTIWIK 1030

>ref|NP_188785.1| unknown protein; protein id: At3g21480.1 [Arabidopsis thaliana]
          Length = 1045

 Score =  181 bits (459), Expect = 1e-44
 Identities = 89/144 (61%), Positives = 116/144 (79%), Gaps = 4/144 (2%)
 Frame = -2

Query: 736  LDERNYILRDAKKEKEFGFSLPVSLARASEHPLLKGRRVLITPNTKPSKDIISSLVMAVQ 557
            +DE  YILRD+KKEKEF F++ VSLARA + PLL+GRRV ITPNTKP+ + I++LV AV 
Sbjct: 891  VDEDMYILRDSKKEKEFCFNMGVSLARARQFPLLQGRRVFITPNTKPALNTITTLVKAVH 950

Query: 556  GQAVER----VGRSAMKDKKIPDDLLILSCEEDYATCVPFLEKGAVIYSSELLLNGIVTQ 389
            G  +         S++ + K+P++LL+LSCEED A C+PFLE+GA +YSSELLLNGIVTQ
Sbjct: 951  GLVIISSPFYTFISSLSEDKVPENLLVLSCEEDRAICIPFLERGAEVYSSELLLNGIVTQ 1010

Query: 388  KLEYQRYRLFADHVKKTRSTIWLR 317
            +LEY+RYRLF DHV++TRSTIW++
Sbjct: 1011 RLEYERYRLFTDHVRRTRSTIWIK 1034

>ref|NP_192222.1| hypothetical protein; protein id: At4g03130.1 [Arabidopsis
           thaliana] gi|25407164|pir||G85039 hypothetical protein
           AT4g03130 [imported] - Arabidopsis thaliana
           gi|4262141|gb|AAD14441.1| hypothetical protein
           [Arabidopsis thaliana] gi|7270183|emb|CAB77798.1|
           hypothetical protein [Arabidopsis thaliana]
          Length = 765

 Score =  110 bits (276), Expect = 2e-23
 Identities = 56/102 (54%), Positives = 74/102 (71%)
 Frame = -2

Query: 736 LDERNYILRDAKKEKEFGFSLPVSLARASEHPLLKGRRVLITPNTKPSKDIISSLVMAVQ 557
           +DE++YILRD KKEK+ GF L  SLARA +HPLLKG +V ITP+ KPS+ +I+ LV   Q
Sbjct: 635 IDEKSYILRDIKKEKD-GFCLLTSLARAKQHPLLKGFKVCITPSIKPSRGMITDLVKMTQ 693

Query: 556 GQAVERVGRSAMKDKKIPDDLLILSCEEDYATCVPFLEKGAV 431
           GQ VE     A +D+  P+D+LILSC+ED   C+PF+ +G V
Sbjct: 694 GQVVEASEIIAAEDRNFPEDVLILSCKEDRDFCLPFVNQGTV 735

>dbj|BAB89727.1| P0504E02.29 [Oryza sativa (japonica cultivar-group)]
            gi|20161326|dbj|BAB90250.1| B1150F11.10 [Oryza sativa
            (japonica cultivar-group)]
          Length = 819

 Score =  103 bits (257), Expect = 3e-21
 Identities = 52/125 (41%), Positives = 86/125 (68%), Gaps = 4/125 (3%)
 Frame = -2

Query: 733  DERNYILRDAKKEKEFGFSLPVSLARASEHPLL----KGRRVLITPNTKPSKDIISSLVM 566
            +E + +L+ +++ ++   ++ V L+++  +  L    KGRRVLITPN KPSK+++ SLV+
Sbjct: 673  NEVSPVLQSSRRRRKHMSTVRVLLSQSMGNETLNDQTKGRRVLITPNAKPSKELLKSLVV 732

Query: 565  AVQGQAVERVGRSAMKDKKIPDDLLILSCEEDYATCVPFLEKGAVIYSSELLLNGIVTQK 386
               G+ +ER   S MK++ +     ++SCE+DY  CVPF++ G  ++ SEL+LNGIVTQK
Sbjct: 733  TAHGKVLERNAMSKMKNRSLMG-AFVISCEQDYKICVPFIKNGFEVFESELVLNGIVTQK 791

Query: 385  LEYQR 371
            LE++R
Sbjct: 792  LEFER 796

>gb|AAH08328.1|AAH08328 Unknown (protein for IMAGE:3503689) [Homo sapiens]
          Length = 391

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 45/128 (35%), Positives = 74/128 (57%), Gaps = 4/128 (3%)
 Frame = -2

Query: 736 LDERNYILRDAKKEKEFGFSLPVSLARASEHPLLKGRRVLITPNTKPSKDIISSLVMAVQ 557
           +DE+NYILRDA+ E  F FSL  SL RA   PL K +   ITP   PS   + ++V    
Sbjct: 262 IDEQNYILRDAEAEVLFSFSLEESLKRAHVSPLFKAKYFYITPGICPSLSTMKAIVECAG 321

Query: 556 GQAVERVG--RSAMKDKKIP--DDLLILSCEEDYATCVPFLEKGAVIYSSELLLNGIVTQ 389
           G+ + +    R  M+ K+     +++++SCE D   C  +  +G  ++++E +L G++TQ
Sbjct: 322 GKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCREYFARGIDVHNAEFVLTGVLTQ 381

Query: 388 KLEYQRYR 365
            L+Y+ Y+
Sbjct: 382 TLDYESYK 389

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 644,474,695
Number of Sequences: 1393205
Number of extensions: 14371352
Number of successful extensions: 33874
Number of sequences better than 10.0: 38
Number of HSP's better than 10.0 without gapping: 32765
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33859
length of database: 448,689,247
effective HSP length: 120
effective length of database: 281,504,647
effective search space used: 35188080875
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MPDL085b09_f AV780916 1 533
2 MFBL040b12_f BP043273 142 664
3 SPDL026f10_f BP053624 153 737
4 GENLf002b03 BP062453 180 668
5 MRL020b03_f BP084727 214 570




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research