KMC000032A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000032A_C01 KMC000032A_c01
catCCCACAAAAATCGCTGATGCATCCATCTATATAAAATCGCATAGCTTCCTCGTATAT
ACACCACTCATCAGTGACTGTACACACTAGTCAACGCCAAATGGGCTTTCAGATATAAGC
ATACAATATGACATCTATGTAAAGAGATGTATTGAAAGATTAAAGCTATGCTCTAACGGG
ACTATACACCATTCATCCCTTTCCTCCGGAAAAAAATGAAAACAAAAATGGAAAGGCAAA
ACAAAATTTACAGCCAATCTACAAGTAACTATCAATCTTCAGGGCGTTGAATCTCACCCA
TCATGATCCGAGTGGCTGGAGACCTTGAAACCAAGAAGTGAAGGATCTATCTGCTTTCCT
TTCTTACCCTTCTTTTTGCCACTTCGGCCGGCTTGTCCACCGTCAGATGGCTCAGTCCCA
GCTCCGCTGGTTGAATGTGTATCCACCTCAGGAAGAACAGGTTGCTTGAGCATGTCTATA
AATGATGTCTCTGATCCAGCGCCTTCACTAAAAGATGAAGATCTAAATCGAATCTCTTTC
TT


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000032A_C01 KMC000032A_c01
         (542 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB90655.1| B1033B05.5 [Oryza sativa (japonica cultivar-grou...    57  1e-07
ref|NP_173840.1| unknown protein; protein id: At1g24300.1 [Arabi...    54  2e-06
ref|NP_174063.1| unknown protein; protein id: At1g27430.1 [Arabi...    53  3e-06
pir||F86399 protein F17L21.22 [imported] - Arabidopsis thaliana ...    53  3e-06
emb|CAC19011.1| meis2.1 protein [Danio rerio]                          39  0.041

>dbj|BAB90655.1| B1033B05.5 [Oryza sativa (japonica cultivar-group)]
            gi|20161927|dbj|BAB90838.1| P0592G05.24 [Oryza sativa
            (japonica cultivar-group)]
          Length = 1530

 Score = 57.0 bits (136), Expect = 1e-07
 Identities = 33/73 (45%), Positives = 43/73 (58%), Gaps = 3/73 (4%)
 Frame = -1

Query: 521  SSSFSEGAGSET---SFIDMLKQPVLPEVDTHSTSGAGTEPSDGGQAGRSGKKKGKKGKQ 351
            + SF   +G+     SF +M+K    P +  +  S    E +DGG  G+  KKK KKGKQ
Sbjct: 1450 AGSFISPSGTSVDGPSFREMVKSTKKPALQQYDAS----ESADGGPGGKGAKKKTKKGKQ 1505

Query: 350  IDPSLLGFKVSSH 312
            IDPSLLGFKV S+
Sbjct: 1506 IDPSLLGFKVHSN 1518

>ref|NP_173840.1| unknown protein; protein id: At1g24300.1 [Arabidopsis thaliana]
            gi|7486371|pir||T00661 hypothetical protein F3I6.24 -
            Arabidopsis thaliana gi|2829883|gb|AAC00591.1| Unknown
            protein [Arabidopsis thaliana]
          Length = 1417

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 33/69 (47%), Positives = 45/69 (64%), Gaps = 3/69 (4%)
 Frame = -1

Query: 509  SEGAGSE-TSFIDMLKQPVLPEVDTHSTSGAGTEPSD--GGQAGRSGKKKGKKGKQIDPS 339
            ++G+ SE TSF +MLK+       ++S      E +D   G  G  GKKKGKKG+QIDP+
Sbjct: 1344 NKGSTSEATSFSEMLKK-------SNSMKKVAAESNDVTEGSKGGGGKKKGKKGRQIDPA 1396

Query: 338  LLGFKVSSH 312
            LLGFKV+S+
Sbjct: 1397 LLGFKVTSN 1405

>ref|NP_174063.1| unknown protein; protein id: At1g27430.1 [Arabidopsis thaliana]
          Length = 1453

 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 2/68 (2%)
 Frame = -1

Query: 509  SEGAGSET-SFIDMLKQP-VLPEVDTHSTSGAGTEPSDGGQAGRSGKKKGKKGKQIDPSL 336
            ++G+ SE  SF +MLK+   + +V   ST    TE S GG     GKKKGKKG+QIDP+L
Sbjct: 1379 NKGSTSEAASFSEMLKKSNSMKKVAAESTDA--TEGSKGG----GGKKKGKKGRQIDPAL 1432

Query: 335  LGFKVSSH 312
            LGFKV+S+
Sbjct: 1433 LGFKVTSN 1440

>pir||F86399 protein F17L21.22 [imported] - Arabidopsis thaliana
            gi|9802542|gb|AAF99744.1|AC004557_23 F17L21.22
            [Arabidopsis thaliana]
          Length = 1475

 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 2/68 (2%)
 Frame = -1

Query: 509  SEGAGSET-SFIDMLKQP-VLPEVDTHSTSGAGTEPSDGGQAGRSGKKKGKKGKQIDPSL 336
            ++G+ SE  SF +MLK+   + +V   ST    TE S GG     GKKKGKKG+QIDP+L
Sbjct: 1401 NKGSTSEAASFSEMLKKSNSMKKVAAESTDA--TEGSKGG----GGKKKGKKGRQIDPAL 1454

Query: 335  LGFKVSSH 312
            LGFKV+S+
Sbjct: 1455 LGFKVTSN 1462

>emb|CAC19011.1| meis2.1 protein [Danio rerio]
          Length = 393

 Score = 38.9 bits (89), Expect = 0.041
 Identities = 25/74 (33%), Positives = 31/74 (41%), Gaps = 1/74 (1%)
 Frame = -1

Query: 518 SSFSEGAGSETSFIDMLKQPVLPEVDTHSTSGAGTE-PSDGGQAGRSGKKKGKKGKQIDP 342
           S F + +GS T+  D          D HST   GT  PS GG A +SG    + G  +D 
Sbjct: 199 SDFDDLSGSSTNLADHNPASWRDMDDAHSTPSVGTPGPSSGGHASQSGDNSSELGDGLDN 258

Query: 341 SLLGFKVSSHSDHD 300
           SL         D D
Sbjct: 259 SLASPGTGDEDDQD 272

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 471,589,363
Number of Sequences: 1393205
Number of extensions: 10361618
Number of successful extensions: 30647
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 29195
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30599
length of database: 448,689,247
effective HSP length: 115
effective length of database: 288,470,672
effective search space used: 18750593680
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GNLf008a08 BP075254 1 377
2 MRL021h09_f BP084821 4 363
3 GENLf002a09 BP062449 4 553
4 MRL016f08_f BP084544 5 494
5 MWL055e11_f AV769529 5 389
6 GNLf008b12 BP075264 32 555
7 MRL037a09_f BP085520 34 387
8 MRL015g04_f BP084499 90 459




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research