KMC000031A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000031A_C01 KMC000031A_c01
aatatatatttaaaagtaatgacttcagaatcagaaaaacttctaagcatgcactaaaac
atttcagaaaatGGAAGGCGCCAAATTTAGATAACATCTCAAGAACATAAATAAGAATGT
ACAATTACAGAAAAAGGTAAACTTCATGGTTTAACCTAAAAGGCTATAAGTTACAAGTTA
CAACCGAACTCTCCTTATTTCTAATACACACTCCCCCGGACTCGACCACCATGGTTAATG
GCTCTAGCAGAGGATTCAGTAAGGGAACAATTGGAAGAAGTTACCTATACAAAAATTATG
TGCTTACATGTTACCAATCAGCAAGCACAATTAAACACAGAATGGCTAAAGCATTTGGCT
TTGGTGGCAATCTTTCTCACACCGGTTTAATGGTGAGAGAATCCTCCATTAAGAGGGGAT
ATAGGGATTCGGTCCATGATGTTCATTTTAGGGGCCTCAAGAATGGCCTTAGGCAGAGTT
AATGCGTATGGCATGCCCCAAATTGncagtggcctcatatatatgag


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000031A_C01 KMC000031A_c01
         (527 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_189060.2| unknown protein; protein id: At3g24180.1, suppo...    81  9e-15
dbj|BAB01359.1| emb|CAB39630.1~gene_id:MUJ8.8~strong similarity ...    81  9e-15
gb|AAG16864.1|AC069145_13 unknown protein [Oryza sativa]               72  5e-12
gb|AAL31035.1|AC078948_19 unknown protein [Oryza sativa]               72  5e-12
ref|NP_174631.1| hypothetical protein; protein id: At1g33700.1 [...    33  2.1

>ref|NP_189060.2| unknown protein; protein id: At3g24180.1, supported by cDNA:
            gi_17529231 [Arabidopsis thaliana]
            gi|17529232|gb|AAL38843.1| unknown protein [Arabidopsis
            thaliana]
          Length = 950

 Score = 80.9 bits (198), Expect = 9e-15
 Identities = 37/69 (53%), Positives = 53/69 (76%)
 Frame = -1

Query: 527  LIYMRPLXIWGMPYALTLPKAILEAPKMNIMDRIPISPLNGGFSHH*TGVRKIATKAKCF 348
            LIYMRPL IWGM +AL+LPKAIL+AP++N+MDR+ +SP +  FS++    + +  KAKCF
Sbjct: 885  LIYMRPLAIWGMQWALSLPKAILDAPQINMMDRVHLSPRSRRFSNN---FKVVKHKAKCF 941

Query: 347  SHSVFNCAC 321
             +S  +C+C
Sbjct: 942  GNSALSCSC 950

>dbj|BAB01359.1| emb|CAB39630.1~gene_id:MUJ8.8~strong similarity to unknown protein
            [Arabidopsis thaliana]
          Length = 937

 Score = 80.9 bits (198), Expect = 9e-15
 Identities = 37/69 (53%), Positives = 53/69 (76%)
 Frame = -1

Query: 527  LIYMRPLXIWGMPYALTLPKAILEAPKMNIMDRIPISPLNGGFSHH*TGVRKIATKAKCF 348
            LIYMRPL IWGM +AL+LPKAIL+AP++N+MDR+ +SP +  FS++    + +  KAKCF
Sbjct: 872  LIYMRPLAIWGMQWALSLPKAILDAPQINMMDRVHLSPRSRRFSNN---FKVVKHKAKCF 928

Query: 347  SHSVFNCAC 321
             +S  +C+C
Sbjct: 929  GNSALSCSC 937

>gb|AAG16864.1|AC069145_13 unknown protein [Oryza sativa]
          Length = 444

 Score = 71.6 bits (174), Expect = 5e-12
 Identities = 37/69 (53%), Positives = 45/69 (64%)
 Frame = -1

Query: 527 LIYMRPLXIWGMPYALTLPKAILEAPKMNIMDRIPISPLNGGFSHH*TGVRKIATKAKCF 348
           LIYMRPL IW M +A + PKAIL+APK+N+MDRI +SP      +    VRKIA   +CF
Sbjct: 377 LIYMRPLAIWAMQWARSPPKAILDAPKVNLMDRIHLSPQMIRAMNE-INVRKIAPDNRCF 435

Query: 347 SHSVFNCAC 321
             S F C C
Sbjct: 436 PSSAFRCEC 444

>gb|AAL31035.1|AC078948_19 unknown protein [Oryza sativa]
          Length = 967

 Score = 71.6 bits (174), Expect = 5e-12
 Identities = 37/69 (53%), Positives = 45/69 (64%)
 Frame = -1

Query: 527  LIYMRPLXIWGMPYALTLPKAILEAPKMNIMDRIPISPLNGGFSHH*TGVRKIATKAKCF 348
            LIYMRPL IW M +A + PKAIL+APK+N+MDRI +SP      +    VRKIA   +CF
Sbjct: 900  LIYMRPLAIWAMQWARSPPKAILDAPKVNLMDRIHLSPQMIRAMNE-INVRKIAPDNRCF 958

Query: 347  SHSVFNCAC 321
              S F C C
Sbjct: 959  PSSAFRCEC 967

>ref|NP_174631.1| hypothetical protein; protein id: At1g33700.1 [Arabidopsis
           thaliana]
          Length = 905

 Score = 33.1 bits (74), Expect = 2.1
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = -1

Query: 527 LIYMRPLXIWGMPYALTLPK 468
           L YMRPL IWG+ +A T+PK
Sbjct: 827 LCYMRPLAIWGIQWAHTMPK 846

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 440,513,319
Number of Sequences: 1393205
Number of extensions: 9298795
Number of successful extensions: 17186
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 16866
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17175
length of database: 448,689,247
effective HSP length: 115
effective length of database: 288,470,672
effective search space used: 17308240320
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 SPDL039a03_f BP054424 1 409
2 SPDL044g11_f BP054794 33 527
3 GENLf061h08 BP065641 73 258
4 GENLf002a05 BP062448 89 500




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research