KMC000018A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000018A_C01 KMC000018A_c01
aaatacagagaatctctgcgttttgtttccacaaaaaagaaatcacagaaaaagccaggt
gGAATAGGAAAATCTTACATATTCTTACCCTATTAATGCTATTGAATAGAAAATCAGAAG
TTACTGTCATGGCTTTAACAAAGATGACTATGGAAGCCCATTTAAGTGCAAAAAGGCAAG
ATAAAATGGAATGACCCTTTTCACAAATACATTTGTATATAAAGAAAAAATGCAGAAGAA
AATTGTCGTAGTGAAAACCTCTTATGCTCTCATACTCATTTTAACATTTCTTGTGAGTTC
TCAATTCACCAACATCATACTTGACTTTTAAATGCTCTTCTATGGAGATGAAAGTCAAAA
GAAGAGGAAACCTTCAAGCTCTAAAGCCTCCAATTAAAGGAGAAGATTCTTTGGATATCA
CGATGCAGTTGAGGAATGACCATCAGACAGGAGCAGAGCTTGGCTTGACTTCCATTGACG
GATGGAAAGAAATCTTAGAGAACTGCATAAGGAATCATGGAAGGAGGGTGCCCTTGCTCA
AATCCACTTAATTAGAAAATGAATGTAGAAGAACATGGGGAAAAACTGGCCTGGAAGACC
ATAAATCATCCTTAACACAGCATTACAGACAAAATAATGACCTTTGCAACTCCTCTTAAA
TCAACACATAGGTGAATAGCACATAAATAGTTCGAGAAATATAGCAATTCCTCCTTGTAC
CTCAGGTCACACTAATCATGAAGCCTTTGAATTGATTCTTGTTTGTTCACCTTTCCTAAA
GGACAAAGACAATCCAGGCCAACAAAAC


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000018A_C01 KMC000018A_c01
         (808 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAC28707.1| unnamed protein product [Mus musculus]                 36  0.76
pir||T17157 CL2AA protein - rat gi|3695123|gb|AAC62654.1| CL2AA ...    36  0.76
pir||T46611 CL2BB protein - rat gi|3695131|gb|AAC62658.1| CL2BB ...    36  0.76
pir||T17158 CL2AB protein - rat gi|3695125|gb|AAC62655.1| CL2AB ...    36  0.76
pir||T17185 CL2BC protein - rat gi|3695133|gb|AAC62659.1| CL2BC ...    36  0.76

>dbj|BAC28707.1| unnamed protein product [Mus musculus]
          Length = 470

 Score = 35.8 bits (81), Expect = 0.76
 Identities = 18/48 (37%), Positives = 25/48 (51%)
 Frame = -1

Query: 196 GHSILSCLFALKWASIVIFVKAMTVTSDFLFNSINRVRICKIFLFHLA 53
           G   L CL  L W+  ++FV   TV   +LF + N  +   IF+FH A
Sbjct: 44  GAFALLCLLGLTWSFGLLFVNEETVVMAYLFTAFNAFQGLFIFIFHCA 91

>pir||T17157 CL2AA protein - rat gi|3695123|gb|AAC62654.1| CL2AA [Rattus
            norvegicus]
          Length = 1452

 Score = 35.8 bits (81), Expect = 0.76
 Identities = 18/48 (37%), Positives = 25/48 (51%)
 Frame = -1

Query: 196  GHSILSCLFALKWASIVIFVKAMTVTSDFLFNSINRVRICKIFLFHLA 53
            G   L CL  L W+  ++FV   TV   +LF + N  +   IF+FH A
Sbjct: 1043 GAFALLCLLGLTWSFGLLFVNEETVVMAYLFTAFNAFQGLFIFIFHCA 1090

>pir||T46611 CL2BB protein - rat gi|3695131|gb|AAC62658.1| CL2BB [Rattus
            norvegicus]
          Length = 1435

 Score = 35.8 bits (81), Expect = 0.76
 Identities = 18/48 (37%), Positives = 25/48 (51%)
 Frame = -1

Query: 196  GHSILSCLFALKWASIVIFVKAMTVTSDFLFNSINRVRICKIFLFHLA 53
            G   L CL  L W+  ++FV   TV   +LF + N  +   IF+FH A
Sbjct: 1058 GAFALLCLLGLTWSFGLLFVNEETVVMAYLFTAFNAFQGLFIFIFHCA 1105

>pir||T17158 CL2AB protein - rat gi|3695125|gb|AAC62655.1| CL2AB [Rattus
            norvegicus]
          Length = 1420

 Score = 35.8 bits (81), Expect = 0.76
 Identities = 18/48 (37%), Positives = 25/48 (51%)
 Frame = -1

Query: 196  GHSILSCLFALKWASIVIFVKAMTVTSDFLFNSINRVRICKIFLFHLA 53
            G   L CL  L W+  ++FV   TV   +LF + N  +   IF+FH A
Sbjct: 1043 GAFALLCLLGLTWSFGLLFVNEETVVMAYLFTAFNAFQGLFIFIFHCA 1090

>pir||T17185 CL2BC protein - rat gi|3695133|gb|AAC62659.1| CL2BC [Rattus
            norvegicus]
          Length = 1478

 Score = 35.8 bits (81), Expect = 0.76
 Identities = 18/48 (37%), Positives = 25/48 (51%)
 Frame = -1

Query: 196  GHSILSCLFALKWASIVIFVKAMTVTSDFLFNSINRVRICKIFLFHLA 53
            G   L CL  L W+  ++FV   TV   +LF + N  +   IF+FH A
Sbjct: 1058 GAFALLCLLGLTWSFGLLFVNEETVVMAYLFTAFNAFQGLFIFIFHCA 1105

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 660,831,804
Number of Sequences: 1393205
Number of extensions: 13813981
Number of successful extensions: 33759
Number of sequences better than 10.0: 57
Number of HSP's better than 10.0 without gapping: 32568
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33754
length of database: 448,689,247
effective HSP length: 121
effective length of database: 280,111,442
effective search space used: 41176381974
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MPD082a11_f AV775359 1 538
2 SPDL095g09_f BP057989 49 617
3 MFB009h01_f BP034588 87 667
4 MFB090f10_f BP040593 101 641
5 SPDL046b07_f BP054862 174 725
6 MPD006a06_f AV770370 203 277
7 MPD026a05_f AV771748 257 729
8 SPDL043f03_f BP054720 265 577
9 SPDL051d04_f BP055213 270 820




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research