KMC000022A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000022A_C02 KMC000022A_c02
atgCGGAGGAACAAGAATATCAAGAAGTGGATGGTATTACAGAATGAGGAAGATAGTCCA
TGGTCCCCAGTGGTTTTATAACAAGAACCATACCGTAAAATATGACAAACTAATTCTTGA
GACTGCAGATCCCTCATTTGGTAGAGGGAACAATTTATCATTCAATGCCTCTTTCTTATA
AGAATACATGAAACAGGAAAGAGAAGAAGGACAATGAAAACTCACAGAAATATAATGAAA
GAATAAAAATGAAAAAGTAAAACCCCCTATTACAGGTAACAATTGGTCAACCAAACACCC
TCCCCTTCCCCTTCCTCTTTATCTACACACCCGAAAAATACAACTTTGGCATCCAAAAAT
TCGTGCTACTTCGAGACGCGTGTCATGTTCAAATGCATTGCTTCTTCAACATGCAGTGTG
AGCTGAGAAAACACCTTCAGCTTTTTATTCTATGACTCATCACAATTCAATCCACAAATT
TCTAACACAGGGCCATCTCTTGACACAAAAGGGTTGATTCTAACCCACATGAGGGTCAAG
ATGGATGCAAGCAGAATTGACCACACCAACACAATGGTGGGCATTCTATCCTGTTTACCA
AGTAAACCTTTCAGGAATGGATAGAGATGGAGGACGACCCACAAGGCGAAGAACAATCTA
CCAAAGAGAGGTCCCCATGAGTCATAACCATTGTTGATGGCATCTGAGATCCCAACAATG
ATCCCAACTATGTTTATGATTAACAAAGTAGTTGGAGGGATGAG


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000022A_C02 KMC000022A_c02
         (764 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_179768.1| putative cellulose synthase catalytic subunit; ...   201  1e-50
ref|NP_196549.1| cellulose synthase catalytic subunit; protein i...   195  5e-49
gb|AAM97089.1| cellulose synthase catalytic subunit [Arabidopsis...   195  5e-49
ref|NP_195645.1| cellulose synthase catalytic subunit (Ath-A); p...   195  7e-49
gb|AAL24340.1| cellulose synthase catalytic subunit (Ath-A) [Ara...   195  7e-49

>ref|NP_179768.1| putative cellulose synthase catalytic subunit; protein id:
            At2g21770.1 [Arabidopsis thaliana]
            gi|25412057|pir||H84604 probable cellulose synthase
            catalytic subunit [imported] - Arabidopsis thaliana
            gi|4417271|gb|AAD20396.1| putative cellulose synthase
            catalytic subunit [Arabidopsis thaliana]
          Length = 1088

 Score =  201 bits (510), Expect = 1e-50
 Identities = 91/101 (90%), Positives = 101/101 (99%)
 Frame = -1

Query: 764  LIPPTTLLIINIVGIIVGISDAINNGYDSWGPLFGRLFFALWVVLHLYPFLKGLLGKQDR 585
            LIPPTTLLIINIVG+IVG+SDAINNGYDSWGPLFGRLFFALWV++HLYPFLKGLLGKQDR
Sbjct: 986  LIPPTTLLIINIVGVIVGVSDAINNGYDSWGPLFGRLFFALWVIVHLYPFLKGLLGKQDR 1045

Query: 584  MPTIVLVWSILLASILTLMWVRINPFVSRDGPVLEICGLNC 462
            +PTI+LVWSILLASILTL+WVR+NPFVS+DGPVLEICGL+C
Sbjct: 1046 VPTIILVWSILLASILTLLWVRVNPFVSKDGPVLEICGLDC 1086

>ref|NP_196549.1| cellulose synthase catalytic subunit; protein id: At5g09870.1
            [Arabidopsis thaliana] gi|9758965|dbj|BAB09408.1|
            cellulose synthase catalytic subunit [Arabidopsis
            thaliana]
          Length = 1069

 Score =  195 bits (496), Expect = 5e-49
 Identities = 87/101 (86%), Positives = 99/101 (97%)
 Frame = -1

Query: 764  LIPPTTLLIINIVGIIVGISDAINNGYDSWGPLFGRLFFALWVVLHLYPFLKGLLGKQDR 585
            LIPPTTLLIIN++G+IVGISDAI+NGYDSWGPLFGRLFFA WV+LHLYPFLKGLLGKQDR
Sbjct: 968  LIPPTTLLIINVIGVIVGISDAISNGYDSWGPLFGRLFFAFWVILHLYPFLKGLLGKQDR 1027

Query: 584  MPTIVLVWSILLASILTLMWVRINPFVSRDGPVLEICGLNC 462
            MPTI+LVWSILLASILTL+WVR+NPFV++ GP+LEICGL+C
Sbjct: 1028 MPTIILVWSILLASILTLLWVRVNPFVAKGGPILEICGLDC 1068

>gb|AAM97089.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
          Length = 346

 Score =  195 bits (496), Expect = 5e-49
 Identities = 87/101 (86%), Positives = 99/101 (97%)
 Frame = -1

Query: 764 LIPPTTLLIINIVGIIVGISDAINNGYDSWGPLFGRLFFALWVVLHLYPFLKGLLGKQDR 585
           LIPPTTLLIIN++G+IVGISDAI+NGYDSWGPLFGRLFFA WV+LHLYPFLKGLLGKQDR
Sbjct: 245 LIPPTTLLIINVIGVIVGISDAISNGYDSWGPLFGRLFFAFWVILHLYPFLKGLLGKQDR 304

Query: 584 MPTIVLVWSILLASILTLMWVRINPFVSRDGPVLEICGLNC 462
           MPTI+LVWSILLASILTL+WVR+NPFV++ GP+LEICGL+C
Sbjct: 305 MPTIILVWSILLASILTLLWVRVNPFVAKGGPILEICGLDC 345

>ref|NP_195645.1| cellulose synthase catalytic subunit (Ath-A); protein id:
            At4g39350.1, supported by cDNA: gi_2827140 [Arabidopsis
            thaliana] gi|7484859|pir||T08583 cellulose synthase (EC
            2.4.1.-) catalytic chain - Arabidopsis thaliana
            gi|2827141|gb|AAC39335.1| cellulose synthase catalytic
            subunit [Arabidopsis thaliana] gi|4914447|emb|CAB43650.1|
            cellulose synthase catalytic subunit (Ath-A) [Arabidopsis
            thaliana] gi|7270919|emb|CAB80598.1| cellulose synthase
            catalytic subunit (Ath-A) [Arabidopsis thaliana]
          Length = 1084

 Score =  195 bits (495), Expect = 7e-49
 Identities = 86/101 (85%), Positives = 100/101 (98%)
 Frame = -1

Query: 764  LIPPTTLLIINIVGIIVGISDAINNGYDSWGPLFGRLFFALWVVLHLYPFLKGLLGKQDR 585
            LIPPTTLLIINI+G+IVG+SDAI+NGYDSWGPLFGRLFFALWV++HLYPFLKG+LGKQD+
Sbjct: 982  LIPPTTLLIINIIGVIVGVSDAISNGYDSWGPLFGRLFFALWVIVHLYPFLKGMLGKQDK 1041

Query: 584  MPTIVLVWSILLASILTLMWVRINPFVSRDGPVLEICGLNC 462
            MPTI++VWSILLASILTL+WVR+NPFV++ GPVLEICGLNC
Sbjct: 1042 MPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLNC 1082

>gb|AAL24340.1| cellulose synthase catalytic subunit (Ath-A) [Arabidopsis thaliana]
           gi|20259920|gb|AAM13307.1| cellulose synthase catalytic
           subunit [Arabidopsis thaliana]
          Length = 507

 Score =  195 bits (495), Expect = 7e-49
 Identities = 86/101 (85%), Positives = 100/101 (98%)
 Frame = -1

Query: 764 LIPPTTLLIINIVGIIVGISDAINNGYDSWGPLFGRLFFALWVVLHLYPFLKGLLGKQDR 585
           LIPPTTLLIINI+G+IVG+SDAI+NGYDSWGPLFGRLFFALWV++HLYPFLKG+LGKQD+
Sbjct: 405 LIPPTTLLIINIIGVIVGVSDAISNGYDSWGPLFGRLFFALWVIVHLYPFLKGMLGKQDK 464

Query: 584 MPTIVLVWSILLASILTLMWVRINPFVSRDGPVLEICGLNC 462
           MPTI++VWSILLASILTL+WVR+NPFV++ GPVLEICGLNC
Sbjct: 465 MPTIIVVWSILLASILTLLWVRVNPFVAKGGPVLEICGLNC 505

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 719,094,475
Number of Sequences: 1393205
Number of extensions: 16812636
Number of successful extensions: 44635
Number of sequences better than 10.0: 82
Number of HSP's better than 10.0 without gapping: 42201
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44535
length of database: 448,689,247
effective HSP length: 121
effective length of database: 280,111,442
effective search space used: 37254821786
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MPDL066e06_f AV779865 1 484
2 MFBL035f01_f BP043023 4 474
3 SPDL064h11_f BP056006 5 545
4 SPDL067g07_f BP056183 8 544
5 MPDL050a05_f AV779008 9 558
6 GENLf001g04 BP062437 9 498
7 MPD002e01_f AV770134 10 592
8 MRL010b09_f BP084195 12 500
9 MPDL060f01_f AV779557 13 564
10 GENLf057b07 BP065380 14 565
11 GENLf057h06 BP065423 14 555
12 GENLf072c01 BP066228 16 497
13 MF015d09_f BP029034 19 477
14 MWL033f08_f AV769138 20 396
15 MFBL049c05_f BP043758 20 498
16 SPDL099c03_f BP058212 20 589
17 SPDL043d05_f BP054706 30 546
18 GNLf004c08 BP075013 32 470
19 SPDL036c04_f BP054255 32 531
20 SPDL085b02_f BP057304 32 498
21 MFL016h08_f BP033818 34 491
22 SPDL014h07_f BP052896 47 497
23 MWL016g10_f AV768852 96 538
24 SPD005f04_f BP044411 127 643
25 MPDL028g06_f AV777914 144 498
26 MRL006b10_f BP083997 162 508
27 MPDL028f06_f AV777909 166 470
28 GENLf009e01 BP062825 195 773
29 SPDL049e02_f BP055079 227 757




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research