KMC000029A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000029A_C01 KMC000029A_c01
tatgttaaagtATGTTTAAATAAAAATATGTATAATTTAACTCGAATTTCTATCTACAAT
CACAACCGTTTAAATTTTGCAATAATAATTTATCTAAAAGTTTACAATAGTAGTACAGGT
CAACCAATCCATGATTCACTGTAGTACTAGCTAGAATAATGACATAAAAATAAGAACAGC
AACCAAAACATAAACGGCCTCTAATGTTGCAAGTAAAACAAAACAACCATGACTTTCTTC
TGCTATTATATAGAGTATCTCCTTGCAGTTGGTGAGGGTATATTCGTCTTCTTCACACGT
AAGATTCTATGTGGCCACCAAATCTTTGTTTAGTCTTGCAGTTAGTTCCTTTCGCAGAAT
TTTGCCTGAGGCTGCTTTAGGAATGGCGTCCGTGAAGAAAACTCTGTTGATTCTCTTGTA
AAATACCACCTGTTTTGAAATGTACTGTTTGATTTCATCGTCGGTGATCTTAGAACCATT
TGATCTCACGATAAATGCAACTGGTAATTCTCCTGCAGCTTCATCTTTCAAGGGTACAAC
AGCAGCATCAGAAATGTTTGGGTGAGCAATCAACAATGCTTCGAGCTCGGCAGGAGCTAC
TTGGAATCCTTTGGATTAGATTAAntcctttaatcgat


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000029A_C01 KMC000029A_c01
         (638 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||T07908 4-coumarate-CoA ligase (EC 6.2.1.12) 2 - western bal...   173  2e-42
gb|AAL98709.1|AF279267_1 4-coumarate:coenzyme A ligase [Glycine ...   170  1e-41
pir||T07909 4-coumarate-CoA ligase (EC 6.2.1.12) 1 [validated] -...   169  3e-41
gb|AAF91309.1|AF239686_1 4-coumarate:coA ligase 2 [Rubus idaeus]      165  5e-40
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase (4CL) (4-coumaroyl-C...   162  3e-39

>pir||T07908 4-coumarate-CoA ligase (EC 6.2.1.12) 2 - western balsam poplar x
           cottonwood gi|2911797|gb|AAC39365.1| 4-coumarate:CoA
           ligase 2 [Populus balsamifera subsp. trichocarpa x
           Populus deltoides]
          Length = 548

 Score =  173 bits (438), Expect = 2e-42
 Identities = 91/117 (77%), Positives = 101/117 (85%)
 Frame = -3

Query: 636 RLKXLI*SKGFQVAPAELEALLIAHPNISDAAVVPLKDEAAGELPVAFIVRSNGSKITDD 457
           RLK LI  KGFQVAPAELEA+LIAHPNISDAAVVP+KDEAAGE+PVAF+VRSNGSKIT+D
Sbjct: 436 RLKELIKYKGFQVAPAELEAMLIAHPNISDAAVVPMKDEAAGEVPVAFVVRSNGSKITED 495

Query: 456 EIKQYISKQVVFYKRINRVFFTDAIPKAASGKILRKELTARLNKDLVAT*NLTCEED 286
           EIKQYISKQV+FYKRI RVFFT+AIPKA SGKILRK+L AR     V+  +L C  D
Sbjct: 496 EIKQYISKQVIFYKRIGRVFFTEAIPKAPSGKILRKDLRAR-----VSAGDLPCTSD 547

>gb|AAL98709.1|AF279267_1 4-coumarate:coenzyme A ligase [Glycine max]
          Length = 546

 Score =  170 bits (431), Expect = 1e-41
 Identities = 89/107 (83%), Positives = 98/107 (91%)
 Frame = -3

Query: 636 RLKXLI*SKGFQVAPAELEALLIAHPNISDAAVVPLKDEAAGELPVAFIVRSNGSKITDD 457
           RLK LI  KGFQVAPAELEALLIAHPNISDAAVV +KDEAAGE+PVAF+VRSNGS+I +D
Sbjct: 437 RLKELIKYKGFQVAPAELEALLIAHPNISDAAVVGMKDEAAGEIPVAFVVRSNGSEIAED 496

Query: 456 EIKQYISKQVVFYKRINRVFFTDAIPKAASGKILRKELTARLNKDLV 316
           EIK+YIS+QVVFYKRI RVFFTD+IPKA SGKILRK LTARLN+ LV
Sbjct: 497 EIKKYISQQVVFYKRICRVFFTDSIPKAPSGKILRKVLTARLNEGLV 543

>pir||T07909 4-coumarate-CoA ligase (EC 6.2.1.12) 1 [validated] - western balsam
           poplar x cottonwood gi|2911799|gb|AAC39366.1|
           4-coumarate:CoA ligase 1 [Populus balsamifera subsp.
           trichocarpa x Populus deltoides]
          Length = 557

 Score =  169 bits (428), Expect = 3e-41
 Identities = 85/102 (83%), Positives = 96/102 (93%)
 Frame = -3

Query: 636 RLKXLI*SKGFQVAPAELEALLIAHPNISDAAVVPLKDEAAGELPVAFIVRSNGSKITDD 457
           RLK LI  KGFQVAPAELEA+LIAHP+ISD AVVP+KDEAAGE+P+AF+VR+NGSKIT+D
Sbjct: 437 RLKELIKYKGFQVAPAELEAMLIAHPDISDCAVVPMKDEAAGEVPIAFVVRANGSKITED 496

Query: 456 EIKQYISKQVVFYKRINRVFFTDAIPKAASGKILRKELTARL 331
           EIKQYISKQVVFYKRI+RVFFT+AIPKA SGKILRK+L ARL
Sbjct: 497 EIKQYISKQVVFYKRISRVFFTEAIPKAPSGKILRKDLRARL 538

>gb|AAF91309.1|AF239686_1 4-coumarate:coA ligase 2 [Rubus idaeus]
          Length = 544

 Score =  165 bits (417), Expect = 5e-40
 Identities = 83/102 (81%), Positives = 95/102 (92%)
 Frame = -3

Query: 636 RLKXLI*SKGFQVAPAELEALLIAHPNISDAAVVPLKDEAAGELPVAFIVRSNGSKITDD 457
           RLK LI  KGFQVAPAELEA+LI+HPN+SDAAVV +KDEAAGE+PVAF+VRSNGSKI++D
Sbjct: 437 RLKELIKYKGFQVAPAELEAMLISHPNLSDAAVVSMKDEAAGEVPVAFVVRSNGSKISED 496

Query: 456 EIKQYISKQVVFYKRINRVFFTDAIPKAASGKILRKELTARL 331
           +IKQYISKQVVFYKRI++VFFTD IPKA SGKILRK+L ARL
Sbjct: 497 DIKQYISKQVVFYKRISKVFFTDKIPKAPSGKILRKDLRARL 538

>sp|O24540|4CL_VANPL 4-coumarate--CoA ligase (4CL) (4-coumaroyl-CoA synthase)
          Length = 553

 Score =  162 bits (410), Expect = 3e-39
 Identities = 82/102 (80%), Positives = 92/102 (89%)
 Frame = -3

Query: 636 RLKXLI*SKGFQVAPAELEALLIAHPNISDAAVVPLKDEAAGELPVAFIVRSNGSKITDD 457
           RLK LI  KGFQVAPAELEALL+ HP ISDAAVVP+KDEAAGE+PVAF+V+SNG  IT+D
Sbjct: 444 RLKELIKYKGFQVAPAELEALLLTHPCISDAAVVPMKDEAAGEVPVAFVVKSNGHNITED 503

Query: 456 EIKQYISKQVVFYKRINRVFFTDAIPKAASGKILRKELTARL 331
           EIKQ+ISKQV+FYKRINRVFF +AIPKA SGKILRK+L ARL
Sbjct: 504 EIKQFISKQVIFYKRINRVFFVEAIPKAPSGKILRKDLRARL 545

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 485,205,911
Number of Sequences: 1393205
Number of extensions: 9769845
Number of successful extensions: 28408
Number of sequences better than 10.0: 1376
Number of HSP's better than 10.0 without gapping: 26671
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27798
length of database: 448,689,247
effective HSP length: 118
effective length of database: 284,291,057
effective search space used: 26723359358
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf069g03 BP066088 1 564
2 GNLf010f06 BP075407 12 498
3 GENLf035h04 BP064205 15 560
4 GENLf015b04 BP063129 17 586
5 GENLf056b02 BP065320 18 311
6 GENLf065d01 BP065853 18 505
7 GENf068f10 BP061281 18 506
8 GENLf076c05 BP066457 18 544
9 GENLf035e05 BP064187 18 544
10 GENLf085e08 BP066982 18 542
11 GNLf001h08 BP074876 18 304
12 GENLf021b10 BP063448 18 574
13 GENLf008d10 BP062764 18 584
14 GENf002h12 BP058418 19 551
15 GENLf042c10 BP064551 19 235
16 MR090a05_f BP082887 20 397
17 MF094e08_f BP033218 22 583
18 GENLf067h11 BP065984 22 122
19 GENLf010h02 BP062896 23 541
20 GNLf002h05 BP074932 26 337
21 GENLf061e04 BP065614 32 524
22 GENLf060f02 BP065569 32 575
23 MR059e06_f BP080529 34 438
24 GENLf027h05 BP063797 34 560
25 GENLf039c04 BP064390 35 573
26 GENLf057a07 BP065372 36 564
27 GENLf065h10 BP065885 52 563
28 GENLf077a12 BP066512 56 526
29 GENLf048h08 BP064930 64 633
30 GENLf014b01 BP063065 68 633
31 GENf063a11 BP061025 72 423
32 GENLf032c10 BP064015 72 551
33 GENLf015f03 BP063163 72 607
34 GENLf022h12 BP063538 73 574
35 GENLf042b03 BP064543 73 572
36 GNLf010b01 BP075376 73 605
37 GENLf048c10 BP064895 75 616
38 GENLf043b12 BP064607 75 608
39 GENLf079e06 BP066646 75 507
40 GNLf004d02 BP075016 75 581
41 GNLf014a09 AU254055 75 342
42 GNLf006d09 BP075150 75 668
43 GENLf055f08 BP065294 79 322
44 GENLf013d06 BP063023 79 608
45 GENLf030b04 BP063906 80 326
46 GENLf010h01 BP062895 80 607
47 GENLf086a02 BP067006 80 600
48 GENLf089a09 BP067188 82 585
49 GENLf067a08 BP065943 82 187
50 GENLf059d06 BP065503 83 603
51 GENLf044b07 BP064659 84 578
52 GENLf047b08 BP064821 84 584
53 GENLf080h10 BP066723 84 575
54 GENLf009a03 BP062797 84 608
55 GNLf005e09 BP075087 84 370
56 GNLf007h06 BP075241 85 565
57 GENLf026d01 BP063700 86 503
58 GENLf090e02 BP067265 87 620
59 GENLf030a12 BP063904 90 629
60 GENLf046c06 BP064770 114 608
61 GENLf001h11 BP062445 140 564




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research