KMC000026A_c03
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000026A_C03 KMC000026A_c03
agcacaactcagtATAATTCATCAAAGAGAAACGAGTTTAAATTCACTTCAGGGGATTAC
GAATTGTGAGCATGAAAGTGTTTAAGAGAATATAGAAGTTCTCAACAGTGCCAGAGCTAC
TAGTCTACAAAGTACAAACCAGAAGAATCCTTGGCCTCATTAAGTGACCAGAAATTGGAC
TAGAAGTTCTCCAAAAACAAATGGGATAAGGGTGAAAACACGTTAAACACGTTAAACACT
TGTAGTTGGGCGGGGGCACACTGCCTTCTATTCCCTCATTTTGAAAATACATAGTAACAA
CCAGTTCAAAGATTAACTAGAGGGTGGAAAAAAACCACAGCATTAAGAAGATGACATTTC
ACGCCCAAGAACTCAACTTCAAGAGGGTAATAGAGCAGTAGTAGTGACTCGAATAATTCA
TTTACGTAGCCACTCTCTCCATAGGAGAACCAGTTTTCTAAGTACCATATGAATGTTTGA
ACTTTGCAACTCAGGACCGAACTCATGAGGAGTACTCAAATGGTTGAGGAGGTTGAGGTT
CTTCGTCCACAGCCATTGCCGATGAAGAACTTTGCAATCCAGCAGCTGATCCAGCAGCAG
TTGAAGTGGCCGATGCGGGTGTGACGGTAATCGCGAGCACTTCTGGCTCGGTAGGACGCA
GGTCTTTGAGAAGCACAAATCCTGAAGGTGCCAACTTAACTGGAGCATATCTGCTATCCT
GTAAAAATTTGATGAACTTCTCC


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000026A_C03 KMC000026A_c03
         (743 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_180832.1| 26S proteasome regulatory subunit (RPN2), putat...   107  1e-22
dbj|BAB78498.1| 26S proteasome regulatory particle non-ATPase su...   105  7e-22
ref|NP_171973.1| 26S proteasome regulatory subunit (RPN2), putat...   104  2e-21
gb|AAL83992.1| 26S proteasome regulatory subunit [Oryza sativa]        57  3e-07
ref|NP_702521.1| 26S proteasome subunit, putative [Plasmodium fa...    37  0.39

>ref|NP_180832.1| 26S proteasome regulatory subunit (RPN2), putative; protein id:
            At2g32730.1, supported by cDNA: gi_20466789 [Arabidopsis
            thaliana] gi|7486095|pir||T00795 26S proteasome
            regulatory subunit [imported] - Arabidopsis thaliana
            gi|2914700|gb|AAC04490.1| 26S proteasome regulatory
            subunit (RPN2), putative [Arabidopsis thaliana]
            gi|20466790|gb|AAM20712.1| 26S proteasome regulatory
            subunit [Arabidopsis thaliana]
          Length = 1004

 Score =  107 bits (268), Expect = 1e-22
 Identities = 55/80 (68%), Positives = 63/80 (78%), Gaps = 1/80 (1%)
 Frame = -2

Query: 742  EKFIKFLQDSRYAPVKLAPSGFVLLKDLRPTEPEVLAITVTPASATSTAAGSAAGLQSS- 566
            EK+IK L DSRY PVKLAPSGFVLLKDLR  EPEVL++T  P S  S A G+AA  Q + 
Sbjct: 925  EKYIKLLDDSRYVPVKLAPSGFVLLKDLREHEPEVLSLTDAPTSTASPATGTAAAAQGTP 984

Query: 565  SSAMAVDEEPQPPQPFEYSS 506
            +SAMAVD+EPQPPQ FEY+S
Sbjct: 985  ASAMAVDDEPQPPQAFEYAS 1004

>dbj|BAB78498.1| 26S proteasome regulatory particle non-ATPase subunit2a [Oryza
           sativa (japonica cultivar-group)]
          Length = 284

 Score =  105 bits (262), Expect = 7e-22
 Identities = 53/80 (66%), Positives = 63/80 (78%), Gaps = 1/80 (1%)
 Frame = -2

Query: 742 EKFIKFLQDSRYAPVKLAPSGFVLLKDLRPTEPEVLAITVTPASATSTAAGSAAGLQ-SS 566
           EKFIKFL+  RY PVKLAPSGFVLL+DL+PTE E L +T  PA+  + AA + AG Q S 
Sbjct: 205 EKFIKFLEGGRYEPVKLAPSGFVLLRDLKPTETEELVLTDAPATQATNAAAATAGQQGSG 264

Query: 565 SSAMAVDEEPQPPQPFEYSS 506
           ++AMAVDEEP PPQPFEY+S
Sbjct: 265 AAAMAVDEEPLPPQPFEYTS 284

>ref|NP_171973.1| 26S proteasome regulatory subunit (RPN2), putative; protein id:
            At1g04810.1 [Arabidopsis thaliana]
            gi|25347943|pir||C86181 hypothetical protein [imported] -
            Arabidopsis thaliana gi|7211984|gb|AAF40455.1|AC004809_13
            Strong similarity to the SEN3-like tRNA-processing
            protein F24L7.13 from A. thaliana gi|2914700 on BAC
            gb|AC003974.  EST gb|AA712969 comes from this gene.
            [Arabidopsis thaliana] gi|28393231|gb|AAO42045.1|
            putative 26S proteasome regulatory subunit (RPN2)
            [Arabidopsis thaliana]
          Length = 1001

 Score =  104 bits (259), Expect = 2e-21
 Identities = 51/83 (61%), Positives = 65/83 (77%), Gaps = 4/83 (4%)
 Frame = -2

Query: 742  EKFIKFLQDSRYAPVKLAPSGFVLLKDLRPTEPEVLAITVTPASATSTAAGSAAGLQ--- 572
            EK+IK ++DSRY P+KLAPSGFVLL+DLRP EPEVL++T  P S  S A G+ A  Q   
Sbjct: 918  EKYIKLMEDSRYVPMKLAPSGFVLLRDLRPHEPEVLSLTDAPTSTASPAVGAEAAGQAQQ 977

Query: 571  -SSSSAMAVDEEPQPPQPFEYSS 506
             +++SAMA+D+EPQPPQ FEY+S
Sbjct: 978  AATTSAMAIDDEPQPPQAFEYAS 1000

>gb|AAL83992.1| 26S proteasome regulatory subunit [Oryza sativa]
          Length = 88

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 25/35 (71%), Positives = 31/35 (88%)
 Frame = -2

Query: 742 EKFIKFLQDSRYAPVKLAPSGFVLLKDLRPTEPEV 638
           EKFIKF++ SRY PVK APSGF+LL+D++PTE EV
Sbjct: 54  EKFIKFIEGSRYVPVKPAPSGFILLQDMQPTEAEV 88

>ref|NP_702521.1| 26S proteasome subunit, putative [Plasmodium falciparum 3D7]
            gi|23497706|gb|AAN37245.1|AE014826_44 26S proteasome
            subunit, putative [Plasmodium falciparum 3D7]
          Length = 1172

 Score = 36.6 bits (83), Expect = 0.39
 Identities = 16/34 (47%), Positives = 24/34 (70%), Gaps = 1/34 (2%)
 Frame = -2

Query: 742  EKFIKFLQDSRYAPV-KLAPSGFVLLKDLRPTEP 644
            EK+I+++ +SRY PV     SGF++L D+ P EP
Sbjct: 1111 EKYIEYIPNSRYIPVLPTRKSGFIMLNDITPLEP 1144

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 631,784,739
Number of Sequences: 1393205
Number of extensions: 13911182
Number of successful extensions: 38914
Number of sequences better than 10.0: 31
Number of HSP's better than 10.0 without gapping: 36561
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38738
length of database: 448,689,247
effective HSP length: 120
effective length of database: 281,504,647
effective search space used: 35751090169
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MFL003a01_f BP033567 1 493
2 MPDL004f04_f AV776729 14 620
3 MWL012h07_f AV768790 18 388
4 MPDL088d02_f AV781098 20 552
5 SPDL082c01_f BP057109 21 608
6 MRL037d08_f BP085541 24 172
7 MPDL062e07_f AV779662 38 617
8 GNLf008h02 BP075302 40 533
9 SPDL085a05_f BP057297 67 549
10 MFL023c01_f BP033924 67 644
11 GENLf017b10 BP063255 70 483
12 GNLf007c02 BP075200 88 258
13 GENLf001h05 BP062442 100 542
14 MFL022e08_f BP033912 110 677
15 GNLf004e09 BP075028 113 390
16 MRL026c02_f BP085039 201 566
17 MRL019g04_f BP084709 217 672
18 MFB007h04_f BP034443 222 762
19 MRL013d11_f BP084380 230 590
20 SPDL087c09_f BP057450 266 729
21 GNLf013b11 BP075558 348 530




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research