KMC000017A_c04
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000017A_C04 KMC000017A_c04
CATGAAGCATACATTTTTATTTAAAATCAAGCAACCGTTGGTGGGAGCTGGAAAAAAATG
CTCCAAAGTACAGATATTGGGATTTTAATACAAAATAAGGGAAAAAATGATCAATTAATT
GTGTTTTTTACATAAAGATAAATGAGTACAAATATATATTTGGCTCACATTTCTTCATTT
TTTCCATTCTCTCAAACGAAAACGGCTCAATTTCTTCTGGTGATGCTACTTCCATCTCCT
TCAATTCCACATGCTACTTCTGGCTCATGCTAATTTCGAATCCTCCTTCAATTCCTTCTT
CTGATGCTTGTTCCATCTCCTTCAATTCAACATGCTACTTCTGGCTGATGCTAATTTCTA
CTTCTCTTCAATTCCGGGAAATTCCTAGAAAAGAACAGAAAGTTCTCCAATGATATAAAA
CCACCACCCCTAAAATCTGTGGACGGATCCTTGGCTTGCCAATCCATTTCCTTCCACTGG
TCGGATATCAAGCCATGGAGTTTTTCTTCAGGAAATGCAGCATTCCATAAAGCCCTGCAA
AAATCTCTCCAGAAAAAATGTCTCAGTGTTATAAGGACACTCACCAGCATTCATGGTCCT
AAGTTAGTTAGCTAACTGCCAGAGAGGTGACGAAAATTCAATACTATTCGTATTTAAAAT
ATCCATTTCATACAGCTATTCACTTTGGTATTGTAATGAGAATCGTGAAAGAGGAACTCT
GGATGATCCTTCAAGAACCAGATCATGAAGGGCTGCAATAAGATCCCCAAAACAGCTTTA
CTGGTGAAGGAACCTTCTTCAGCAGCACAATTTCATCTGTCACAAGATTTCCACGCCTCA
TCCATGTnGGGCCTCATGTCTTTCTGTGGTTGCAAACAACGAAAGGGAAATTCCGCCACT
CATTTCATCATCCTCCATACAGAGAGAGATAGGGAC


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000017A_C04 KMC000017A_c04
         (936 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_567097.1| putative protein; protein id: At3g60260.1, supp...    99  9e-20
pir||T49221 hypothetical protein F27H5.50 - Arabidopsis thaliana...    99  9e-20
ref|NP_566027.1| expressed protein; protein id: At2g44770.1, sup...    98  2e-19
pir||T01604 hypothetical protein At2g44770 [imported] - Arabidop...    98  2e-19
gb|AAL06934.1| At2g44770/F16B22.26 [Arabidopsis thaliana] gi|179...    95  1e-18

>ref|NP_567097.1| putative protein; protein id: At3g60260.1, supported by cDNA:
           104796., supported by cDNA: gi_17473881, supported by
           cDNA: gi_20148670 [Arabidopsis thaliana]
           gi|17473882|gb|AAL38361.1| putative protein [Arabidopsis
           thaliana] gi|20148671|gb|AAM10226.1| putative protein
           [Arabidopsis thaliana] gi|21536589|gb|AAM60921.1|
           unknown [Arabidopsis thaliana]
          Length = 266

 Score = 99.0 bits (245), Expect = 9e-20
 Identities = 41/53 (77%), Positives = 47/53 (88%)
 Frame = -2

Query: 530 LWNAAFPEEKLHGLISDQWKEMDWQAKDPSTDFRGGGFISLENFLFFSRNFPE 372
           LW  AFPEE+LHG++SDQWKEM WQ KDPSTDFRGGGFISLEN L+F+R FP+
Sbjct: 94  LWKLAFPEEELHGIVSDQWKEMGWQGKDPSTDFRGGGFISLENLLYFARKFPK 146

>pir||T49221 hypothetical protein F27H5.50 - Arabidopsis thaliana
           gi|7576202|emb|CAB87863.1| putative protein [Arabidopsis
           thaliana]
          Length = 250

 Score = 99.0 bits (245), Expect = 9e-20
 Identities = 41/53 (77%), Positives = 47/53 (88%)
 Frame = -2

Query: 530 LWNAAFPEEKLHGLISDQWKEMDWQAKDPSTDFRGGGFISLENFLFFSRNFPE 372
           LW  AFPEE+LHG++SDQWKEM WQ KDPSTDFRGGGFISLEN L+F+R FP+
Sbjct: 94  LWKLAFPEEELHGIVSDQWKEMGWQGKDPSTDFRGGGFISLENLLYFARKFPK 146

>ref|NP_566027.1| expressed protein; protein id: At2g44770.1, supported by cDNA:
           36996., supported by cDNA: gi_15810013, supported by
           cDNA: gi_17981658 [Arabidopsis thaliana]
           gi|20197031|gb|AAC27479.2| expressed protein
           [Arabidopsis thaliana] gi|21593197|gb|AAM65146.1|
           unknown [Arabidopsis thaliana]
          Length = 266

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 42/53 (79%), Positives = 47/53 (88%)
 Frame = -2

Query: 536 RALWNAAFPEEKLHGLISDQWKEMDWQAKDPSTDFRGGGFISLENFLFFSRNF 378
           R LW  +FPEE+LHGLIS+QWKEM WQ KDPSTDFRGGGFISLEN L+F+RNF
Sbjct: 92  RELWKLSFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNF 144

>pir||T01604 hypothetical protein At2g44770 [imported] - Arabidopsis thaliana
          Length = 250

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 42/53 (79%), Positives = 47/53 (88%)
 Frame = -2

Query: 536 RALWNAAFPEEKLHGLISDQWKEMDWQAKDPSTDFRGGGFISLENFLFFSRNF 378
           R LW  +FPEE+LHGLIS+QWKEM WQ KDPSTDFRGGGFISLEN L+F+RNF
Sbjct: 92  RELWKLSFPEEELHGLISEQWKEMGWQGKDPSTDFRGGGFISLENLLYFARNF 144

>gb|AAL06934.1| At2g44770/F16B22.26 [Arabidopsis thaliana]
           gi|17981659|gb|AAL51113.1|AF458341_1 At2g44770/F16B22.26
           [Arabidopsis thaliana]
          Length = 266

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 41/53 (77%), Positives = 46/53 (86%)
 Frame = -2

Query: 536 RALWNAAFPEEKLHGLISDQWKEMDWQAKDPSTDFRGGGFISLENFLFFSRNF 378
           R LW  +FPEE+LHGLIS+QWKEM WQ KD STDFRGGGFISLEN L+F+RNF
Sbjct: 92  RELWKLSFPEEELHGLISEQWKEMGWQGKDQSTDFRGGGFISLENLLYFARNF 144

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 849,449,920
Number of Sequences: 1393205
Number of extensions: 19145116
Number of successful extensions: 43382
Number of sequences better than 10.0: 47
Number of HSP's better than 10.0 without gapping: 41458
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43350
length of database: 448,689,247
effective HSP length: 123
effective length of database: 277,325,032
effective search space used: 52137106016
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GNLf005d07 BP075962 1 496
2 GENLf076d02 BP066465 1 516
3 GNLf011h11 BP075492 2 454
4 GENLf044f08 BP064678 8 481
5 GENLf015b06 BP063130 432 939




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research