KMC000020A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000020A_C01 KMC000020A_c01
gactaaaaagcttaattgagccataaatgaaggtttgaatcgaaaacttgccagtaactc
ttataacaaccaaTACTGAATTGATGGTATTGCTTTTGGTCTCGCAACATATACGCCTGG
CATGATGGGCGTGTTCAACTCAGTTATAATAAGATAAATCTAACAGGATGGTTTCATATT
AATGGTTACATTATGAAAAACATTACTACTGTCAAAAAAAGAACTAATAGGCAATGACCA
AATCAGATGTGATACCCCATAATCAATAATGTATCCGAGAAAATCAAATGGATTCACTTA
TCGTGGAGGCGGTGGCGGTGGCAGGTTTGATTTTGCAAACCCCACCCATGTAACAATGCC
AACAGCCAGAATGATCCATCCAAATATGTCATACTTCAGATCACTGCTCTTCTTTTTCTT
TTGAGTCTGAAAAATAAACAAAAAAATTAGGCAAAAATATAAGCATAAGTATGCAGATCA
GAGTTTCTAAATATTTAAGCTATAGCCTATGTGCTTCAATGTGCTTTTTGTAGCTTGAAT
GAAAACATGCTTACCCATAATGGAGATATCAAATAAATAA


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000020A_C01 KMC000020A_c01
         (580 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P92792|OM20_SOLTU Mitochondrial import receptor subunit TOM20...    82  4e-15
dbj|BAB86179.1| putative mitochondrial import receptor subunit T...    65  8e-10
ref|NP_189344.1| TOM20, putative; protein id: At3g27080.1, suppo...    62  7e-09
gb|AAM64598.1| putative TOM20 [Arabidopsis thaliana]                   62  7e-09
pir||D86399 protein F17L21.18 [imported] - Arabidopsis thaliana ...    58  7e-08

>sp|P92792|OM20_SOLTU Mitochondrial import receptor subunit TOM20 (Translocase of outer
           membrane 20 kDa subunit) gi|7459240|pir||T07679 protein
           import receptor TOM20, mitochondrial - potato
           gi|1524370|emb|CAA63223.1| TOM20 [Solanum tuberosum]
          Length = 204

 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 35/42 (83%), Positives = 39/42 (92%)
 Frame = -2

Query: 429 QTQKKKKSSDLKYDIFGWIILAVGIVTWVGFAKSNLPPPPPP 304
           ++ KK KSSDLKYDIFGW+ILAVGIV WVGFAKSN+PPPPPP
Sbjct: 160 KSSKKTKSSDLKYDIFGWVILAVGIVAWVGFAKSNMPPPPPP 201

>dbj|BAB86179.1| putative mitochondrial import receptor subunit TOM20 (translocase
           of outer membrane 20 KDA subunit) [Oryza sativa
           (japonica cultivar-group)]
          Length = 237

 Score = 64.7 bits (156), Expect = 8e-10
 Identities = 26/41 (63%), Positives = 32/41 (77%)
 Frame = -2

Query: 429 QTQKKKKSSDLKYDIFGWIILAVGIVTWVGFAKSNLPPPPP 307
           Q++KKKK SD  YD+FGW++L VG+V WVG AKSN PP  P
Sbjct: 191 QSRKKKKDSDFWYDVFGWVVLGVGMVVWVGLAKSNAPPQAP 231

>ref|NP_189344.1| TOM20, putative; protein id: At3g27080.1, supported by cDNA:
           30812., supported by cDNA: gi_14532805, supported by
           cDNA: gi_19310822 [Arabidopsis thaliana]
           gi|13631842|sp|P82874|O203_ARATH Mitochondrial import
           receptor subunit TOM20-3 (Translocase of outer membrane
           20 kDa subunit 3) gi|9279631|dbj|BAB01089.1| TOM20-like
           protein [Arabidopsis thaliana]
           gi|11044965|emb|CAC14430.1| TOM20-3 protein [Arabidopsis
           thaliana] gi|14532806|gb|AAK64184.1| putative TOM20
           protein [Arabidopsis thaliana]
           gi|19310823|gb|AAL85142.1| putative TOM20 protein
           [Arabidopsis thaliana]
          Length = 202

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 24/38 (63%), Positives = 30/38 (78%)
 Frame = -2

Query: 420 KKKKSSDLKYDIFGWIILAVGIVTWVGFAKSNLPPPPP 307
           K KKSSD KYD  GW+ILA+G+V W+ FAK+N+P  PP
Sbjct: 164 KNKKSSDAKYDAMGWVILAIGVVAWISFAKANVPVSPP 201

>gb|AAM64598.1| putative TOM20 [Arabidopsis thaliana]
          Length = 202

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 24/38 (63%), Positives = 30/38 (78%)
 Frame = -2

Query: 420 KKKKSSDLKYDIFGWIILAVGIVTWVGFAKSNLPPPPP 307
           K KKSSD KYD  GW+ILA+G+V W+ FAK+N+P  PP
Sbjct: 164 KNKKSSDAKYDAMGWVILAIGVVAWISFAKANVPVSPP 201

>pir||D86399 protein F17L21.18 [imported] - Arabidopsis thaliana
           gi|9802543|gb|AAF99745.1|AC004557_24 F17L21.18
           [Arabidopsis thaliana]
          Length = 209

 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 26/45 (57%), Positives = 34/45 (74%)
 Frame = -2

Query: 435 IFQTQKKKKSSDLKYDIFGWIILAVGIVTWVGFAKSNLPPPPPPR 301
           +  ++KKK++++  YD+ GWIILA GIV WVG AKS L PPPP R
Sbjct: 166 VSSSKKKKRNTEFTYDVCGWIILACGIVAWVGMAKS-LGPPPPAR 209

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 495,553,695
Number of Sequences: 1393205
Number of extensions: 10886404
Number of successful extensions: 48329
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 34066
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42679
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 21426319650
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MWM058a06_f AV765606 1 395
2 GENLf001f07 BP062433 74 580




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research