KMC000030A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000030A_C01 KMC000030A_c01
aatttggtgtATGAAAGAAGAATCTTGTGTATTCATTCAGGCCTAACTAAAAAAATAGGT
GGGTATATAGGGGAGAAAACAGAATAGCTTCACAGGAATACATCGGTTCCATATAAATAA
ATAAAAAATAGTTGCAATTTCAAAGTCTATAACCATGCAAGTGCTTGGCCCACCTTCTAG
CCATGTAAGGATCATGGAAATCCCAGCTCTCAACACTGCTACTCCTACCACCTGCAGTGC
TCATCATATCCCTCACACTCTCTTCTCCACTTTCTGCAACATCACCACCACTTTTATGTT
CTCCAACACCAACAACAGTTTCCCCTGTCCTTCTAACACACTCATCAATTTCACCTTCAA
TGTAGCTAAATTCAACATACACGTGAGTAGTGCAGCCACCTAGGTCTAATAGAATCCTTC
TATCTTCTCCACCTCTTATCTCTCCAATTCTTATGACT


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000030A_C01 KMC000030A_c01
         (458 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||S54157 extensin-like protein - cowpea (fragment)                  42  0.003
ref|NP_176464.1| hypothetical protein; protein id: At1g62763.1 [...    36  0.22
ref|NP_178539.2| putative cation transport protein; protein id: ...    35  0.28
emb|CAD40879.1| OSJNBa0064H22.24 [Oryza sativa (japonica cultiva...    34  0.63
pir||C71610 probable membrane associated protein PFB0615c - mala...    34  0.63

>pir||S54157 extensin-like protein - cowpea (fragment)
          Length = 279

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 27/78 (34%), Positives = 34/78 (42%)
 Frame = +1

Query: 205 SSQHCYSYHLQCSSYPSHSLLHFLQHHHHFYVLQHQQQFPLSF*HTHQFHLQCS*IQHTR 384
           S  H +  H     + SH LLH L HH H  + +H    P+S    H  HL    + H  
Sbjct: 93  SPHHHHLLHRHLLMFTSHHLLHLLPHHLHMCISRHHHHLPMST-SPHHHHL----LHH-- 145

Query: 385 E*CSHLGLIESFYLLHLL 438
               HL +  S  LLHLL
Sbjct: 146 ----HLPMSTSHPLLHLL 159

 Score = 38.9 bits (89), Expect = 0.026
 Identities = 29/85 (34%), Positives = 38/85 (44%), Gaps = 5/85 (5%)
 Frame = +1

Query: 199 NPSSQHCYSYHLQCSSYPSHSLLHFLQHHHHFYVLQHQQ-----QFPLSF*HTHQFHLQC 363
           +P   H   +HL  S+  SH LLH L HH H  +  H       + P +F   H  HL  
Sbjct: 136 SPHHHHLLHHHLPMST--SHPLLHLLLHHLHMCISHHHHHLLHLRLP-TFTSPHLLHL-- 190

Query: 364 S*IQHTRE*CSHLGLIESFYLLHLL 438
             + H      HL +  S +LLHLL
Sbjct: 191 --LPH------HLPMFTSLHLLHLL 207

 Score = 37.4 bits (85), Expect = 0.074
 Identities = 29/82 (35%), Positives = 36/82 (43%), Gaps = 7/82 (8%)
 Frame = +1

Query: 214 HCYSYHLQCSSYPSHSLLHFLQHH-------HHFYVLQHQQQFPLSF*HTHQFHLQCS*I 372
           H   +HL    + SH LLH L HH       HH ++L H     L F   H  HL    +
Sbjct: 18  HLLHHHLLM--FTSHHLLHLLPHHLHMCISRHHHHLLHHHL---LMFTSHHLLHL----L 68

Query: 373 QHTRE*CSHLGLIESFYLLHLL 438
            H      HL +  S +LLHLL
Sbjct: 69  PH------HLPMFTSLHLLHLL 84

 Score = 36.2 bits (82), Expect = 0.17
 Identities = 26/85 (30%), Positives = 33/85 (38%), Gaps = 7/85 (8%)
 Frame = +1

Query: 205 SSQHCYSYHLQCSSYPSHSLLHFLQHH-------HHFYVLQHQQQFPLSF*HTHQFHLQC 363
           S  H +  H     + SH LLH L HH       H  ++L H     +S  H H  H   
Sbjct: 45  SRHHHHLLHHHLLMFTSHHLLHLLPHHLPMFTSLHLLHLLPHHLPMCISPHHHHLLH--- 101

Query: 364 S*IQHTRE*CSHLGLIESFYLLHLL 438
                      HL +  S +LLHLL
Sbjct: 102 ----------RHLLMFTSHHLLHLL 116

 Score = 35.0 bits (79), Expect = 0.37
 Identities = 20/59 (33%), Positives = 25/59 (41%), Gaps = 7/59 (11%)
 Frame = +1

Query: 199 NPSSQHCYSYHLQCSSYPSHSLLHFLQHH-------HHFYVLQHQQQFPLSF*HTHQFH 354
           +P   H   +HL    + SH LLH L HH       HH ++L H      S  H H  H
Sbjct: 216 SPHHHHLLHHHLLM--FTSHHLLHLLPHHLHMCISRHHHHLLHHHLLMSTSPHHHHLLH 272

>ref|NP_176464.1| hypothetical protein; protein id: At1g62763.1 [Arabidopsis
           thaliana] gi|6630459|gb|AAF19547.1|AC007190_15 F23N19.12
           [Arabidopsis thaliana]
          Length = 312

 Score = 35.8 bits (81), Expect = 0.22
 Identities = 29/79 (36%), Positives = 41/79 (51%), Gaps = 2/79 (2%)
 Frame = +3

Query: 216 LLLLPPAVLIISLTLSSPLSATSPPLLCSPTPTTVSPVLLTHSSISPSM--*LNSTYT*V 389
           +L L  A+L+   T SS LS +S     SP+P + SP     SS+SPS    L+ + +  
Sbjct: 9   ILHLSIAILLFITTSSSSLSPSSSSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSP 68

Query: 390 VQPPRSNRILLSSPPLISP 446
             PP S+  L S  P +SP
Sbjct: 69  PPPPPSSSPLSSLSPSLSP 87

>ref|NP_178539.2| putative cation transport protein; protein id: At2g04620.1
           [Arabidopsis thaliana]
          Length = 798

 Score = 35.4 bits (80), Expect = 0.28
 Identities = 21/71 (29%), Positives = 30/71 (41%)
 Frame = +1

Query: 187 KDHGNPSSQHCYSYHLQCSSYPSHSLLHFLQHHHHFYVLQHQQQFPLSF*HTHQFHLQCS 366
           ++H   S  H +  H Q S    H   H   HHHH +  +H ++   +  H HQ H    
Sbjct: 568 EEHHQHSDSHKHEEHHQHSDSHKHEEHHEHDHHHHSHSHKH-EECNHNHDHEHQSH---- 622

Query: 367 *IQHTRE*CSH 399
              H  E C+H
Sbjct: 623 --SHNHEECNH 631

>emb|CAD40879.1| OSJNBa0064H22.24 [Oryza sativa (japonica cultivar-group)]
          Length = 152

 Score = 34.3 bits (77), Expect = 0.63
 Identities = 15/37 (40%), Positives = 22/37 (58%)
 Frame = +3

Query: 225 LPPAVLIISLTLSSPLSATSPPLLCSPTPTTVSPVLL 335
           LPPAV    L L  P ++ + P  C+P P T +P++L
Sbjct: 105 LPPAVAAAPLVLPLPRASAAEPPRCAPMPPTAAPLVL 141

>pir||C71610 probable membrane associated protein PFB0615c - malaria parasite
            (Plasmodium falciparum)
          Length = 2013

 Score = 34.3 bits (77), Expect = 0.63
 Identities = 20/52 (38%), Positives = 26/52 (49%)
 Frame = +1

Query: 136  NFKVYNHASAWPTF*PCKDHGNPSSQHCYSYHLQCSSYPSHSLLHFLQHHHH 291
            NF  YN+ S++  F     H N SS H  S H   SS+ + S  H L  HH+
Sbjct: 1690 NFSSYNNLSSYNNF---SSHHNLSSHHNLSSHHNLSSHHNLSSHHNLSSHHN 1738

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 415,493,515
Number of Sequences: 1393205
Number of extensions: 9426710
Number of successful extensions: 37427
Number of sequences better than 10.0: 93
Number of HSP's better than 10.0 without gapping: 32563
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36216
length of database: 448,689,247
effective HSP length: 112
effective length of database: 292,650,287
effective search space used: 11706011480
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf002a01 BP062446 1 460
2 MF004f12_f BP028458 11 389
3 GNLf009e11 BP075344 29 187




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research