KMC000019A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000019A_C01 KMC000019A_c01
GTCTGGTAAGCAAAACAATATGACGTTTATTTCGATAACATGTTCAAATAATTTGGTCAA
TAAGCAAACCATTTGCAATTGGGGAAGTATGGTATGGACATGCTTATGAGTACCAAACCA
AAAGCGTGCTTTTCAGAGGAAGTATCCATATAGTTCCAAGTAACAAATGCACAAGTTCCA
GGGATTGGTGGCATCAGTAGTGGATCCTGTGAGAACAACCCGAAAATACCGAAAGGGAAG
CAGTGCGTTGGGGCCAGTTATGGGCCAAGATGGCAAATTGACCAGGTTTGCACACTGTCC
AGTCATTTTCATGGACTCTCAAGTTCTTCCAACTCTTCCCATCCAGTGAACCCTGAATAT
TCCAACATCTCGGAAAGGCCTTGGAACCATCCTGCCTCAGCGTATAGTAGTTGCACATAA
GCTGATGATCTTGGCCAAGATCAACCATCCACCAGGTAGAGTTATGTCCATTTTCCAATC
GAGGCCCAGCAAAACATGTTCCCTGGTAGGTTCTGGAGACCAAAACCTTAGGATCAGTGT
ATCTTGAGTGGGGACTGCTGGCTGTAATC


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000019A_C01 KMC000019A_c01
         (569 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAM62449.1| unknown [Arabidopsis thaliana]                         163  2e-39
ref|NP_180619.1| unknown protein; protein id: At2g30610.1 [Arabi...   120  2e-26
gb|AAB47544.1| MigA [Dictyostelium discoideum]                         48  6e-09
gb|AAO51756.1| similar to Dictyostelium discoideum (Slime mold)....    50  3e-07
ref|NP_609369.1| CG5604-PA [Drosophila melanogaster] gi|7297647|...    42  0.004

>gb|AAM62449.1| unknown [Arabidopsis thaliana]
          Length = 809

 Score =  163 bits (412), Expect = 2e-39
 Identities = 72/111 (64%), Positives = 89/111 (79%)
 Frame = -2

Query: 568 ITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGHNSTWWMVDLGQDHQLMCNYYTLRQD 389
           IT+SSP SR+TDPK L S+ Y GT FAGPR+E+GH S+WW+VDLG++HQLMCNYYT RQD
Sbjct: 666 ITSSSPTSRFTDPKALASKAYAGTSFAGPRMEDGHISSWWVVDLGEEHQLMCNYYTFRQD 725

Query: 388 GSKAFPRCWNIQGSLDGKSWKNLRVHENDWTVCKPGQFAILAHNWPQRTAS 236
           GS+AF R W  QGS+DGK+W +LRVHE+D T+CK GQFA    +WP   A+
Sbjct: 726 GSRAFTRFWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFA----SWPITAAN 772

 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 40/66 (60%), Positives = 45/66 (67%)
 Frame = -3

Query: 336 RVGRT*ESMKMTGQCANLVNLPSWPITGPNALLPFRYFRVVLTGSTTDATNPWNLCICYL 157
           RV    ++M   GQ A      SWPIT  NALLPFR+FR+VLTG T D + PWN CICYL
Sbjct: 749 RVHEDDQTMCKAGQFA------SWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYL 802

Query: 156 ELYGYF 139
           ELYGYF
Sbjct: 803 ELYGYF 808

>ref|NP_180619.1| unknown protein; protein id: At2g30610.1 [Arabidopsis thaliana]
           gi|25408093|pir||E84710 hypothetical protein At2g30610
           [imported] - Arabidopsis thaliana
           gi|1946358|gb|AAB63076.1| unknown protein [Arabidopsis
           thaliana]
          Length = 114

 Score =  120 bits (300), Expect = 2e-26
 Identities = 51/81 (62%), Positives = 65/81 (79%)
 Frame = -2

Query: 478 LENGHNSTWWMVDLGQDHQLMCNYYTLRQDGSKAFPRCWNIQGSLDGKSWKNLRVHENDW 299
           +E+GH S+WW+VDLG++HQLMCNYYT RQDGS+AF R W  QGS+DGK+W +LRVHE+D 
Sbjct: 1   MEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQ 60

Query: 298 TVCKPGQFAILAHNWPQRTAS 236
           T+CK GQFA    +WP   A+
Sbjct: 61  TMCKAGQFA----SWPITAAN 77

 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 40/66 (60%), Positives = 45/66 (67%)
 Frame = -3

Query: 336 RVGRT*ESMKMTGQCANLVNLPSWPITGPNALLPFRYFRVVLTGSTTDATNPWNLCICYL 157
           RV    ++M   GQ A      SWPIT  NALLPFR+FR+VLTG T D + PWN CICYL
Sbjct: 54  RVHEDDQTMCKAGQFA------SWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYL 107

Query: 156 ELYGYF 139
           ELYGYF
Sbjct: 108 ELYGYF 113

>gb|AAB47544.1| MigA [Dictyostelium discoideum]
          Length = 813

 Score = 48.1 bits (113), Expect(2) = 6e-09
 Identities = 24/72 (33%), Positives = 39/72 (53%), Gaps = 2/72 (2%)
 Frame = -2

Query: 460 STWWMVDLGQDHQLMCNYYTLRQDGSKAFP--RCWNIQGSLDGKSWKNLRVHENDWTVCK 287
           ++W M+DLG +  ++  YYT+R   S      R W+ QGS +G+ W  L+ H ND ++  
Sbjct: 701 ASWVMIDLGPNRTVVPMYYTIRHGLSYKSDSLRTWDFQGSTNGEQWTVLKRHTNDPSL-- 758

Query: 286 PGQFAILAHNWP 251
              +    H+WP
Sbjct: 759 --NYKYATHSWP 768

 Score = 33.5 bits (75), Expect(2) = 6e-09
 Identities = 19/42 (45%), Positives = 25/42 (59%)
 Frame = -3

Query: 270 SWPITGPNALLPFRYFRVVLTGSTTDATNPWNLCICYLELYG 145
           SWP+TG      FRYFR++ TG  ++  N   L I  LE+YG
Sbjct: 766 SWPVTGCETA--FRYFRILQTGKNSNNRN--FLVIGGLEIYG 803

>gb|AAO51756.1| similar to Dictyostelium discoideum (Slime mold). MigA
          Length = 602

 Score = 49.7 bits (117), Expect(2) = 3e-07
 Identities = 25/58 (43%), Positives = 33/58 (56%), Gaps = 5/58 (8%)
 Frame = -2

Query: 460 STWWMVDLGQDHQLMCNYYTLRQDGSK-----AFPRCWNIQGSLDGKSWKNLRVHEND 302
           ++++ VDLG  H L   YY+LR  G       A P+ W + GSLDG+ W  LR H ND
Sbjct: 431 NSFFCVDLGVKHVLCPTYYSLRYGGDSQGSIYAAPKNWQLLGSLDGQEWTLLRDHSND 488

 Score = 26.2 bits (56), Expect(2) = 3e-07
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = -3

Query: 234 FRYFRVVLTGSTTDATNPWNLCICYLELYG 145
           +RY +++ TG      N   LC+C  E+YG
Sbjct: 508 YRYLKILQTGPNQRDGN--ELCLCCFEVYG 535

>ref|NP_609369.1| CG5604-PA [Drosophila melanogaster] gi|7297647|gb|AAF52899.1|
            CG5604-PA [Drosophila melanogaster]
          Length = 2727

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 25/79 (31%), Positives = 40/79 (49%), Gaps = 2/79 (2%)
 Frame = -2

Query: 466  HNSTWWMVDLGQDHQLMCNYYTLR--QDGSKAFPRCWNIQGSLDGKSWKNLRVHENDWTV 293
            +   W+ +DLG    ++   YTLR  +   ++  R W +QGS DG +W  L  H +D ++
Sbjct: 1190 NKKAWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGSTWTTLSTHVDDKSL 1247

Query: 292  CKPGQFAILAHNWPQRTAS 236
             +PG  A     WP   A+
Sbjct: 1248 VEPGSTA----TWPINCAT 1262

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 570,396,117
Number of Sequences: 1393205
Number of extensions: 13763814
Number of successful extensions: 37423
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 36181
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37406
length of database: 448,689,247
effective HSP length: 116
effective length of database: 287,077,467
effective search space used: 20956655091
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MRL007b11_f BP084047 1 447
2 MFBL001b12_f BP041311 1 579
3 GENf053d04 BP060606 1 524
4 GENLf001f06 BP062432 6 563
5 GENLf080d05 BP066691 6 507
6 GNLf013d10 BP075568 9 509




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research