KMC000027A_c03
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000027A_C03 KMC000027A_c03
AACAAAAACGTATTTCCATTCAAGAAGATGGATAACTCATTTTAAGTTATAGCAAAGCTT
CTCCATTTGGCACATTAAGCAGATATCTTTACAAGAGCACGCTGAGGATAATTTCCAAAC
TCAACCCCATGTTCATTTAGCTGATAATTACCTTACATATCATAGGTAATTTTTGCGGGT
AACCAATAGGTCTTTTGCAAATTGTCATCGATAATATTATGACTACCAAAATGCCCTATG
TAATTCACATGTATTAATCTAATATGGAACAAGCTTGGCCTTCACTATGTTCTTAACATT
GAACAAGCTTGGCAGGAAAAGAGAATATCCCAACACTAATTGTTACAGTGATTTATACTG
CTCAATGAGATGAGATGCATGGAGGCGTGATGTAGGGGTCGCGGTGCAACCCAATTTTTT
CAAATATGAGATCTGTTTGTCAGTTGGTGTTGACGAACCCATTGCTTTCTCAATCCTTAA
TTTCAAGAAATGTTCCTGTTTTTCCCTCATAAGATGAGCACGTTTATCAGCAGGAATTCG
CTCCCATCTCAAAATAGATGGAGCATACTGAAATGCTTCATCACATCTTATGCAAGATTT
TAGTGTATTCAACAAATCCTTGTTTTTGTTTTTCTGATGTCTAAG


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000027A_C03 KMC000027A_c03
         (645 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_703540.1| hypothetical protein [Plasmodium falciparum 3D7...    33  3.3
ref|NP_473177.2| hypothetical protein [Plasmodium falciparum 3D7...    32  7.3
ref|NP_062014.1| transducin-like enhancer of split 4, homolog of...    32  9.5

>ref|NP_703540.1| hypothetical protein [Plasmodium falciparum 3D7]
            gi|23504682|emb|CAD51560.1| hypothetical protein
            [Plasmodium falciparum 3D7]
          Length = 2488

 Score = 33.1 bits (74), Expect = 3.3
 Identities = 22/73 (30%), Positives = 34/73 (46%)
 Frame = -1

Query: 456  SSTPTDKQISYLKKLGCTATPTSRLHASHLIEQYKSL*QLVLGYSLFLPSLFNVKNIVKA 277
            +STP+      + K  C     SR H     ++Y  L  L LG++L L S + +  ++  
Sbjct: 2347 NSTPSSAVYQLIYKKTC-----SRTHEDFNSDKYSLLTDLKLGHNLNLKSAYAISKLLSQ 2401

Query: 276  KLVPY*INTCELH 238
            KL P   N  EL+
Sbjct: 2402 KLNPEEYNNLELY 2414

>ref|NP_473177.2| hypothetical protein [Plasmodium falciparum 3D7]
            gi|15375373|emb|CAB39000.2| hypothetical protein
            [Plasmodium falciparum 3D7]
          Length = 1446

 Score = 32.0 bits (71), Expect = 7.3
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = +2

Query: 188  RSFANCHR*YYDYQNALCNSHVLI*YGTSLAFTMFLTLNKLGRKREYPNTN 340
            ++  N H  YY  +N + N+HVL  Y T L F  FL   K  +K+ Y + N
Sbjct: 977  KNIRNIHNSYYHIKNIIKNNHVLYVYSTYLQF--FLLWRK-KKKKNYEDDN 1024

>ref|NP_062014.1| transducin-like enhancer of split 4, homolog of Drosophila E(spl)
           [Rattus norvegicus] gi|1174716|sp|Q07141|TLE4_RAT
           Transducin-like enhancer protein 4 (ESP2 protein)
           gi|1083650|pir||B49555 enhancer of split homolog R-esp2
           - rat gi|294549|gb|AAC37640.1| 'transducin [Rattus
           norvegicus]
          Length = 741

 Score = 31.6 bits (70), Expect = 9.5
 Identities = 22/87 (25%), Positives = 38/87 (43%), Gaps = 8/87 (9%)
 Frame = -1

Query: 600 KSCIRCDEAFQYAPSILRWERIPADKRAHLMREKQEHFLKLRIEKAMGSSTPTDKQISYL 421
           +SC R  E FQ+  +     ++  +K A    E Q H++ +  E + G +    KQ   +
Sbjct: 23  ESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYV-MYYEMSYGLNIEMHKQAEIV 81

Query: 420 KKLG--------CTATPTSRLHASHLI 364
           K+L         C +    +L A HL+
Sbjct: 82  KRLNAICAQVIPCLSQEQQQLQAQHLL 108

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 535,317,035
Number of Sequences: 1393205
Number of extensions: 11303187
Number of successful extensions: 19846
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 19366
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19845
length of database: 448,689,247
effective HSP length: 118
effective length of database: 284,291,057
effective search space used: 27291941472
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf052f04 BP065143 1 415
2 GNf010d10 BP068086 2 441
3 GENf029a11 BP059561 50 444
4 GENLf056d10 BP065339 114 489
5 GENLf001h06 BP062443 118 653




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research