KMC000025A_c97
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000025A_C97 KMC000025A_c97
AGAGAAATCCAACCTTGGCATATATTCTTAGATAAAACGACAAGAATTACAGCAAGGACA
AGAGATGGGGCCAGTGAGAGATTTAATGACAAGAAAGAAAAAAAAAAACTGAAAAAAGAA
AAGAAGGATCCAGAAATGACTCGGCTGTTATTTTTGGATTTGGGCAAAATACACAATCAC
AGCCGTAAATCAGCACATGGGCTGGGTCCTCTTCCAACTTAAAAAGCAAAGGATTACTGG
ACCCATGAACCGAAAACATGACCCACCTAAAAATAGATCATAATCATCATAATATTAGCA
TTGGCATAGAATAATCATCTTTACATTACAAATTACAAAGAGCTTGGGAAATTAAAAGAA
GAACCCAAAAAAAAAAAAAGATAAACAGAACATCAGTGATGTTGATGATGAAATGAAACC
CACAAGACATGGGCTTGTGATTATGATTCTCCCAAACAGTTGTACTGATCATGAACCGTT
TGAATTCAATCACTGTGGACTTGAAGGGCAATGGCTCGGATAACAACCACGTGGTAGATA
GCTGCAAGAAGCAGCTCCGATGAATGGTCCCACCCAGAAGATCCAGTGATCATCCCAGCC
ACGGTGCCTTGTTGAAGATAATGGCAGCACCGAGACTCCTAGCAGGGCTTGATACCAGTT
CCTGGTAATGGGGATGGTAGCCAAATGCACCAAGAACACAGCGAACCCAATAGGCAGAGG
TGCCAAAATGGGGACGTGAGAGTCTCTGGCGCTACGCTTAGCATCGGTGGCGGAGAAGAC
GGTGTAAACAAGAACAAAGGTGCCAACAATCTCAGCACCGAGACCATCACCCTTGGTGTA
ACCAGGGGCAACAAAGTTAGCACCACCTCCTAGAGTTCCGTACTTGGTCTTTCCCTCAAA
ACCTTTCACCACGCCGGCGCCAACAATAGCACCCAGGCACTGCATCACGATGTAGAAAAT
AGCCCTTGTCAAGGACAACTTCCTCGCCAAAAACAGCCCAAAAGTCACAGCCGGGTTTAT
GTGACCTCCTGAGATTCCGGCGGTGCAGTAAACGAGAGCGAAGATCATGCCACCGAAAGC
CCAAGCAATCCCTTGAATACCAACAGTTTTGCACTTGCTATCGGCACCGCTGACACCCAT
GACGGTCAAGACGGTGATGTAGAGGAACAGAAAGGTGGCAACAAACTCGGCAATACCGGC
TCTGTAGAAGGACCATGAGGTGAGCTCCGACGGCTCAAACAGCGGCGCCAGGTGGTGGCT
CCTGGTAGTCCTTGCCATCATCTTGGCTCTGAGCTGCTATGCCGATGGGTTGCCTCTCCG
GGTACTTGTTCGCACCCAAGGACACATCCTGCTCCTTCGCCTCCATCGATGGTTAGTGGT
TGTTCTGGTTCTTCTGATGATGGTGGTGATGAATGATTGGTGTGTAGTAGTGTGGTCGCA
TTCCTGTGGTAAACGATGCAGTGTTTAAGACTGAAACCGCCGCTATCGTTTCCAGTCACA
TTCTCACCTTCCAAACACCTCCGACGAAATCACCTACCGGCGTGGTCCTCAACCCGATCT
CCGATCAAGAGCATGTCAACCACCGTGGAGCACATCGTCCTCTTCAAGGTCAAAGACGAC
ACCGACCCCTCCAAGGTCACCGCCATGGTCAACGGCCTCAGCTCCCTCATCTCCCTAGAC
CACGTCCTCCACCTCACGGTGGGCCCAATCCTCCGCAACCGCTCCACCTCCTTGACCTTC
ACCCACATGCTCCACAGCCGCTATAACTCCAAGGAAGATCTCGACGCCTACTCCGCTCAC
CCCAGCCACCTCGGCGTCGTCAGGGGGAATGTCCTCCCCATCATCGACGACCTCATGGCC
GTCGATTGGGTCGCCGAAGATCTCCGCGGCGATATCGTCACGCCGCAGGGGTCGGCGATG
CGACTTACCTTGTTGAAATTGAAGGAGAATGCGGATAGCGGTAAGGTTCTGGGGGTTATC
AGAGAAATTCCGGAGAGCTTCAAGCAGATTAGTCAGCTGAGCTGCGGCGAGAATTTCTCC
CCGGCGAGAGCTAAGGGCTTCTCGGTTGCTTCCCTGGCGGTTTTTCCTGGACAGGGGGAG
TTGGAGGATGTGGATTCGAATGGGGAGGTGGTGAGTTATCATAAGGATAAGGTTAGGGAT
CTGCTAGAGAGTGTGGTTGTGGTTGATTATGTGGTGCCGCCGCCGCCTGCTCAGTCTGCT
AGCCTTTGATAAGGTTATTGCTTCTCTTGCCATTGTAACTGTTCAATCATTGTTTTTGCT
TTATCATCTTCATGTATTAAGCCTTCAATGCTTTGTTGTGATGTGCAATGTGGGGAATAA
GGTTTGAGAGAGAATGCTTTCTTGTGGTGTGCAATGTGGGAAATAATGAAATGTTAATGG
TTATCTTTTAGTTTCTACTT


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000025A_C97 KMC000025A_c97
         (2420 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAK66766.1|AF386739_1 aquaporin protein PIP1;1 [Medicago trun...   406  e-128
gb|AAC17528.1| aquaporin 1 [Samanea saman]                            395  e-126
pir||T09260 aquaporin-like transmembrane channel protein - alfal...   392  e-124
sp|P25794|TIPW_PEA WATER-STRESS INDUCED TONOPLAST INTRINSIC PROT...   394  e-124
emb|CAA38241.1| 289 aa peptide [Pisum sativum]                        392  e-124

>gb|AAK66766.1|AF386739_1 aquaporin protein PIP1;1 [Medicago truncatula]
          Length = 289

 Score =  406 bits (1044), Expect(2) = e-128
 Identities = 204/235 (86%), Positives = 213/235 (89%), Gaps = 2/235 (0%)
 Frame = -3

Query: 1248 APLFEPSELTSWSFYRAGIAEFVATFLFLYITVLTVMGVSGADSKCKTVGIQGIAWAFGG 1069
            APLFEPSELTSWSFYRAGIAEFVATFLFLYITVLTVMGV  ADSKCKTVGIQGIAWAFGG
Sbjct: 40   APLFEPSELTSWSFYRAGIAEFVATFLFLYITVLTVMGVVRADSKCKTVGIQGIAWAFGG 99

Query: 1068 MIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIVMQCLGAIVGAGVVKGFEGK 889
            MIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRA+FY+VMQCLGAI GAGVVKGFEGK
Sbjct: 100  MIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFEGK 159

Query: 888  TKYGTLGGGANFVAPGYTKGDGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPI 709
            T++G L GGANFVAPGYTKGDGLGAEIVGTF+LVYTVFSATDAKRSARDSHVPILAPLPI
Sbjct: 160  TRFGDLKGGANFVAPGYTKGDGLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPI 219

Query: 708  GFAVFLVHLATIPITRNWYQAL--LGVSVLPLSSTRHRGWDDHWIFWVGPFIGAA 550
            GFAVFLVHLATIPIT         LG +++     +  GWDDHWIFWVGPFIGAA
Sbjct: 220  GFAVFLVHLATIPITGTGINPARSLGAAII---FNKDLGWDDHWIFWVGPFIGAA 271

 Score = 79.0 bits (193), Expect(2) = e-128
 Identities = 36/39 (92%), Positives = 38/39 (97%)
 Frame = -2

Query: 1366 MEAKEQDVSLGANKYPERQPIGIAAQSQDDGKDYQEPPP 1250
            MEAKEQDVSLGANK+PERQP+GIAAQSQDD KDYQEPPP
Sbjct: 1    MEAKEQDVSLGANKFPERQPLGIAAQSQDDPKDYQEPPP 39

>gb|AAC17528.1| aquaporin 1 [Samanea saman]
          Length = 289

 Score =  395 bits (1014), Expect(3) = e-126
 Identities = 197/235 (83%), Positives = 207/235 (87%), Gaps = 2/235 (0%)
 Frame = -3

Query: 1248 APLFEPSELTSWSFYRAGIAEFVATFLFLYITVLTVMGVSGADSKCKTVGIQGIAWAFGG 1069
            APLFEPSELTSWSFYRAGIAEFVATFLFLYIT+LTVMGVS +DSKCKTVGIQGIAWAFGG
Sbjct: 40   APLFEPSELTSWSFYRAGIAEFVATFLFLYITILTVMGVSRSDSKCKTVGIQGIAWAFGG 99

Query: 1068 MIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIVMQCLGAIVGAGVVKGFEGK 889
            MIFALVYCTAGISGGHINPAVTFGLFL RKLSLTR IFYIVMQCLGAI GAGVVKGFEGK
Sbjct: 100  MIFALVYCTAGISGGHINPAVTFGLFLGRKLSLTRTIFYIVMQCLGAICGAGVVKGFEGK 159

Query: 888  TKYGTLGGGANFVAPGYTKGDGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPI 709
              YG  GGG N+V  GYTKGDGLGAEIVGTF+LVYTVFSATDAKRSARDSHVPILAPLPI
Sbjct: 160  KLYGDNGGGVNYVHSGYTKGDGLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPI 219

Query: 708  GFAVFLVHLATIPITRNWYQAL--LGVSVLPLSSTRHRGWDDHWIFWVGPFIGAA 550
            GFAVFLVHLATIPIT         LG +++     +H GW +HW+FWVGPFIGAA
Sbjct: 220  GFAVFLVHLATIPITGTGINPARSLGAAII---FNKHLGWHEHWVFWVGPFIGAA 271

 Score = 76.3 bits (186), Expect(3) = e-126
 Identities = 35/39 (89%), Positives = 36/39 (91%)
 Frame = -2

Query: 1366 MEAKEQDVSLGANKYPERQPIGIAAQSQDDGKDYQEPPP 1250
            ME KEQDVSLGANK+ ERQPIG AAQSQDDGKDYQEPPP
Sbjct: 1    MEGKEQDVSLGANKFSERQPIGTAAQSQDDGKDYQEPPP 39

 Score = 26.9 bits (58), Expect(3) = e-126
 Identities = 12/13 (92%), Positives = 13/13 (99%)
 Frame = -1

Query: 548 LAAIYHVVVIRAI 510
           LAA+YHVVVIRAI
Sbjct: 272 LAALYHVVVIRAI 284

>pir||T09260 aquaporin-like transmembrane channel protein - alfalfa
            gi|2623060|gb|AAB86380.1| aquaporin-like transmembrane
            channel protein [Medicago sativa]
          Length = 290

 Score =  392 bits (1008), Expect(2) = e-124
 Identities = 198/235 (84%), Positives = 210/235 (89%), Gaps = 2/235 (0%)
 Frame = -3

Query: 1248 APLFEPSELTSWSFYRAGIAEFVATFLFLYITVLTVMGVSGADSKCKTVGIQGIAWAFGG 1069
            APLFEPSELTSWSFYRAGIAEFVATFLFLYIT+LTVMGV+ ++SKCKTVGIQGIAW+FGG
Sbjct: 40   APLFEPSELTSWSFYRAGIAEFVATFLFLYITLLTVMGVNRSESKCKTVGIQGIAWSFGG 99

Query: 1068 MIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIVMQCLGAIVGAGVVKGFEGK 889
            MIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRA+FY+VMQ LGAI GAGVVKGFEGK
Sbjct: 100  MIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALFYMVMQTLGAICGAGVVKGFEGK 159

Query: 888  TKYGTLGGGANFVAPGYTKGDGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPI 709
            T Y    GGANFVAPGYTKGDGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPI
Sbjct: 160  TFYTNKNGGANFVAPGYTKGDGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPI 219

Query: 708  GFAVFLVHLATIPITRNWYQAL--LGVSVLPLSSTRHRGWDDHWIFWVGPFIGAA 550
            GFAVFLVHLATIPIT         LG +++     +  GW+DHWIFWVGPFIGAA
Sbjct: 220  GFAVFLVHLATIPITGTGINPARSLGAAII---FNKDLGWNDHWIFWVGPFIGAA 271

 Score = 79.3 bits (194), Expect(2) = e-124
 Identities = 36/39 (92%), Positives = 38/39 (97%)
 Frame = -2

Query: 1366 MEAKEQDVSLGANKYPERQPIGIAAQSQDDGKDYQEPPP 1250
            MEAKEQDVSLGANK+PERQPIGIAAQS DDGKDY+EPPP
Sbjct: 1    MEAKEQDVSLGANKFPERQPIGIAAQSHDDGKDYKEPPP 39

>sp|P25794|TIPW_PEA WATER-STRESS INDUCED TONOPLAST INTRINSIC PROTEIN (WSI-TIP)
            (TURGOR-RESPONSIVE PROTEIN 7A) gi|485511|pir||S33617
            trg-31 protein - garden pea gi|20426|emb|CAA79159.1|
            trg-31 [Pisum sativum]
          Length = 289

 Score =  394 bits (1013), Expect(2) = e-124
 Identities = 199/235 (84%), Positives = 209/235 (88%), Gaps = 2/235 (0%)
 Frame = -3

Query: 1248 APLFEPSELTSWSFYRAGIAEFVATFLFLYITVLTVMGVSGADSKCKTVGIQGIAWAFGG 1069
            APLFEPSELTSWSFYRAGIAEF+ATFLFLYITVLTVMGV    SKCKTVGIQGIAWAFGG
Sbjct: 40   APLFEPSELTSWSFYRAGIAEFIATFLFLYITVLTVMGVVRESSKCKTVGIQGIAWAFGG 99

Query: 1068 MIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIVMQCLGAIVGAGVVKGFEGK 889
            MIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFY+VMQ LGAI GAGVVKGFEGK
Sbjct: 100  MIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYMVMQVLGAICGAGVVKGFEGK 159

Query: 888  TKYGTLGGGANFVAPGYTKGDGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPI 709
             ++G L GGANFVAPGYTKGDGLGAEIVGTF+LVYTVFSATDAKRSARDSHVPILAPLPI
Sbjct: 160  QRFGDLNGGANFVAPGYTKGDGLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPI 219

Query: 708  GFAVFLVHLATIPITRNWYQAL--LGVSVLPLSSTRHRGWDDHWIFWVGPFIGAA 550
            GFAVFLVHLATIPIT         LG +++     +  GW+DHWIFWVGPFIGAA
Sbjct: 220  GFAVFLVHLATIPITGTGINPARSLGAAIV---FNKKIGWNDHWIFWVGPFIGAA 271

 Score = 77.4 bits (189), Expect(2) = e-124
 Identities = 35/39 (89%), Positives = 38/39 (96%)
 Frame = -2

Query: 1366 MEAKEQDVSLGANKYPERQPIGIAAQSQDDGKDYQEPPP 1250
            MEAKEQDVSLGANK+PERQP+GIAAQSQD+ KDYQEPPP
Sbjct: 1    MEAKEQDVSLGANKFPERQPLGIAAQSQDEPKDYQEPPP 39

>emb|CAA38241.1| 289 aa peptide [Pisum sativum]
          Length = 289

 Score =  392 bits (1008), Expect(2) = e-124
 Identities = 198/235 (84%), Positives = 208/235 (88%), Gaps = 2/235 (0%)
 Frame = -3

Query: 1248 APLFEPSELTSWSFYRAGIAEFVATFLFLYITVLTVMGVSGADSKCKTVGIQGIAWAFGG 1069
            APLFEPSELTSWSFYRAGIAEF+ATFLFLYITVLTVMGV    SKCKTVGIQGIAWAFGG
Sbjct: 40   APLFEPSELTSWSFYRAGIAEFIATFLFLYITVLTVMGVVRESSKCKTVGIQGIAWAFGG 99

Query: 1068 MIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIVMQCLGAIVGAGVVKGFEGK 889
            MIFALVYCTAGISGGHINPAVTFGLFLARK SLTRAIFY+VMQ LGAI GAGVVKGFEGK
Sbjct: 100  MIFALVYCTAGISGGHINPAVTFGLFLARKXSLTRAIFYMVMQVLGAICGAGVVKGFEGK 159

Query: 888  TKYGTLGGGANFVAPGYTKGDGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPI 709
             ++G L GGANFVAPGYTKGDGLGAEIVGTF+LVYTVFSATDAKRSARDSHVPILAPLPI
Sbjct: 160  QRFGDLNGGANFVAPGYTKGDGLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPI 219

Query: 708  GFAVFLVHLATIPITRNWYQAL--LGVSVLPLSSTRHRGWDDHWIFWVGPFIGAA 550
            GFAVFLVHLATIPIT         LG +++     +  GW+DHWIFWVGPFIGAA
Sbjct: 220  GFAVFLVHLATIPITGTGINPARSLGAAIV---FNKKIGWNDHWIFWVGPFIGAA 271

 Score = 77.4 bits (189), Expect(2) = e-124
 Identities = 35/39 (89%), Positives = 38/39 (96%)
 Frame = -2

Query: 1366 MEAKEQDVSLGANKYPERQPIGIAAQSQDDGKDYQEPPP 1250
            MEAKEQDVSLGANK+PERQP+GIAAQSQD+ KDYQEPPP
Sbjct: 1    MEAKEQDVSLGANKFPERQPLGIAAQSQDEPKDYQEPPP 39

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,394,419,208
Number of Sequences: 1393205
Number of extensions: 65458278
Number of successful extensions: 445090
Number of sequences better than 10.0: 3792
Number of HSP's better than 10.0 without gapping: 206599
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 371237
length of database: 448,689,247
effective HSP length: 132
effective length of database: 264,786,187
effective search space used: 178465890038
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 SPD079c04_f BP050305 1 724
2 MFB008c06_f BP034470 91 851
3 MR100f10_f BP083672 91 644
4 MR091h08_f BP083042 93 572
5 MR034h05_f BP078658 94 669
6 MR097c07_f BP083420 98 725
7 GNf023d02 BP069031 101 662
8 MPD021h12_f AV771481 105 812
9 MR038g06_f BP078968 106 775
10 GNf015a10 BP068427 107 501
11 MFB039g07_f BP036881 109 641
12 SPD086d05_f BP050862 112 824
13 SPD023e04_f BP045820 114 820
14 MWM249b08_f AV768552 116 647
15 MR054c05_f BP080148 118 592
16 MR053c03_f BP080067 118 635
17 MR072g02_f BP081562 118 655
18 MPD029h04_f AV772012 119 813
19 GNf072a02 BP072663 120 762
20 MR035a03_f BP078668 121 484
21 MPD095h10_f AV776254 121 265
22 MR067h03_f BP081187 121 592
23 MR001a02_f BP075968 121 761
24 MR044g01_f BP079428 122 811
25 GNf086g11 BP073743 122 538
26 MPD062c10_f AV774130 122 719
27 MPD049g01_f AV773342 123 837
28 MPD003h05_f AV770221 123 826
29 MR084f02_f BP082480 123 732
30 MPD081b07_f AV775304 123 696
31 MR011c04_f BP076771 123 733
32 MR006g02_f BP076422 124 643
33 MR044h06_f BP079443 124 678
34 MR003f10_f BP076174 124 616
35 MR022b11_f BP077657 125 521
36 MR049h11_f BP079829 125 669
37 MR036b01_f BP078759 125 640
38 MR077b05_f BP081908 125 769
39 MF097a09_f BP033330 126 771
40 GNf053b07 BP071293 126 228
41 MR089a10_f BP082814 126 587
42 MR044c06_f BP079393 126 188
43 MR039h03_f BP079048 126 640
44 MR012b09_f BP076846 126 641
45 MR054f09_f BP080183 126 193
46 MF004b10_f BP028431 126 652
47 MR087f03_f BP082694 126 733
48 MR057d10_f BP080377 126 820
49 GNf081d10 BP073343 126 521
50 SPD062a04_f BP048902 126 853
51 MR096d11_f BP083360 127 610
52 MR025d04_f BP077908 127 759
53 MF090e08_f BP033027 127 734
54 MR095a07_f BP083269 127 617
55 MR025c12_f BP077904 127 664
56 MR041e09_f BP079176 127 730
57 MR033h03_f BP078577 127 672
58 MR029a01_f BP078201 127 656
59 MR003h08_f BP076195 127 735
60 MR099a06_f BP083551 127 633
61 MR041f12_f BP079188 127 642
62 MR035d06_f BP078701 127 653
63 MR022e06_f BP077682 127 461
64 MR023c05_f BP077738 127 653
65 MR054g11_f BP080194 127 630
66 MR010d11_f BP076709 127 636
67 MR036d06_f BP078783 127 639
68 MR002d09_f BP076075 127 350
69 MR066a06_f BP081042 127 755
70 MR044e06_f BP079413 127 643
71 MF001g01_f BP028286 127 763
72 MR099c12_f BP083575 127 754
73 MF057e08_f BP031303 127 680
74 MR014f08_f BP077049 127 791
75 MR093f02_f BP083164 127 646
76 MR078b09_f BP081989 127 625
77 MR006c12_f BP076388 127 652
78 MR054a06_f BP080126 127 637
79 GNf051g08 BP071180 127 668
80 MR030e02_f BP078309 127 657
81 MR014g12_f BP077064 127 658
82 MR088e10_f BP082771 127 666
83 MR007d08_f BP076477 127 663
84 MR041d04_f BP079162 127 592
85 MR026a12_f BP077967 127 668
86 MR036f12_f BP078806 127 669
87 MR020e07_f BP077526 127 632
88 MR033c09_f BP078533 127 668
89 MR013g01_f BP076974 127 671
90 MR017a05_f BP077235 127 675
91 MR015e08_f BP077115 127 595
92 MR030d10_f BP078306 127 572
93 MR085h09_f BP082575 127 249
94 SPD013h09_f BP045072 127 647
95 GNf054d04 BP071388 127 668
96 MR060e08_f BP080610 127 641
97 GNf027f09 BP069330 127 698
98 MF019a09_f BP029232 127 573
99 MR005a11_f BP076284 127 622
100 MR088d01_f BP082755 127 533
101 MF097b11_f BP033340 127 837
102 MR094h03_f BP083256 127 636
103 MR092f02_f BP083093 127 640
104 MR036e06_f BP078793 127 540
105 MR022f09_f BP077695 127 669
106 MR053g07_f BP080109 127 632
107 MR001d11_f BP076003 127 669
108 MR033g11_f BP078573 127 689
109 SPD088c09_f BP051020 127 845
110 MR037e01_f BP078864 127 558
111 GENf018d02 BP059124 127 785
112 GNf062g04 BP072001 127 656
113 MF050c02_f BP030916 127 744
114 MF019g06_f BP029277 127 507
115 MWM111b02_f AV766494 127 824
116 MR060b11_f BP080582 127 763
117 MF074c04_f BP032219 127 829
118 SPD066g09_f BP049299 127 855
119 GNf032d01 BP069688 127 705
120 MF053f05_f BP031094 127 726
121 MF025e05_f BP029585 127 828
122 GNf072e06 BP072706 127 668
123 MR066d08_f BP081072 127 764
124 MR044a11_f BP079378 127 735
125 MR056e04_f BP080311 127 764
126 MR046d02_f BP079550 127 760
127 MR007b12_f BP076461 127 767
128 MR070f11_f BP081400 127 732
129 MR048a04_f BP079681 127 755
130 MR021f02_f BP077610 127 770
131 MR095f03_f BP083309 127 772
132 GNf040c03 BP070292 127 770
133 MR049a08_f BP079759 127 773
134 MR073e01_f BP081615 127 775
135 MR021d12_f BP077600 127 753
136 MR050f09_f BP079889 127 784
137 MR073f01_f BP081624 127 787
138 MR071f12_f BP081481 127 731
139 MR051b12_f BP079929 127 770
140 MF058b01_f BP031334 127 732
141 MR054d03_f BP080158 127 797
142 MR079h06_f BP082116 127 732
143 GNf048c07 BP070902 127 755
144 MR015e06_f BP077113 127 742
145 MR012h05_f BP076906 127 771
146 MR071b10_f BP081438 127 739
147 GNf036h08 BP070024 127 677
148 MR076c04_f BP081833 127 804
149 MR004c04_f BP076221 127 675
150 MF015g02_f BP029052 127 810
151 MR022h02_f BP077709 127 725
152 MR096f07_f BP083374 127 808
153 MR052g05_f BP080034 127 598
154 MR064c03_f BP080896 127 674
155 MR100b03_f BP083629 127 607
156 MR007a07_f BP076447 127 652
157 MR066a03_f BP081040 127 649
158 MR099a05_f BP083550 127 647
159 MR036f03_f BP078800 127 721
160 SPD100c06_f BP051969 127 832
161 MR032h10_f BP078502 127 646
162 MR008b12_f BP076539 127 643
163 GNf089a07 BP073908 127 823
164 MR013a03_f BP076914 127 645
165 GNf038c09 BP070134 127 712
166 MR012d06_f BP076865 127 802
167 MR053b09_f BP080061 127 653
168 MR060d10_f BP080602 127 589
169 MR002e06_f BP076082 127 710
170 MR057f10_f BP080398 127 825
171 MR012d07_f BP076866 127 607
172 MFB051f04_f BP037712 127 850
173 MR034d07_f BP078622 127 630
174 MR028c04_f BP078144 127 490
175 MR050e04_f BP079876 127 625
176 GNf030g10 BP069572 127 543
177 MR024h07_f BP077870 127 659
178 MR040f03_f BP079102 127 661
179 MR063a12_f BP080804 127 662
180 MR085c09_f BP082532 127 642
181 MR014d10_f BP077030 127 626
182 MR067g10_f BP081185 127 663
183 MR022e12_f BP077687 127 661
184 MR031f10_f BP078406 127 505
185 MR046h04_f BP079593 127 506
186 MR031b01_f BP078358 127 655
187 MR017g04_f BP077299 127 641
188 GNf090h01 BP074039 127 695
189 MR078d06_f BP082004 127 770
190 MFB079g03_f BP039797 127 888
191 MR058g01_f BP080477 127 643
192 MR052c12_f BP080007 127 690
193 MR055h11_f BP080273 127 648
194 MFB052h02_f BP037799 127 845
195 MR045e11_f BP079490 127 518
196 MR012d12_f BP076868 127 656
197 MR020h02_f BP077553 127 685
198 MR081g10_f BP082260 127 521
199 MR002a05_f BP076046 127 624
200 MR094c08_f BP083215 127 635
201 MR013d11_f BP076952 127 659
202 MR038a11_f BP078915 127 609
203 MR025f12_f BP077933 127 563
204 MR089c07_f BP082830 127 769
205 MR023e03_f BP077755 127 570
206 MR064g02_f BP080936 127 718
207 MR091e12_f BP083013 127 610
208 MR018c03_f BP077340 127 673
209 MR010c02_f BP076692 127 588
210 MR040c05_f BP079081 127 635
211 MWM214d10_f AV768023 127 621
212 MR011d09_f BP076785 127 658
213 MR054a12_f BP080132 127 679
214 SPD012b12_f BP044933 128 823
215 MR046h12_f BP079599 128 719
216 MF064d06_f BP031699 128 723
217 MF060g08_f BP031483 128 243
218 MR016e09_f BP077195 128 706
219 MR098a10_f BP083476 128 734
220 SPD018h08_f BP045452 128 656
221 GENf021c06 BP059249 128 617
222 MF064a09_f BP031680 128 647
223 MFB008e12_f BP034492 128 655
224 MFB098g07_f BP041156 128 831
225 MR015f04_f BP077122 128 523
226 MF008d03_f BP028636 128 720
227 MR055e11_f BP080249 128 642
228 MR047f08_f BP079659 128 642
229 MR072a10_f BP081509 128 664
230 MR007f10_f BP076499 128 555
231 MR068h10_f BP081260 128 798
232 MR085a12_f BP082514 128 639
233 MR050h11_f BP079911 128 592
234 GENf014f05 BP058944 128 785
235 MR045a12_f BP079458 128 607
236 MR055e05_f BP080243 128 822
237 MR017h07_f BP077313 128 762
238 MR034f11_f BP078647 128 335
239 MR006e10_f BP076408 128 518
240 MR085h06_f BP082572 128 592
241 MF030b03_f BP029834 128 770
242 MR094h11_f BP083263 128 630
243 MR027g02_f BP078103 128 666
244 MFB094b10_f BP040836 128 774
245 MF096a03_f BP033283 128 726
246 MR066g02_f BP081097 128 692
247 MR059h07_f BP080558 128 699
248 GNf033f07 BP069789 128 794
249 MR031g01_f BP078409 128 664
250 MPD037b02_f AV772507 128 763
251 MF088g03_f BP032939 128 592
252 MR070c10_f BP081376 128 752
253 MFB060g07_f BP038381 128 702
254 MR058f10_f BP080474 128 734
255 MF017g04_f BP029162 128 730
256 MR085f03_f BP082557 128 820
257 MR042c03_f BP079236 128 659
258 SPD062e04_f BP048946 128 759
259 MR061a09_f BP080648 128 636
260 MR012h02_f BP076903 128 627
261 MF036b04_f BP030188 128 743
262 MR048e03_f BP079716 128 742
263 MR028e08_f BP078168 128 730
264 GNf049c02 BP070976 128 644
265 MR003h09_f BP076196 128 487
266 SPD017g12_f BP045372 128 521
267 GNf046b03 BP070736 128 667
268 MF053c02_f BP031075 128 823
269 MF014h11_f BP029007 128 720
270 MR027h04_f BP078112 128 641
271 MR098d06_f BP083503 129 485
272 MF039h04_f BP030357 129 699
273 MR050b06_f BP079846 129 651
274 MF063f02_f BP031650 129 839
275 MR088e01_f BP082764 129 607
276 MR068b10_f BP081208 129 742
277 MF078g10_f BP032445 129 671
278 MR087b01_f BP082666 129 620
279 SPD068e12_f BP049445 129 811
280 MF100g06_f BP033510 129 810
281 MF081a04_f BP032543 129 771
282 MF020b03_f BP029295 129 794
283 MF027h08_f BP029713 129 669
284 MR070d03_f BP081379 129 656
285 MR071b06_f BP081434 129 211
286 MR019f10_f BP077454 129 735
287 MF085b11_f BP032762 129 733
288 MR076g05_f BP081876 129 803
289 MR083h02_f BP082420 129 641
290 GNf051d07 BP071148 129 637
291 MF068d05_f BP031919 129 811
292 MR024b12_f BP077819 129 695
293 MR071a09_f BP081428 129 643
294 MF068b08_f BP031906 129 769
295 MR094b09_f BP083207 129 645
296 MF032c05_f BP029962 130 413
297 MR090c03_f BP082907 130 610
298 MR019c12_f BP077424 130 609
299 MR065e02_f BP081000 130 651
300 MR041g01_f BP079189 130 656
301 MR090h06_f BP082958 130 593
302 MR079d06_f BP082077 130 702
303 SPD025e06_f BP045981 130 732
304 MR025f06_f BP077929 130 690
305 MR023e04_f BP077756 130 619
306 MF010h06_f BP028777 130 770
307 MR009f05_f BP076641 130 667
308 MR089h03_f BP082875 130 630
309 MR093a08_f BP083126 130 632
310 MR070a08_f BP081354 130 649
311 MR062e10_f BP080760 130 636
312 MR067c11_f BP081144 130 673
313 MFB048e12_f BP037494 130 675
314 MR016b09_f BP077166 130 706
315 MR074h05_f BP081723 130 630
316 MR042c08_f BP079239 130 610
317 MR082a10_f BP082281 130 395
318 MR066d04_f BP081068 130 361
319 GENf078g06 BP061711 130 571
320 SPD032f10_f BP046563 130 259
321 MR093e08_f BP083160 130 643
322 MR046h05_f BP079594 130 655
323 MR012c02_f BP076850 130 571
324 MR059h11_f BP080561 130 731
325 MR092g02_f BP083103 130 592
326 MR087h08_f BP082719 130 636
327 MR048f01_f BP079725 130 517
328 MR097f11_f BP083452 130 646
329 MR039a10_f BP078991 130 651
330 MR027h12_f BP078120 130 668
331 MR036c11_f BP078776 130 657
332 MR042e01_f BP079253 130 662
333 MR066g11_f BP081105 130 610
334 MR037g02_f BP078885 130 685
335 MR037f10_f BP078881 130 672
336 MR066f04_f BP081089 130 678
337 MR016a09_f BP077156 130 723
338 MR094d02_f BP083220 130 720
339 MR078f01_f BP082018 130 607
340 MR009d10_f BP076626 130 675
341 MR054b07_f BP080138 130 647
342 MF019h05_f BP029283 130 370
343 MR032b03_f BP078438 130 405
344 MR066f02_f BP081087 130 513
345 MR037g12_f BP078894 130 607
346 MR002e03_f BP076080 130 709
347 MR005f09_f BP076334 130 588
348 MF027b11_f BP029677 130 461
349 MF047c06_f BP030763 130 573
350 MR026a01_f BP077957 130 487
351 MR020f09_f BP077539 130 686
352 GNf053c02 BP071299 130 687
353 MR087c04_f BP082674 130 532
354 MF091g06_f BP033087 130 690
355 MR096f09_f BP083376 130 640
356 MR062d04_f BP080746 130 822
357 SPD033d11_f BP046622 130 647
358 MR028g09_f BP078187 130 771
359 MF033g10_f BP030052 130 818
360 MPD012f12_f AV770832 130 829
361 MR042d09_f BP079250 130 767
362 MF041e03_f BP030445 130 791
363 SPD039h04_f BP047137 130 820
364 SPD009h06_f BP044749 130 846
365 MFB069e03_f BP039017 130 834
366 GNf055e02 BP071472 130 832
367 MR075d03_f BP081765 130 751
368 SPD056b07_f BP048439 130 807
369 MF076h08_f BP032348 130 769
370 MR064h06_f BP080948 130 810
371 MF075d06_f BP032275 130 778
372 SPD056e02_f BP048463 130 845
373 MFB076h09_f BP039587 130 854
374 MR003d05_f BP076152 130 699
375 SPD080g05_f BP050410 130 739
376 MF061e06_f BP031532 130 737
377 MFB055g09_f BP038012 130 804
378 MR044f06_f BP079422 130 684
379 SPD032b11_f BP046522 130 811
380 GNf037b11 BP070043 130 708
381 MF020e02_f BP029322 130 818
382 MF001e05_f BP028275 130 813
383 MFB021a06_f BP035467 130 853
384 MR081f03_f BP082246 130 649
385 MFB030h05_f BP036227 130 864
386 MR071e02_f BP081462 130 651
387 MF016f10_f BP029104 130 655
388 MFB064c07_f BP038628 130 732
389 MFB090f08_f BP040591 130 846
390 MF002b09_f BP028317 130 754
391 MR075c01_f BP081752 130 655
392 MR074f06_f BP081705 130 649
393 SPD039d08_f BP047102 130 838
394 MFB017c08_f BP035167 130 836
395 MR065b11_f BP080976 130 656
396 MR031a04_f BP078350 130 648
397 MFB010h10_f BP034674 130 832
398 MFB070h10_f BP039129 130 873
399 MR011f05_f BP076805 130 813
400 MF034b06_f BP030073 130 764
401 MR076g12_f BP081881 130 632
402 MFB041b08_f BP036963 130 734
403 MFB015e04_f BP035029 130 810
404 MR024e04_f BP077841 130 813
405 MFB044h04_f BP037251 130 732
406 MR091c08_f BP082993 130 730
407 MR098d11_f BP083508 130 800
408 MR063d06_f BP080830 130 730
409 MR050d07_f BP079868 130 726
410 MR037g01_f BP078884 130 657
411 MF065g09_f BP031778 130 722
412 MR096e08_f BP083366 130 785
413 MR096h06_f BP083392 130 778
414 MF009g12_f BP028716 130 728
415 MR046h02_f BP079592 130 723
416 GNf041g01 BP070411 130 774
417 MR002d01_f BP076070 130 775
418 MR006c07_f BP076383 130 678
419 MF057h12_f BP031328 130 689
420 MR036a07_f BP078754 130 658
421 MR060a08_f BP080570 130 663
422 MR074d11_f BP081688 130 644
423 MR088e04_f BP082767 130 642
424 MR015h04_f BP077144 130 643
425 MR020f11_f BP077541 130 642
426 MFB018h11_f BP035302 130 594
427 MR025d03_f BP077907 130 718
428 MFB093h06_f BP040813 130 771
429 MR003f06_f BP076170 130 770
430 MR090b12_f BP082904 130 640
431 MR066c09_f BP081063 130 640
432 MR090d01_f BP082915 130 639
433 MR084h10_f BP082503 130 659
434 MR005d10_f BP076314 130 768
435 MR067c04_f BP081137 130 636
436 GNf033f12 BP069793 130 708
437 MR012d04_f BP076863 130 767
438 MR089f06_f BP082857 130 763
439 MF010g03_f BP028768 130 628
440 MR045f07_f BP079497 130 641
441 MFB025d02_f BP035800 130 759
442 MR098g06_f BP083530 130 639
443 MR016f01_f BP077199 130 666
444 MR035g05_f BP078731 130 661
445 MR090g04_f BP082949 130 634
446 SPD059d01_f BP048687 130 709
447 MR099h02_f BP083614 130 630
448 MR057f08_f BP080396 130 754
449 MFB099d11_f BP041194 130 489
450 MR023g11_f BP077786 130 637
451 MR085h02_f BP082568 130 735
452 MR075e12_f BP081783 130 508
453 MR064e09_f BP080920 130 625
454 MR022f12_f BP077698 130 662
455 MR003a08_f BP076124 130 700
456 MR026d09_f BP077995 130 667
457 MR035e02_f BP078707 130 511
458 MR098h12_f BP083545 130 627
459 MR099e08_f BP083591 131 622
460 MR067d12_f BP081154 131 639
461 MR074g10_f BP081718 131 652
462 MR038g10_f BP078971 131 305
463 MR100c06_f BP083638 131 653
464 MR088e07_f BP082769 131 811
465 MR099b03_f BP083558 131 625
466 MR079f12_f BP082101 131 642
467 MR064h11_f BP080952 131 661
468 MR072f03_f BP081553 131 652
469 MR027e01_f BP078081 131 672
470 MR085f11_f BP082561 131 640
471 MR032d08_f BP078463 131 674
472 MR046c04_f BP079541 131 800
473 MR082g06_f BP082335 131 636
474 MR077a01_f BP081893 131 657
475 MR099b09_f BP083562 131 639
476 MR071a07_f BP081426 131 641
477 MR098g04_f BP083528 131 644
478 MR059b01_f BP080501 131 649
479 MR076g01_f BP081872 131 647
480 MF078f02_f BP032431 131 814
481 SPD090d10_f BP051197 131 841
482 SPD006a03_f BP044437 131 831
483 MR080a09_f BP082127 131 763
484 MR082h08_f BP082348 131 627
485 MR042f10_f BP079270 131 510
486 MR060b01_f BP080574 131 759
487 MR078h04_f BP082036 131 766
488 MR022d06_f BP077672 131 636
489 MR016h06_f BP077225 131 695
490 MR072b11_f BP081521 131 769
491 SPD097c03_f BP051732 131 894
492 GNf073a09 BP072744 131 652
493 MR021g11_f BP077625 131 661
494 MR025c07_f BP077900 131 646
495 MR017b08_f BP077248 131 775
496 MR086e01_f BP082617 131 647
497 MR026b04_f BP077971 131 730
498 MFB075b08_f BP039441 131 818
499 MR083f06_f BP082403 131 627
500 MR025b03_f BP077886 132 750
501 MR050b02_f BP079842 132 649
502 MFB016c04_f BP035091 132 867
503 MR044e04_f BP079411 132 658
504 MR058a05_f BP080424 132 647
505 MR077f04_f BP081947 132 759
506 MR075b02_f BP081742 132 759
507 MR044b11_f BP079388 132 761
508 MPD075e07_f AV774931 132 775
509 SPD005d12_f BP044397 132 829
510 MFB051h01_f BP037729 133 502
511 MR049g11_f BP079818 133 528
512 MR075e09_f BP081781 133 651
513 MF002a06_f BP028305 133 643
514 MR050c08_f BP079860 133 762
515 MR034e04_f BP078630 133 775
516 MR088a05_f BP082726 133 714
517 MF053b02_f BP031068 134 810
518 MR086f03_f BP082629 134 733
519 MR012h04_f BP076905 134 733
520 MR072c04_f BP081526 134 643
521 MR061d01_f BP080670 134 756
522 MR093b11_f BP083138 134 755
523 MF083b08_f BP032667 134 814
524 MR058d12_f BP080457 135 814
525 MR099c04_f BP083569 135 648
526 MR073h01_f BP081643 135 771
527 MF021g11_f BP029393 135 797
528 MR075f02_f BP081785 135 739
529 MR097e08_f BP083442 135 732
530 SPD061c03_f BP048836 138 807
531 MR045a02_f BP079449 139 503
532 MR024b11_f BP077818 139 674
533 MR021g06_f BP077620 139 655
534 MF092a04_f BP033098 140 773
535 MFB073c07_f BP039302 140 810
536 MF054d04_f BP031140 140 734
537 MF006g08_f BP028564 140 732
538 MFB033c02_f BP036404 140 769
539 GNf028h01 BP069418 143 689
540 MR059d01_f BP080518 143 626
541 SPD086b04_f BP050841 143 774
542 MR061c11_f BP080668 143 659
543 MR023f04_f BP077768 143 513
544 SPD018f05_f BP045430 144 646
545 MR060b07_f BP080578 144 664
546 MR032f10_f BP078483 144 672
547 MR089a03_f BP082807 144 653
548 MR062c04_f BP080735 144 770
549 MR062f08_f BP080770 145 662
550 MPD094e10_f AV776168 145 733
551 MR066c01_f BP081056 145 635
552 MF044h03_f BP030632 146 818
553 MF017c07_f BP029139 146 689
554 MWM088h02_f AV766182 148 625
555 MR051e10_f BP079952 148 709
556 MF002c04_f BP028322 151 810
557 MFB018h02_f BP035293 152 775
558 SPD049b05_f BP047883 153 770
559 MF093a09_f BP033145 153 819
560 MWM121g05_f AV766679 155 628
561 SPDL087g01_f BP057480 157 810
562 MR036h01_f BP078817 160 470
563 MR011c11_f BP076777 160 686
564 SPD057h08_f BP048573 164 852
565 SPD079g12_f BP050349 166 791
566 GNf063g09 BP072073 166 831
567 MF049b08_f BP030859 167 688
568 SPD097h10_f BP051788 167 826
569 MR081a02_f BP082195 168 653
570 MF091f04_f BP033082 168 825
571 MF100g03_f BP033507 169 718
572 MF044c12_f BP030610 169 745
573 SPD035h09_f BP046824 169 807
574 SPD010f01_f BP044807 173 567
575 GNf001h06 BP067477 248 478
576 SPD013f05_f BP045047 281 642
577 MPD041g09_f AV772820 292 956
578 MPD031c09_f AV772119 293 927
579 SPD034g09_f BP046736 296 949
580 MR078e09_f BP082014 300 800
581 MPD078c08_f AV775111 300 942
582 SPD077g01_f BP050182 303 949
583 MPD030f11_f AV772070 303 924
584 MPD092c01_f AV776027 309 874
585 MR067f09_f BP081174 310 795
586 MR022b02_f BP077649 314 783
587 MPD045g06_f AV773080 317 815
588 MPD054b02_f AV773606 317 882
589 GNf094f03 BP074344 317 490
590 MPD041d02_f AV772793 320 959
591 MR046c03_f BP079540 320 864
592 GNf068b11 BP072397 321 722
593 GNf029d04 BP069461 321 923
594 GNf085e08 BP073644 324 568
595 MPD052h04_f AV773532 324 896
596 MPD069h05_f AV774598 324 904
597 MR029g04_f BP078263 324 807
598 MFB052g04_f BP037790 324 937
599 SPD059d05_f BP048688 324 966
600 MF099h10_f BP033476 324 885
601 GNf042g04 BP070483 324 878
602 MR019d09_f BP077433 324 772
603 MR048d01_f BP079707 324 774
604 SPD046e04_f BP047670 324 846
605 MF006a03_f BP028521 324 891
606 MR008f09_f BP076571 324 846
607 MR055d08_f BP080236 324 823
608 SPD012f06_f BP044972 324 689
609 GNf057b06 BP071595 324 830
610 GNf059d12 BP071756 324 841
611 GNf068f06 BP072424 324 828
612 MR042b01_f BP079223 324 837
613 GNf027d10 BP069315 324 853
614 MR041e10_f BP079177 324 775
615 MR057h10_f BP080418 324 957
616 MR064b03_f BP080888 324 456
617 MR041d01_f BP079161 324 808
618 MR028b11_f BP078139 324 811
619 MR011e11_f BP076799 324 810
620 MWM081e11_f AV766051 324 987
621 GNf096c11 BP074474 324 813
622 GNf057f03 BP071626 324 888
623 MFB094e04_f BP040854 324 1001
624 GNf049d11 BP070994 324 958
625 MFB082d12_f BP040002 324 957
626 MWM127g10_f AV766769 324 998
627 SPD083b12_f BP050607 324 957
628 MF083d06_f BP032679 324 949
629 MR024f03_f BP077851 324 929
630 MF043f04_f BP030569 324 933
631 MFB056e12_f BP038068 324 927
632 MR035b01_f BP078677 324 897
633 GNf057e05 BP071619 324 964
634 SPD048f08_f BP047845 324 901
635 MR020f03_f BP077533 324 814
636 MR069f08_f BP081322 324 893
637 MF071h07_f BP032093 324 896
638 MF006c04_f BP028536 324 889
639 MR004f09_f BP076255 324 889
640 MR071c12_f BP081452 324 894
641 MPD011b06_f AV770712 324 947
642 MPD029g03_f AV772002 324 949
643 MPD074c01_f AV774839 324 956
644 MR029d06_f BP078236 324 836
645 MPD070b04_f AV774611 324 902
646 MF030e04_f BP029858 324 870
647 GNf035e06 BP069915 324 827
648 SPD047a09_f BP047712 324 750
649 GNf097d09 BP074555 324 807
650 MF007h08_f BP028614 324 834
651 MR092d05_f BP083077 324 809
652 MR022d09_f BP077674 324 799
653 MR060f04_f BP080617 324 804
654 SPD045b04_f BP047566 324 929
655 MR030g01_f BP078328 324 809
656 MR095d12_f BP083295 324 798
657 MFB091a06_f BP040616 324 478
658 SPD091f05_f BP051283 324 516
659 MR079h03_f BP082114 324 802
660 MF032b09_f BP029956 324 592
661 MF024a05_f BP029510 324 606
662 MR069b11_f BP081282 324 823
663 SPD009h12_f BP044753 324 842
664 GNf099h01 BP074733 324 772
665 MR005b02_f BP076286 324 685
666 MR007g09_f BP076507 324 804
667 GNf082c10 BP073406 324 787
668 MR055g07_f BP080260 324 800
669 MR065g10_f BP081026 324 793
670 MF024f05_f BP029543 324 786
671 MR047e06_f BP079646 324 946
672 MR017d09_f BP077272 324 908
673 GNf060f01 BP071839 324 848
674 SPD090b11_f BP051178 324 934
675 GNf091f07 BP074104 324 908
676 MR020e11_f BP077529 324 920
677 GNf098b02 BP074606 324 919
678 MR021c07_f BP077587 324 823
679 MR027e05_f BP078085 324 916
680 MF054d10_f BP031143 324 931
681 MF074f09_f BP032242 324 910
682 MR065a05_f BP080958 324 912
683 MF039d01_f BP030334 324 914
684 MF085b06_f BP032761 324 747
685 MFB098c06_f BP041123 324 745
686 MPD054g01_f AV773643 327 572
687 MPD052d03_f AV773508 327 824
688 GNf052a08 BP071201 327 838
689 MPD076h04_f AV775019 327 962
690 GNf061a10 BP071876 327 837
691 MPD034d08_f AV772329 327 522
692 MPD021c03_f AV771436 327 481
693 MR026g02_f BP078017 327 770
694 MPD056c11_f AV773746 327 903
695 MR036a12_f BP078758 327 634
696 MPD066a12_f AV774377 327 901
697 MPD062h03_f AV774170 327 906
698 GNf051e06 BP071158 327 814
699 MFB009e01_f BP034559 328 955
700 MPD044c09_f AV772981 328 957
701 MPD052d04_f AV773509 328 823
702 MFB044b09_f BP037201 329 645
703 MR062h08_f BP080788 329 808
704 MR079c11_f BP082071 329 789
705 SPD089g12_f BP051147 329 999
706 MPD005h06_f AV770359 329 925
707 MFB087b08_f BP040339 329 908
708 SPD089f12_f BP051135 329 926
709 MR070h08_f BP081417 329 815
710 MR087a09_f BP082664 329 793
711 MPD095e05_f AV776224 329 859
712 MR082d03_f BP082304 329 796
713 MR068c02_f BP081212 329 798
714 SPD035b04_f BP046762 332 892
715 MR090g06_f BP082951 332 781
716 SPD021a09_f BP045622 332 994
717 MFB097g09_f BP041091 332 893
718 MFB094e01_f BP040851 332 895
719 MPD082h01_f AV775411 332 903
720 MF100e02_f BP033496 332 909
721 MR065h07_f BP081034 332 769
722 GNf036f11 BP070008 332 626
723 MR026g04_f BP078019 332 754
724 MR100h01_f BP083686 332 905
725 SPD057e01_f BP048537 332 955
726 MFB085f03_f BP040224 332 814
727 MFB009d02_f BP034550 332 1024
728 MR099h01_f BP083613 332 781
729 MFB007c09_f BP034404 332 898
730 MR053f04_f BP080096 333 800
731 MPD073b09_f AV774773 333 787
732 MFB019b11_f BP035321 333 879
733 MR064a12_f BP080885 333 819
734 MR013f07_f BP076970 333 945
735 GNf050d10 BP071070 333 884
736 SPD054f08_f BP048326 333 957
737 MR066b04_f BP081050 335 887
738 MF091g02_f BP033085 335 722
739 MR057c02_f BP080363 335 812
740 MPD032b08_f AV772170 335 586
741 MR056f03_f BP080321 336 915
742 MR098h05_f BP083539 337 798
743 SPD042g09_f BP047376 337 839
744 SPD082g10_f BP050575 340 946
745 MR063g03_f BP080859 340 898
746 SPD002b02_f BP044130 340 966
747 SPD072d10_f BP049754 340 920
748 MFB078d05_f BP039695 340 943
749 MF028h12_f BP029768 340 720
750 SPD050f06_f BP048005 340 928
751 MR029c05_f BP078225 340 564
752 MFB093d01_f BP040778 344 961
753 MR068g01_f BP081246 344 813
754 SPD034d11_f BP046703 344 904
755 MPD040f07_f AV772751 344 949
756 SPD097e09_f BP051760 346 956
757 MR099d12_f BP083587 346 908
758 MPD077d11_f AV775060 350 929
759 MPDL053b09_f AV779174 370 963
760 SPD038a03_f BP046983 388 949
761 MF073e09_f BP032178 403 901
762 GENf016d02 BP059034 926 1507
763 MFB039e03_f BP036860 983 1565
764 MFB041e06_f BP036992 997 1579
765 MFB027f04_f BP035978 1007 1584
766 MWM246e06_f AV768504 1031 1566
767 MF079f11_f BP032489 1039 1561
768 GNf041f02 BP070402 1041 1583
769 GNf036a08 BP069954 1056 1562
770 MR097b07_f BP083410 1066 1550
771 GNf047c07 BP070827 1067 1587
772 MR095g05_f BP083315 1068 1564
773 SPD028h05_f BP046254 1083 1513
774 MRL042g05_f BP085782 1085 1599
775 MPD053d08_f AV773565 1088 1591
776 MFB049a11_f BP037527 1109 1558
777 MPD013f06_f AV770903 1139 1556
778 MR066c12_f BP081066 1180 1578
779 MF036c06_f BP030196 1352 1575
780 MPD093f10_f AV776120 1358 1562
781 MFB019a10_f BP035310 1502 2080
782 SPD066c01_f BP049252 1599 2109
783 SPD068c08_f BP049418 2002 2561
784 SPDL096h06_f BP058063 2008 2561
785 MFB029g01_f BP036136 2024 2561
786 MFB099h11_f BP041229 2026 2569
787 SPD093d12_f BP051425 2056 2557
788 SPD016a04_f BP045224 2065 2498
789 MFB089h06_f BP040536 2065 2550
790 MFB060g02_f BP038377 2067 2568
791 SPD078c12_f BP050228 2072 2568
792 MFB004a01_f BP034150 2081 2542
793 MFB051a02_f BP037664 2092 2557
794 MFB072e11_f BP039250 2147 2561
795 MWM073a01_f AV765872 2436 2562




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research