KMC000021A_c12
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000021A_C12 KMC000021A_c12
gataccattaagttaacaattttatttGCTCATTTCCCAACATTGTTGAGACCATTAAGT
TACCAATTTTATTTGCTCATTTCCCAACATATGCAACCAATGATGAAAACCATCTATTAT
CACATTAACAAAAAGCCGATTACTCAAAAATACGTAAAAATCTGAAACAGCTCGATCCCT
CAAGTGTATTAAGCAACCAAAAAACTAACGCTCATCATGGAGCAACTTCATGAGTTCGAG
AAACCAATTTATTACTGGACATTTCAATCGGTCAAGGTCAAGAAGCGTAACTTGAACGAG
ATACATGGCAAGAAACACACTTAAGCCAGTGGGTCAGCTTGGCAGCACCAACACCTTAAA
GAGATTTTGCAACATGCACGATCAGGTCAACCACACGGGTGCTGGTATCCCATCTCGGTT
GTCATACCACGCAGACAAGCTTGACAAAGTTGTCATTCAAAGCAATTCCAGCCTTGGCAT
CAAAGATACTTGACCTGTTGTCGCCAATGAAGTCAGTTGAGACCACATCATCTTCAGTGT
AACCGAGGATTCCCTTCAATTTGCCCTCAGACTCCTCCTTGATAGCAGCTTTAATTTGAT
CATAGGTGGCAGCCTTCTCCAGTCTGACTGTGAGGTCAACAACTGAGACATCCACAGTAG
GAACACGGAATGCCATCCCGGTCAATTTTCCATTCAAAGCAGGAAGCACTTTGCCAACAG
CCTTAGCAGCTCCAGTGCTGCTGGGAATGATGTTGAATGAGGCAGCCCTTCCACCTCTCC
AGTCTTTTGCGGATGGCCCATCAACAGTCTTCTGAGTGGCAGTGATGGAATGA


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000021A_C12 KMC000021A_c12
         (833 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P34922|G3PC_PEA Glyceraldehyde 3-phosphate dehydrogenase, cyt...   266  2e-70
emb|CAA42103.1| glycolytic glyceraldehyde 3-phosphate dehydrogen...   266  2e-70
sp|P25861|G3PC_ANTMA Glyceraldehyde 3-phosphate dehydrogenase, c...   266  2e-70
sp|P34921|G3PC_DIACA Glyceraldehyde 3-phosphate dehydrogenase, c...   265  6e-70
emb|CAB39974.1| glyceraldehyde-3-phosphate dehydrogenase [Nicoti...   265  6e-70

>sp|P34922|G3PC_PEA Glyceraldehyde 3-phosphate dehydrogenase, cytosolic
           gi|7431538|pir||T06781 glyceraldehyde-3-phosphate
           dehydrogenase (phosphorylating)  (EC 1.2.1.12) - garden
           pea gi|169091|gb|AAA33667.1| glyceraldehyde-3-phosphate
           dehydrogenase gi|1345567|emb|CAA51675.1| glyceraldehyde
           3-phosphate dehydrogenase (phosphorylating) [Pisum
           sativum]
          Length = 338

 Score =  266 bits (681), Expect = 2e-70
 Identities = 141/158 (89%), Positives = 145/158 (91%)
 Frame = -2

Query: 832 HSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 653
           HSITATQKTVDGPS+KDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGM+FRVPTV
Sbjct: 182 HSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTV 241

Query: 652 DVSVVDLTVRLEKAATYDQIKAAIKEESEGKLKGILGYTEDDVVSTDFIGDNRSSIFDAK 473
           DVSVVDLTVRLEKAATYD+IKAAIKEESEGKLKGILGYTEDDVVSTDFIGD RSSIFDAK
Sbjct: 242 DVSVVDLTVRLEKAATYDEIKAAIKEESEGKLKGILGYTEDDVVSTDFIGDTRSSIFDAK 301

Query: 472 AGIALNDNFVKLVCVV*QPRWDTSTRVVDLIVHVAKSL 359
           AGIALND FVKLV          STRVVDLIVH+AK L
Sbjct: 302 AGIALNDKFVKLVSWY-DNELGYSTRVVDLIVHIAKQL 338

>emb|CAA42103.1| glycolytic glyceraldehyde 3-phosphate dehydrogenase [Antirrhinum
           majus]
          Length = 336

 Score =  266 bits (681), Expect = 2e-70
 Identities = 139/155 (89%), Positives = 144/155 (92%)
 Frame = -2

Query: 832 HSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 653
           HSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLP LNGKLTGM+FRVPTV
Sbjct: 180 HSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTV 239

Query: 652 DVSVVDLTVRLEKAATYDQIKAAIKEESEGKLKGILGYTEDDVVSTDFIGDNRSSIFDAK 473
           DVSVVDLTVRLEK ATY+QIKAAIKEESEGKLKGILGYTEDDVVSTDF+GD+RSSIFDAK
Sbjct: 240 DVSVVDLTVRLEKKATYEQIKAAIKEESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAK 299

Query: 472 AGIALNDNFVKLVCVV*QPRWDTSTRVVDLIVHVA 368
           AGIALNDNFVKLV       W  STRVVDLIVH+A
Sbjct: 300 AGIALNDNFVKLVSWY-DNEWGYSTRVVDLIVHMA 333

>sp|P25861|G3PC_ANTMA Glyceraldehyde 3-phosphate dehydrogenase, cytosolic
           gi|66012|pir||DESKG glyceraldehyde-3-phosphate
           dehydrogenase (phosphorylating)  (EC 1.2.1.12) - garden
           snapdragon
          Length = 337

 Score =  266 bits (681), Expect = 2e-70
 Identities = 139/155 (89%), Positives = 144/155 (92%)
 Frame = -2

Query: 832 HSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 653
           HSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLP LNGKLTGM+FRVPTV
Sbjct: 181 HSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTV 240

Query: 652 DVSVVDLTVRLEKAATYDQIKAAIKEESEGKLKGILGYTEDDVVSTDFIGDNRSSIFDAK 473
           DVSVVDLTVRLEK ATY+QIKAAIKEESEGKLKGILGYTEDDVVSTDF+GD+RSSIFDAK
Sbjct: 241 DVSVVDLTVRLEKKATYEQIKAAIKEESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAK 300

Query: 472 AGIALNDNFVKLVCVV*QPRWDTSTRVVDLIVHVA 368
           AGIALNDNFVKLV       W  STRVVDLIVH+A
Sbjct: 301 AGIALNDNFVKLVSWY-DNEWGYSTRVVDLIVHMA 334

>sp|P34921|G3PC_DIACA Glyceraldehyde 3-phosphate dehydrogenase, cytosolic
          Length = 338

 Score =  265 bits (677), Expect = 6e-70
 Identities = 135/157 (85%), Positives = 144/157 (90%)
 Frame = -2

Query: 832 HSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 653
           HSITATQKTVDGPS KDWRGGRAASFNIIPSSTGAAKAVGKVLP+LNGKLTGM+FRVPTV
Sbjct: 181 HSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTV 240

Query: 652 DVSVVDLTVRLEKAATYDQIKAAIKEESEGKLKGILGYTEDDVVSTDFIGDNRSSIFDAK 473
           DVSVVDLTVR+EK ATY+Q+KAAIKEESEGKLKGILGYTEDDVVSTDF+GDNRSSIFDAK
Sbjct: 241 DVSVVDLTVRIEKPATYEQVKAAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAK 300

Query: 472 AGIALNDNFVKLVCVV*QPRWDTSTRVVDLIVHVAKS 362
           AGIALNDNF+KLV       W  STRVVDLI H+ K+
Sbjct: 301 AGIALNDNFIKLVSWY-DNEWGYSTRVVDLIAHIHKT 336

>emb|CAB39974.1| glyceraldehyde-3-phosphate dehydrogenase [Nicotiana tabacum]
          Length = 337

 Score =  265 bits (677), Expect = 6e-70
 Identities = 139/155 (89%), Positives = 143/155 (91%)
 Frame = -2

Query: 832 HSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 653
           HSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV
Sbjct: 181 HSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 240

Query: 652 DVSVVDLTVRLEKAATYDQIKAAIKEESEGKLKGILGYTEDDVVSTDFIGDNRSSIFDAK 473
           DVSVVDLTVRLEK ATYD+IKAAIKEESEGKLKGILGYTEDDVVSTDF+GDNRSSIFDAK
Sbjct: 241 DVSVVDLTVRLEKEATYDEIKAAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAK 300

Query: 472 AGIALNDNFVKLVCVV*QPRWDTSTRVVDLIVHVA 368
           AGIAL+ NFVKLV       W  STRVVDLI H+A
Sbjct: 301 AGIALSKNFVKLVSWY-DNEWGYSTRVVDLIKHMA 334

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 700,072,287
Number of Sequences: 1393205
Number of extensions: 15099456
Number of successful extensions: 42317
Number of sequences better than 10.0: 1685
Number of HSP's better than 10.0 without gapping: 39860
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41643
length of database: 448,689,247
effective HSP length: 122
effective length of database: 278,718,237
effective search space used: 43201326735
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MR070e08_f BP081392 1 402
2 GNf009b07 BP068005 24 519
3 MR008f02_f BP076568 28 516
4 SPD028h09_f BP046258 36 525
5 MR045d01_f BP079474 48 574
6 MF004a03_f BP028421 49 558
7 SPD080h04_f BP050419 49 522
8 MR012b02_f BP076840 62 453
9 MF046b10_f BP030709 78 649
10 MFB020a10_f BP035391 94 635
11 MWM080d06_f AV766025 96 505
12 MFB078e03_f BP039703 101 674
13 MR036c09_f BP078774 102 496
14 MFBL039d08_f BP043230 104 600
15 MFBL038g12_f BP043195 104 673
16 MF064f04_f BP031713 104 633
17 GNf089f07 BP073954 105 501
18 MWM192e01_f AV767663 105 348
19 MFB073d01_f BP039306 108 762
20 MF079b12_f BP032464 112 600
21 MPD031h03_f AV772152 117 702
22 MFB090a02_f BP040542 119 540
23 MR043d12_f BP079329 119 656
24 MR043a07_f BP079298 119 541
25 MF009f09_f BP028706 119 648
26 MF087a10_f BP032854 119 666
27 MR071b05_f BP081433 119 500
28 GNf051b12 BP071130 119 633
29 MFB056c02_f BP038042 119 277
30 MF071h11_f BP032096 119 279
31 SPD034e01_f BP046705 120 719
32 MPD097g01_f AV776362 123 664
33 GNf040d03 BP070303 127 548
34 MF017e07_f BP029153 127 585
35 GNf013a11 BP068287 127 571
36 MF002g11_f BP028357 127 501
37 GNf075g03 BP072935 129 600
38 GENf077d08 BP061662 142 470
39 SPD008c08_f BP044624 142 737
40 MF074f08_f BP032241 142 715
41 SPD058c02_f BP048598 142 632
42 MR042c12_f BP079243 142 421
43 GENf066h09 BP061211 142 644
44 MFB044d12_f BP037219 142 529
45 GENf018d04 BP059125 142 563
46 MR001e03_f BP076006 142 606
47 SPD008f08_f BP044654 143 702
48 SPD012f05_f BP044971 146 730
49 MFB019e01_f BP035343 148 789
50 MF051c08_f BP030968 156 681
51 GENf048g08 BP060395 156 572
52 SPD050a08_f BP047955 156 792
53 GENf050d06 BP060467 157 565
54 GENf030c08 BP059610 161 701
55 MF071e06_f BP032068 162 719
56 GNf042b08 BP070444 162 575
57 MFB016b11_f BP035086 162 707
58 MR033h07_f BP078581 164 525
59 SPD044e08_f BP047515 165 742
60 MFB043c10_f BP037131 165 591
61 MF014c06_f BP028975 171 631
62 MF100f04_f BP033501 187 795
63 SPD033b10_f BP046603 189 305
64 MFB084h11_f BP040179 191 728
65 GENf080g06 BP061797 193 568
66 GENf009e03 BP058722 199 591
67 MF014e04_f BP028986 200 764
68 SPD004h02_f BP044346 201 660
69 MR033c02_f BP078528 205 692
70 MF001d03_f BP028266 235 730
71 MF062a08_f BP031561 238 378
72 GNf049c09 BP070982 238 744
73 GENf048d11 BP060377 242 616
74 GENf006a11 BP058567 242 618
75 MF075f07_f BP032289 242 757
76 MF009b11_f BP028682 242 793
77 GENf006g08 BP058598 242 414
78 MR017e09_f BP077284 242 760
79 MFB027e01_f BP035966 242 828
80 MWM250a01_f AV768562 242 307
81 MFB078c03_f BP039681 242 725
82 MF007f11_f BP028602 242 715
83 GENf027h12 BP059511 242 655
84 SPD010h02_f BP044830 243 789
85 MFB078h06_f BP039734 247 819
86 SPD070a02_f BP049566 252 871




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research