KMC000028A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000028A_C01 KMC000028A_c01
GAAAAAGAAAATGGTTTATTTCTCAAGAATAGCAATGGAACTACAATGAGTCAATGACTA
CGGGTATTTGAGAAACTAGCACTCTCCCTAAATGTCCCTGATTACAATCTAGATACCCTC
GCCCTCTTACTTAGATTTCCTCATTCTCTCTAACCAACTCATTAACTAACTAACCCCCAC
TAAGAGTTACCTATCATTCCATCGTTAAATATGATGCAACATGTATTTCTGTACACCTTA
CCTAGGAATGAGATAATGTATGCTACAGAGAATCAGAAGAGGTTTATCCTCCTAAGTCAT
TCCTTCAACGAGCAAGGGCTGTCACACAAACAGATTCATCCTTCAAGGGAATACAATATT
TCATCAATGCCTCTGCTGCCAAGTGCTAATTACCATTTATTATTACTAACAACTGAAAAT
GTTGGGTTACGATGCCTCTGCGGTATTGCATCCTTTTGCTTAGAGAGCTGCTGGGTTATG
ATGCTCCAATTTCTTCAA


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000028A_C01 KMC000028A_c01
         (498 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P98088|MUC5_HUMAN Tracheobronchial mucin (TBM) (Major airway ...    32  5.1
gb|AAH33831.1| Unknown (protein for IMAGE:3852667) [Homo sapiens]      32  5.1
pir||A57534 mucin 5AC (clone L31) - human (fragment) gi|1052608|...    32  5.1
emb|CAA04738.1| MUC5AC protein [Homo sapiens] gi|3334749|emb|CAA...    32  5.1
ref|NP_726292.1| Gustatory receptor 59c CG30186-PA gi|22095712|s...    31  6.7

>sp|P98088|MUC5_HUMAN Tracheobronchial mucin (TBM) (Major airway glycoprotein)
            gi|631466|pir||A53767 mucin MUC5B, tracheobronchial -
            human gi|488073|gb|AAA18431.1| tracheobronchial mucin
          Length = 1056

 Score = 31.6 bits (70), Expect = 5.1
 Identities = 12/26 (46%), Positives = 18/26 (69%)
 Frame = +2

Query: 317  GCHTNRFILQGNTIFHQCLCCQVLIT 394
            G  ++ + L+GNT+ H+C CCQ L T
Sbjct: 947  GDSSSMYSLEGNTVEHRCQCCQELRT 972

>gb|AAH33831.1| Unknown (protein for IMAGE:3852667) [Homo sapiens]
          Length = 574

 Score = 31.6 bits (70), Expect = 5.1
 Identities = 12/26 (46%), Positives = 18/26 (69%)
 Frame = +2

Query: 317 GCHTNRFILQGNTIFHQCLCCQVLIT 394
           G  ++ + L+GNT+ H+C CCQ L T
Sbjct: 482 GDSSSMYSLEGNTVEHRCQCCQELRT 507

>pir||A57534 mucin 5AC (clone L31) - human (fragment) gi|1052608|emb|CAA88307.1|
           apomucin [Homo sapiens]
          Length = 1042

 Score = 31.6 bits (70), Expect = 5.1
 Identities = 12/26 (46%), Positives = 18/26 (69%)
 Frame = +2

Query: 317 GCHTNRFILQGNTIFHQCLCCQVLIT 394
           G  ++ + L+GNT+ H+C CCQ L T
Sbjct: 858 GDSSSMYSLEGNTVEHRCQCCQELRT 883

>emb|CAA04738.1| MUC5AC protein [Homo sapiens] gi|3334749|emb|CAA04737.1| MUC5AC
            protein [Homo sapiens]
          Length = 1081

 Score = 31.6 bits (70), Expect = 5.1
 Identities = 12/26 (46%), Positives = 18/26 (69%)
 Frame = +2

Query: 317  GCHTNRFILQGNTIFHQCLCCQVLIT 394
            G  ++ + L+GNT+ H+C CCQ L T
Sbjct: 989  GDSSSMYSLEGNTVEHRCQCCQELRT 1014

>ref|NP_726292.1| Gustatory receptor 59c CG30186-PA gi|22095712|sp|Q9W1U5|G59C_DROME
           Putative gustatory receptor 59c
           gi|23240127|gb|AAF46958.3| CG30186-PA [Drosophila
           melanogaster]
          Length = 397

 Score = 31.2 bits (69), Expect = 6.7
 Identities = 11/34 (32%), Positives = 21/34 (61%)
 Frame = -2

Query: 269 SVAYIISFLGKVYRNTCCIIFNDGMIGNS*WGLV 168
           S+ Y  S +G +Y + C I+++    G++ WGL+
Sbjct: 261 SLVYFFSTMGSIYFSVCSILYSSTGFGSTYWGLL 294

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 382,698,016
Number of Sequences: 1393205
Number of extensions: 7228877
Number of successful extensions: 13316
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 13132
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13309
length of database: 448,689,247
effective HSP length: 114
effective length of database: 289,863,877
effective search space used: 14783057727
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GNf031a07 BP069589 1 414
2 GENf061f12 BP060964 5 351
3 GENf035c11 BP059838 5 385
4 GNf092g05 BP074191 5 415
5 GENf068h03 BP061290 5 360
6 GENf045c12 BP060251 5 379
7 GENf071b10 BP061390 5 364
8 GENLf001h08 BP062444 5 516




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research