KMC000023A_c24
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000023A_C24 KMC000023A_c24
cactttgagccacttgaataatgttaataaccaaaagttaagatATTAGGAATAGAGATG
CTGTTAAGTAAACATGAGAGGATCCAAATCCCTCACCAAACAAAGAGTTTCTGGATTGAA
GAGATATAAAGGAAGTACAAGAAAGGTTGAGCAGTACAGAGCAAATTTTCCGCAATGAAA
CAGAACTATTATTTGGATTGACTCATTTGTGTGGTAGCTGCCTCTTGTGAAATTCTAGAG
CAGCATACCGTATCATACAGCAAAGTGGCGGAAAACATAGTAATAACAAAAAGTGGATGA
GATTTGGAAAAAAAAAAACACAAGGCACTCACTTGGGCAGTGATGCAACTATATTTATGC
AAAGTACAAGGGAAGTAAGGGAGGTGGCAACTCAAATTTAACCGGTGTTCTGCATTCCAG
CAGCAATTCCCTTCATGGTGAGAATCAGGGTGTCTTCCAAACCAGTGGCATATTCACTTG
TTGGGGTTCAGTCTCACAAGTTCATCAGCTGGTTGGCTTTTCTCTTTAGAAATGTGCTTC
ACATCATAGTTGGGATCACGGATACGTTTCAATGTATAAGCTTGGAAAACATTCATGGTG
GTGATGTACGAATCACGCAGCCGGAGTCTTAGCTTCAAGTAAGGGTCTCCTTCAAGAACT
TCCTTGTGCCCAGCCACCTGAAGCAGGGAGTTTCTTAGTTTCTTCATATTTGTTCCTCAA
CTGTTCCCCAAATGGCCACAAGTCCTCTGAAACTAGGAGCCTGTCATTTAGAGCA


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000023A_C24 KMC000023A_c24
         (775 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAC20364.1| phosphoenolpyruvate carboxylase [Lotus japonicus]     135  2e-43
gb|AAD31452.1|AF135371_1 phosphoenol pyruvate carboxylase [Lotus...   135  2e-43
dbj|BAB89366.1| phosphoenolpyruvate carboxylase [Nicotiana sylve...   109  2e-42
gb|AAL83719.1|AF236126_1 PEP carboxylase [Vitis vinifera]             107  3e-40
pir||S68415 phosphoenolpyruvate carboxylase (EC 4.1.1.31) 3 - Ka...    97  1e-39

>dbj|BAC20364.1| phosphoenolpyruvate carboxylase [Lotus japonicus]
          Length = 961

 Score =  135 bits (340), Expect(2) = 2e-43
 Identities = 66/74 (89%), Positives = 70/74 (94%)
 Frame = -3

Query: 704  KKLRNSLLQVAGHKEVLEGDPYLKLRLRLRDSYITTMNVFQAYTLKRIRDPNYDVKHISK 525
            ++ +  LLQVAGHKEVLEGDPYLK RLRLRDSYITTMNVFQAYTLKRIRDPNYDVKHISK
Sbjct: 861  EETKKLLLQVAGHKEVLEGDPYLKQRLRLRDSYITTMNVFQAYTLKRIRDPNYDVKHISK 920

Query: 524  EKSQPADELVRLNP 483
            EKS+PADELVRLNP
Sbjct: 921  EKSKPADELVRLNP 934

 Score = 63.2 bits (152), Expect(2) = 2e-43
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = -2

Query: 774 ALNDRLLVSEDLWPFGEQLRNKYEETKKL 688
           ALNDRLLVSEDLWPFGEQLRNKYEETKKL
Sbjct: 838 ALNDRLLVSEDLWPFGEQLRNKYEETKKL 866

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 30/41 (73%), Positives = 34/41 (82%)
 Frame = -1

Query: 523  RKANQLMNL*D*TPTSEYATGLEDTLILTMKGIAAGMQNTG 401
            + A++L+ L    PTSEYA GLEDTLILTMKGIAAGMQNTG
Sbjct: 924  KPADELVRL---NPTSEYAPGLEDTLILTMKGIAAGMQNTG 961

>gb|AAD31452.1|AF135371_1 phosphoenol pyruvate carboxylase [Lotus corniculatus]
          Length = 957

 Score =  135 bits (340), Expect(2) = 2e-43
 Identities = 66/74 (89%), Positives = 70/74 (94%)
 Frame = -3

Query: 704  KKLRNSLLQVAGHKEVLEGDPYLKLRLRLRDSYITTMNVFQAYTLKRIRDPNYDVKHISK 525
            ++ +  LLQVAGHKEVLEGDPYLK RLRLRDSYITTMNVFQAYTLKRIRDPNYDVKHISK
Sbjct: 857  EETKKLLLQVAGHKEVLEGDPYLKQRLRLRDSYITTMNVFQAYTLKRIRDPNYDVKHISK 916

Query: 524  EKSQPADELVRLNP 483
            EKS+PADELVRLNP
Sbjct: 917  EKSKPADELVRLNP 930

 Score = 63.2 bits (152), Expect(2) = 2e-43
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = -2

Query: 774 ALNDRLLVSEDLWPFGEQLRNKYEETKKL 688
           ALNDRLLVSEDLWPFGEQLRNKYEETKKL
Sbjct: 834 ALNDRLLVSEDLWPFGEQLRNKYEETKKL 862

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 30/41 (73%), Positives = 34/41 (82%)
 Frame = -1

Query: 523  RKANQLMNL*D*TPTSEYATGLEDTLILTMKGIAAGMQNTG 401
            + A++L+ L    PTSEYA GLEDTLILTMKGIAAGMQNTG
Sbjct: 920  KPADELVRL---NPTSEYAPGLEDTLILTMKGIAAGMQNTG 957

>dbj|BAB89366.1| phosphoenolpyruvate carboxylase [Nicotiana sylvestris]
          Length = 750

 Score =  109 bits (272), Expect(3) = 2e-42
 Identities = 56/82 (68%), Positives = 69/82 (83%), Gaps = 5/82 (6%)
 Frame = -3

Query: 713 TNMKKLRNSLLQVAGHKEVLEGDPYLKLRLRLRDSYITTMNVFQAYTLKRIRDPNYDV-- 540
           +N ++ ++ LLQ+AGHK++LEGDPYL+ RLRLRDSYITT+NV QAYTLKRIRDPNY V  
Sbjct: 642 SNYEETKSLLLQIAGHKDLLEGDPYLRQRLRLRDSYITTLNVCQAYTLKRIRDPNYSVTP 701

Query: 539 -KHISKE--KSQPADELVRLNP 483
             HISKE  +S+PA ELV+LNP
Sbjct: 702 RPHISKEYMESKPAAELVKLNP 723

 Score = 56.6 bits (135), Expect(3) = 2e-42
 Identities = 27/28 (96%), Positives = 27/28 (96%)
 Frame = -1

Query: 484 PTSEYATGLEDTLILTMKGIAAGMQNTG 401
           PTSEYA GLEDTLILTMKGIAAGMQNTG
Sbjct: 723 PTSEYAPGLEDTLILTMKGIAAGMQNTG 750

 Score = 50.1 bits (118), Expect(3) = 2e-42
 Identities = 23/29 (79%), Positives = 25/29 (85%)
 Frame = -2

Query: 774 ALNDRLLVSEDLWPFGEQLRNKYEETKKL 688
           AL D+LLVSEDLW FGEQLR+ YEETK L
Sbjct: 622 ALYDKLLVSEDLWSFGEQLRSNYEETKSL 650

>gb|AAL83719.1|AF236126_1 PEP carboxylase [Vitis vinifera]
          Length = 339

 Score =  107 bits (267), Expect(3) = 3e-40
 Identities = 55/83 (66%), Positives = 67/83 (80%), Gaps = 6/83 (7%)
 Frame = -3

Query: 713 TNMKKLRNSLLQVAGHKEVLEGDPYLKLRLRLRDSYITTMNVFQAYTLKRIRDPNYDV-- 540
           TN ++ +  LLQ+AGH+++LEGDPYLK RLRLRD+YITT+NV QAYTLKRIRDPNY V  
Sbjct: 230 TNYEETKRLLLQIAGHRDLLEGDPYLKQRLRLRDAYITTLNVCQAYTLKRIRDPNYHVME 289

Query: 539 -KHISK---EKSQPADELVRLNP 483
             H+SK   E S+PA ELV+LNP
Sbjct: 290 RPHLSKEIMESSKPAAELVKLNP 312

 Score = 54.7 bits (130), Expect(3) = 3e-40
 Identities = 25/28 (89%), Positives = 27/28 (96%)
 Frame = -1

Query: 484 PTSEYATGLEDTLILTMKGIAAGMQNTG 401
           PTSEYA G+EDTLILTMKGIAAG+QNTG
Sbjct: 312 PTSEYAPGMEDTLILTMKGIAAGLQNTG 339

 Score = 46.2 bits (108), Expect(3) = 3e-40
 Identities = 21/29 (72%), Positives = 25/29 (85%)
 Frame = -2

Query: 774 ALNDRLLVSEDLWPFGEQLRNKYEETKKL 688
           AL DRLLVSE+LW FG++LR  YEETK+L
Sbjct: 210 ALYDRLLVSEELWLFGKRLRTNYEETKRL 238

>pir||S68415 phosphoenolpyruvate carboxylase (EC 4.1.1.31) 3 - Kalanchoe
           blossfeldiana (fragment)
          Length = 370

 Score = 97.1 bits (240), Expect(3) = 1e-39
 Identities = 52/82 (63%), Positives = 63/82 (76%), Gaps = 6/82 (7%)
 Frame = -3

Query: 710 NMKKLRNSLLQVAGHKEVLEGDPYLKLRLRLRDSYITTMNVFQAYTLKRIRDPNYDV--- 540
           N  + +N LLQVAGHK++LEG+PYL+ RLRLRDSYITT+N  QAYTLKRIRDPNY V   
Sbjct: 262 NYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYITTLNGCQAYTLKRIRDPNYHVTVR 321

Query: 539 KHISK---EKSQPADELVRLNP 483
             +SK   E ++ A ELV+LNP
Sbjct: 322 PRLSKEIMESNKAAAELVKLNP 343

 Score = 56.6 bits (135), Expect(3) = 1e-39
 Identities = 27/28 (96%), Positives = 27/28 (96%)
 Frame = -1

Query: 484 PTSEYATGLEDTLILTMKGIAAGMQNTG 401
           PTSEYA GLEDTLILTMKGIAAGMQNTG
Sbjct: 343 PTSEYAPGLEDTLILTMKGIAAGMQNTG 370

 Score = 53.1 bits (126), Expect(3) = 1e-39
 Identities = 24/29 (82%), Positives = 25/29 (85%)
 Frame = -2

Query: 774 ALNDRLLVSEDLWPFGEQLRNKYEETKKL 688
           AL D+LLVSEDLWPFGEQLRN Y ETK L
Sbjct: 241 ALYDKLLVSEDLWPFGEQLRNNYNETKNL 269

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 674,699,182
Number of Sequences: 1393205
Number of extensions: 15114160
Number of successful extensions: 36096
Number of sequences better than 10.0: 302
Number of HSP's better than 10.0 without gapping: 34110
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35974
length of database: 448,689,247
effective HSP length: 121
effective length of database: 280,111,442
effective search space used: 38095156112
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf014f07 BP063100 1 578
2 GENLf064g03 BP065812 45 577
3 MPDL001d09_f AV776573 45 682
4 GENLf071d11 BP066180 45 538
5 GENLf047g12 BP064861 65 612
6 GENLf052a10 BP065111 66 622
7 GENLf035g06 BP064199 66 578
8 GENLf011e09 BP062937 70 604
9 GENLf008h05 BP062790 70 651
10 GENLf015g11 BP063171 71 614
11 GENLf087g11 BP067109 72 640
12 GENLf041h06 BP064531 81 672
13 GNLf014b10 BP075606 90 573
14 GENLf068c12 BP066005 90 623
15 GENLf092c03 BP067364 92 536
16 GENLf068e06 BP066018 94 679
17 MR011b12_f BP076767 94 479
18 GENLf083c03 BP066861 94 619
19 MRL023e07_f BP084905 94 596
20 GENLf082g02 BP066829 94 600
21 MRL004h09_f BP083930 94 492
22 GENLf005a05 BP062595 94 635
23 GENLf081b11 BP066739 94 645
24 GENLf006d02 BP062656 94 696
25 GENLf056f09 BP065353 94 624
26 GENLf055h06 BP065308 96 646
27 MRL019b04_f BP084672 97 581
28 MRL039d01_f BP085632 97 181
29 MWL062g09_f AV769674 98 406
30 SPDL085d08_f BP057331 116 648
31 GENLf068g02 BP066032 117 648
32 GENLf059h12 BP065533 122 686
33 MPDL091d02_f AV781242 140 682
34 MRL001h11_f BP083764 163 670
35 MRL022h09_f BP084872 165 574
36 GENLf056f04 BP065350 166 719
37 SPDL021a10_f BP053283 166 753
38 GENLf025a03 BP063633 172 741
39 GENLf055c11 BP065274 174 697
40 GNf055f01 BP071480 174 664
41 MRL012f12_f BP084334 174 547
42 GENLf056g09 BP065358 174 730
43 GENLf041d05 BP064503 174 729
44 MFL020d10_f BP033868 174 605
45 GENLf024d06 BP063599 174 568
46 GENLf049g12 BP064984 174 530
47 GNf047b06 BP070814 174 595
48 MRL006h09_f BP084035 174 573
49 GENLf081d06 BP066750 174 689
50 GENLf022a11 BP063487 174 628
51 GENLf027c07 BP063762 174 691
52 GENLf032d12 BP064021 174 528
53 GENLf025f08 BP063662 174 675
54 GENLf018a12 BP063306 174 723
55 GENLf035g05 BP064198 174 704
56 GENLf059e05 BP065509 174 677
57 GNLf001b01 BP074831 174 723
58 GENLf066c05 BP065904 174 725
59 GENLf042c05 BP064549 174 731
60 GENLf069e11 BP066081 174 698
61 GENLf085c04 BP066968 175 728
62 GENLf049a10 BP064940 175 745
63 GENLf017a02 BP063244 175 707
64 MRL011h09_f BP084288 175 538
65 GENLf050h09 BP065045 175 723
66 GENLf092d10 BP067377 175 743
67 GENLf080h03 BP066718 175 532
68 GENLf037e12 BP064288 175 699
69 GENLf063d05 BP065727 175 463
70 MRL011a01_f BP084235 175 743
71 GENLf084f05 BP066938 175 696
72 GENLf019g06 BP063390 175 525
73 GENLf047b04 BP064819 175 745
74 GENLf045c04 BP064708 175 730
75 GENLf076b05 BP066451 175 738
76 GENLf082c08 BP066802 176 742
77 GENLf036c07 BP064227 176 743
78 GENLf080c07 BP066686 176 691
79 GENLf011h11 BP062951 176 730
80 GENLf084c05 BP066918 176 742
81 GENLf005e06 BP062618 176 743
82 GENLf033h07 BP064103 176 745
83 GENLf029d02 BP063867 176 707
84 GENLf052d10 BP065131 176 677
85 GENLf084f09 BP066939 177 740
86 GENLf036e05 BP064235 177 743
87 GENLf059d12 BP065507 178 745
88 MRL019d02_f BP084685 178 658
89 GENLf061f09 BP065627 178 691
90 GENLf086e04 BP067040 179 629
91 MRL013c06_f BP084367 179 649
92 GENLf022b01 BP063489 181 743
93 GENLf034f08 BP064142 181 653
94 GENLf006a09 BP062641 181 735
95 GENLf027e03 BP063777 181 653
96 GENLf043c05 BP064610 182 707
97 GENLf058a12 BP065438 182 766
98 GENLf015d09 BP063150 182 736
99 GENLf037g07 BP064301 182 743
100 GENLf042c06 BP064550 182 722
101 GENLf012c09 BP062967 182 743
102 GENLf031f04 BP063985 182 627
103 GENLf069a05 BP066049 182 742
104 GENLf066a08 BP065890 182 695
105 GENLf042c03 BP064547 182 743
106 GENLf084h06 BP066948 182 339
107 GENLf068d05 BP066009 182 696
108 MRL004d02_f BP083899 182 579
109 GENf071c10 BP061397 182 551
110 GENLf078c07 BP066588 182 743
111 GENLf008e04 BP062768 182 745
112 GENLf065c09 BP065850 182 769
113 GENLf017d05 BP063266 183 723
114 GENLf031h01 BP063997 183 724
115 GENLf080b12 BP066684 183 522
116 GENLf086b08 BP067020 183 691
117 MRL025f02_f BP085009 183 643
118 GENLf089f01 BP067217 183 462
119 GENLf026a07 BP063682 183 721
120 GENLf005c03 BP062603 183 809
121 MRL008e06_f BP084105 183 326
122 GENLf008b11 BP062752 184 743
123 GENLf065a10 BP065835 184 745
124 GENLf049b08 BP064947 185 695
125 GENLf085c12 BP066972 185 730
126 GENLf017g11 BP063290 185 742
127 GENLf026f06 BP063719 185 701
128 GENLf069f05 BP066083 185 728
129 GENLf058b07 BP065443 187 745
130 GENLf029e08 BP063874 190 743
131 GENLf083e11 BP066882 190 697
132 GENLf041f05 BP064517 203 683
133 GENLf041h05 BP064530 203 646
134 GENLf054e06 BP065234 203 743
135 MRL036g09_f BP085505 206 601
136 GENLf064g06 BP065815 206 768
137 GENLf011h06 BP062949 207 767
138 GENLf091g04 BP067336 211 307
139 GENLf073e04 BP066301 214 680
140 MRL003f04_f BP083864 218 688
141 GENLf060c09 BP065551 218 456
142 GENLf074c10 BP066344 220 463
143 GENLf008b09 BP062751 221 741
144 GENLf022b02 BP063490 222 730
145 GENLf029a08 BP063857 222 741
146 GENLf007d09 BP062716 241 730
147 GENLf028d09 BP063832 242 692
148 GNLf016h09 BP075765 246 384
149 GENLf048a06 BP064873 324 740




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research