KMC000024A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000024A_C01 KMC000024A_c01
atttcccaagacaaaacgattcccgttggtttgattcatttatataccaacACAAATCTA
CAATCAATTAAATAAAAATGGCTGGCCAGAGCAGGGGCCAAATCCATACTGTTTGATGTC
TTGGGGCAATCTCAGATATTATACAACAGATATTTAGAACATATAAATAATTAAATGCAA
TATACAAGAAATAAACTTTGAAACACATGTAGCTGTGTTTGGATATCAGTTGACAAGTGC
AAACTAGACTTTACCATGCACTTTAAGACAAACATAACTAATATGATTTGAGATAAGAGT
TTATTCGTGTTGCAACAACTGGTATCCAAACACACATATTCATTGTTGCGGCGCACCACC
ATCTTTGCCACTACTGTCTGGGAGATTTTTAATTGCCTCATAGAGATACCAAGAAGCAAA
AGCATCAGTGGCAGCATACTGTAGTTGCTCCTTTGACAAAACAGGAGTTTCCCAATTTCC
CAGTCTAATTTTGTTGGGCTTTTTAAGCTGCAAAATATAAAAAGCTTTCTGAACATAGTT
CTTCACCTTTTCCAAGAAAACAGTTTGTAAGGAACATACATCCTTCAATTTGATCAAAGG
CAAGAG


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000024A_C01 KMC000024A_c01
         (606 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_680682.1| similar to exonuclease; protein id: At4g13885.1...    75  9e-13
gb|AAO33765.1| Werner Syndrome-like exonuclease [Arabidopsis tha...    74  2e-12
emb|CAC14871.1| exonuclease [Arabidopsis thaliana]                     67  2e-10
ref|NP_193123.1| putative protein; protein id: At4g13870.1 [Arab...    64  2e-09
ref|XP_193066.1| Werner syndrome protein [Mus musculus] gi|75138...    45  6e-04

>ref|NP_680682.1| similar to exonuclease; protein id: At4g13885.1 [Arabidopsis
           thaliana]
          Length = 263

 Score = 74.7 bits (182), Expect = 9e-13
 Identities = 33/52 (63%), Positives = 43/52 (82%)
 Frame = -1

Query: 528 KAFYILQLKKPNKIRLGNWETPVLSKEQLQYAATDAFASWYLYEAIKNLPDS 373
           K F+   L KPN+IRLGNWE   LSK+QLQYAATDA+ASW+L++ +K+LPD+
Sbjct: 208 KLFHDYGLLKPNRIRLGNWEVHPLSKQQLQYAATDAYASWHLHQVLKDLPDA 259

>gb|AAO33765.1| Werner Syndrome-like exonuclease [Arabidopsis thaliana]
          Length = 288

 Score = 73.6 bits (179), Expect = 2e-12
 Identities = 32/46 (69%), Positives = 41/46 (88%)
 Frame = -1

Query: 510 QLKKPNKIRLGNWETPVLSKEQLQYAATDAFASWYLYEAIKNLPDS 373
           +L KPN+IRLGNWE   LSK+QLQYAATDA+ASW+LY+ +K+LPD+
Sbjct: 239 ELLKPNRIRLGNWEFYPLSKQQLQYAATDAYASWHLYKVLKDLPDA 284

>emb|CAC14871.1| exonuclease [Arabidopsis thaliana]
          Length = 285

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 32/46 (69%), Positives = 39/46 (84%)
 Frame = -1

Query: 510 QLKKPNKIRLGNWETPVLSKEQLQYAATDAFASWYLYEAIKNLPDS 373
           +L KPN+IRLGNWE   LSK+QLQYAATDA+ASW+LY   K+LPD+
Sbjct: 239 ELLKPNRIRLGNWEFYPLSKQQLQYAATDAYASWHLY---KDLPDA 281

>ref|NP_193123.1| putative protein; protein id: At4g13870.1 [Arabidopsis thaliana]
           gi|7485693|pir||T05256 hypothetical protein F18A5.260 -
           Arabidopsis thaliana gi|4455316|emb|CAB36851.1| putative
           protein [Arabidopsis thaliana]
           gi|7268091|emb|CAB78429.1| putative protein [Arabidopsis
           thaliana]
          Length = 313

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 28/38 (73%), Positives = 34/38 (88%)
 Frame = -1

Query: 510 QLKKPNKIRLGNWETPVLSKEQLQYAATDAFASWYLYE 397
           +L KPN+IRLGNWE   LSK+QLQYAATDA+ASW+LY+
Sbjct: 239 ELLKPNRIRLGNWEFYPLSKQQLQYAATDAYASWHLYK 276

>ref|XP_193066.1| Werner syndrome protein [Mus musculus] gi|7513876|pir||T17452
           Werner syndrome protein - mouse
           gi|3885838|gb|AAC78077.1| Wrn protein [Mus musculus]
          Length = 1401

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 29/82 (35%), Positives = 42/82 (50%), Gaps = 7/82 (8%)
 Frame = -1

Query: 594 IKLKDVCSLQTVFLEKVK-------NYVQKAFYILQLKKPNKIRLGNWETPVLSKEQLQY 436
           +KL+    L  V  EK+K       N + K     QL K   IR  NW    L+++Q  Y
Sbjct: 147 VKLESFVELTDVANEKLKCAETWSLNGLVKHVLGKQLLKDKSIRCSNWSNFPLTEDQKLY 206

Query: 435 AATDAFASWYLYEAIKNLPDSS 370
           AATDA+A   +Y+ + NL D++
Sbjct: 207 AATDAYAGLIIYQKLGNLGDTA 228

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 520,537,670
Number of Sequences: 1393205
Number of extensions: 11015998
Number of successful extensions: 28558
Number of sequences better than 10.0: 47
Number of HSP's better than 10.0 without gapping: 27871
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28549
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 23997478008
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GNf022c08 BP068958 1 131
2 GNf040f04 BP070328 45 431
3 GENLf001h03 BP062440 54 606
4 GNf056f02 BP071556 60 550
5 GNf055d09 BP071467 156 553




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research