KMC000033A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000033A_C01 KMC000033A_c01
gccccctttgatcaacagcctcctattcaaattttgtaacaaggaccaaaaatcaaattC
ACTTGTAATCATATGTATATTGCCACAGAAAAAAAAAAAATCAGAATTTCCTGGCTCCTT
TCACAACCGATTCCCAAAGTCATTAGCTCATTCCACAACAAAATGGGTTTTTTTTTCTAC
CTTTTCACTTCAATTCAATGTACAGACATGTTCAATAAGAAACAAGGCTACCAAGGCAAC
AAGTTCCATACCAAAAAAGCATAACCTGCTCTACTTCAGTCTTGATCTAATCCATCATGA
ATTATCTGCAAGTTATTAACTTGAGAGTTCCCATATTTGGAAACTGCATAGGCATAAGAT
GCTACAATCCCCCCACAAGGACCACAAGAACAGCAACAAAGAGCTGAAAGCTAGCAAGTA
ATTCACCCCTGATCTCACTGTCAGCTGAATGACATGTGATACTGTTATTCCTTATCTAAC
AACCATCAGGAAGATGTGGTAACAGGCCTCAAGGTCCTTATGGTGTTGTTGAATGAAAGT
AGAATAGATGATACTCTGCACAGAATGCAGCTGCAGCAATCAAACAAAGA


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000033A_C01 KMC000033A_c01
         (590 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_174491.1| hypothetical protein; protein id: At1g32120.1 [...    55  9e-07
gb|AAM94299.1| hypothetical protein [Sorghum bicolor]                  39  0.064
gb|AAD27628.1|AF128457_2 hypothetical protein [Oryza sativa subs...    39  0.064
gb|AAD27684.1|AF119222_16 hypothetical protein [Oryza sativa]          39  0.064
gb|AAD20312.1| hypothetical protein [Zea mays]                         39  0.064

>ref|NP_174491.1| hypothetical protein; protein id: At1g32120.1 [Arabidopsis thaliana]
            gi|25518597|pir||E86445 hypothetical protein F3C3.9
            [imported] - Arabidopsis thaliana
            gi|10801373|gb|AAG23445.1|AC084165_11 hypothetical
            protein [Arabidopsis thaliana]
          Length = 1206

 Score = 54.7 bits (130), Expect = 9e-07
 Identities = 24/42 (57%), Positives = 30/42 (71%)
 Frame = -2

Query: 499  PHLPDGC*IRNNSITCHSADSEIRGELLASFQLFVAVLVVLV 374
            P +P GC ++ NS+ C S DSE+ GE LA+FQLF  VL VLV
Sbjct: 1148 PMMPQGCSLKQNSVVCRSVDSEVSGEFLANFQLFSLVLAVLV 1189

>gb|AAM94299.1| hypothetical protein [Sorghum bicolor]
          Length = 298

 Score = 38.5 bits (88), Expect = 0.064
 Identities = 20/33 (60%), Positives = 22/33 (66%)
 Frame = -2

Query: 589 LCLIAAAAFCAEYHLFYFHSTTP*GP*GLLPHL 491
           LCL+AA AF AE  LFYFHSTT  G  G   +L
Sbjct: 129 LCLVAATAFTAELVLFYFHSTTHMGLEGYYHYL 161

>gb|AAD27628.1|AF128457_2 hypothetical protein [Oryza sativa subsp. indica]
          Length = 309

 Score = 38.5 bits (88), Expect = 0.064
 Identities = 38/122 (31%), Positives = 46/122 (37%), Gaps = 52/122 (42%)
 Frame = -2

Query: 589 LCLIAAAAFCAEYHLFYFHSTTP*GP*G---------------------LLP-------- 497
           LCL+A+ AF AE  LFYFHSTT  G  G                     LLP        
Sbjct: 130 LCLVASTAFMAELLLFYFHSTTHQGLEGYYHYLLVVVVALCVATTVLGALLPASFPVDIA 189

Query: 496 ----------------------HLPDGC-*IRNNSITCHSADSEIRGELLASFQLFVAVL 386
                                  LP GC    +  I CH+  ++ R E LA+FQLF  V 
Sbjct: 190 SGAAIALQGLWFYQTAFTLYGPSLPAGCRRDADGHIDCHTHAAQERAEQLANFQLFGLVF 249

Query: 385 VV 380
           +V
Sbjct: 250 LV 251

>gb|AAD27684.1|AF119222_16 hypothetical protein [Oryza sativa]
          Length = 309

 Score = 38.5 bits (88), Expect = 0.064
 Identities = 38/122 (31%), Positives = 46/122 (37%), Gaps = 52/122 (42%)
 Frame = -2

Query: 589 LCLIAAAAFCAEYHLFYFHSTTP*GP*G---------------------LLP-------- 497
           LCL+A+ AF AE  LFYFHSTT  G  G                     LLP        
Sbjct: 130 LCLVASTAFMAELLLFYFHSTTHQGLEGYYHYLLVVVVALCVATTVLGALLPASFPVDIA 189

Query: 496 ----------------------HLPDGC-*IRNNSITCHSADSEIRGELLASFQLFVAVL 386
                                  LP GC    +  I CH+  ++ R E LA+FQLF  V 
Sbjct: 190 SGAAIALQGLWFYQTAFTLYGPSLPAGCRRDADGHIDCHTHAAQERAEQLANFQLFGLVF 249

Query: 385 VV 380
           +V
Sbjct: 250 LV 251

>gb|AAD20312.1| hypothetical protein [Zea mays]
          Length = 296

 Score = 38.5 bits (88), Expect = 0.064
 Identities = 20/33 (60%), Positives = 22/33 (66%)
 Frame = -2

Query: 589 LCLIAAAAFCAEYHLFYFHSTTP*GP*GLLPHL 491
           LCL+AA AF AE  LFYFHSTT  G  G   +L
Sbjct: 125 LCLVAATAFTAELVLFYFHSTTHMGLEGYYHYL 157

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 501,978,104
Number of Sequences: 1393205
Number of extensions: 10388274
Number of successful extensions: 24728
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 23455
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24694
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 22569056698
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf002a11 BP062450 1 592
2 GENLf030c09 BP063916 60 560
3 GENLf007c09 BP062709 85 553




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research