KMC000016A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000016A_C02 KMC000016A_c02
tggcttttagatttctacatgtatcaagatacagcTAAAAAAATAAATGAAACTCAAATA
AATGATCTAAGTGTCTGTACATGTGCACTGAGTCATCTTTCATTATAACTCAGACGTTCA
AAACAAATAAACAAACACTATCCTATGCTTAAATTGGGAAAAGAAAATAAAAAGAATATT
GCACAAGAAAACACAACTAGCAACCACAAGAAATAAACATGCCCTACAAAGTACATGGAG
TCACTAATTGCACCCACCTATAACAAATGAAAACAAAAAAATTTGAGAAAATAACCTTGG
GCAGGTGTGACAGAAGTGCCTGGACACCTGCCTGACATTGATCGCCTTTTGTCACGTGAC
TTGTGACGCGGCTTCATAACAAAACCCCTCTTGTTGATGAAACTCGAGGAGTGAAAATGA
ATAAACCCAGGCAACACACCAATATTAGCAGCCTGAGTTGGCAAAAATATACTATACACG
TGATGGCAAAGAAATTATATGCACAGCTTGGCACCTGCATCTTTGTGCGATGCCCGAGGG
ATAGCCACAATGGAGGAGCATCAGAAGCAATAATCACTGATTATGAGCATCACTCCGAG


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000016A_C02 KMC000016A_c02
         (599 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAB26278.2| integrin beta 5 subunit [Rattus sp.]                    33  2.1
gb|AAF03943.1|AF154920_1 putative adhesin MAA1 [Mycoplasma arthr...    32  6.2
ref|NP_570344.1| tail protein A [Cyanophage P60] gi|18478733|gb|...    32  8.2
gb|AAL70305.1| envelope glycoprotein; gp120 [Human immunodeficie...    32  8.2
gb|AAL70307.1| envelope glycoprotein; gp120 [Human immunodeficie...    32  8.2

>gb|AAB26278.2| integrin beta 5 subunit [Rattus sp.]
          Length = 200

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 15/36 (41%), Positives = 21/36 (57%)
 Frame = -2

Query: 505 CAYNFFAITCIVYFCQLRLLILVCCLGLFIFTPRVS 398
           CA+  + + C+V F    LL+LVC  GL   +P VS
Sbjct: 65  CAWCLWGVVCVVPFLPCCLLLLVCLCGLLAASPGVS 100

>gb|AAF03943.1|AF154920_1 putative adhesin MAA1 [Mycoplasma arthritidis]
          Length = 746

 Score = 32.0 bits (71), Expect = 6.2
 Identities = 23/66 (34%), Positives = 32/66 (47%), Gaps = 2/66 (3%)
 Frame = +3

Query: 381 KTPLVD-ETRGVKM-NKPRQHTNISSLSWQKYTIHVMAKKLYAQLGTCIFVRCPRDSHNG 554
           K  L+D E  G+ + NK R+  N + L  +K     + + +   L T  F   P D HNG
Sbjct: 474 KKVLIDLEKLGIDIHNKIREQNNQAPLEDKKAPSGTVEENIDPDLNTEGFKETPSDDHNG 533

Query: 555 GASEAI 572
           GAS  I
Sbjct: 534 GASSII 539

>ref|NP_570344.1| tail protein A [Cyanophage P60] gi|18478733|gb|AAL73282.1| tail
           protein A [Cyanophage P60]
          Length = 680

 Score = 31.6 bits (70), Expect = 8.2
 Identities = 25/77 (32%), Positives = 34/77 (43%)
 Frame = +3

Query: 345 PFVT*LVTRLHNKTPLVDETRGVKMNKPRQHTNISSLSWQKYTIHVMAKKLYAQLGTCIF 524
           P+VT L+T  +N +P  D  R           ++S   W       +  K+YA LGT  F
Sbjct: 244 PYVT-LLTPGNNTSPFPDTIR----------VDVSGEGWDIKVTKQIQSKVYANLGTAQF 292

Query: 525 VRCPRDSHNGGASEAII 575
              P D   GGAS + I
Sbjct: 293 T-TPVDQSGGGASTSDI 308

>gb|AAL70305.1| envelope glycoprotein; gp120 [Human immunodeficiency virus type 1]
          Length = 207

 Score = 31.6 bits (70), Expect = 8.2
 Identities = 24/65 (36%), Positives = 33/65 (49%), Gaps = 4/65 (6%)
 Frame = +3

Query: 402 TRGVKMNKPRQ-HTNISSLSWQKYTIHVMAKKLYAQLG---TCIFVRCPRDSHNGGASEA 569
           T G  +  PRQ H NIS   W K T+ ++ KKL  QLG   T IF     +  +GG  E 
Sbjct: 51  TTGDMIGDPRQAHCNISKAEWNK-TLILIVKKLREQLGSNKTIIF-----NQSSGGDPEI 104

Query: 570 IITDY 584
           ++  +
Sbjct: 105 VMHSF 109

>gb|AAL70307.1| envelope glycoprotein; gp120 [Human immunodeficiency virus type 1]
          Length = 206

 Score = 31.6 bits (70), Expect = 8.2
 Identities = 24/65 (36%), Positives = 33/65 (49%), Gaps = 4/65 (6%)
 Frame = +3

Query: 402 TRGVKMNKPRQ-HTNISSLSWQKYTIHVMAKKLYAQLG---TCIFVRCPRDSHNGGASEA 569
           T G  +  PRQ H NIS   W K T+ ++ KKL  QLG   T IF     +  +GG  E 
Sbjct: 50  TTGDMIGDPRQAHCNISKAEWNK-TLILIVKKLREQLGSNKTIIF-----NQSSGGDPEI 103

Query: 570 IITDY 584
           ++  +
Sbjct: 104 VMHSF 108

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 502,577,165
Number of Sequences: 1393205
Number of extensions: 10711093
Number of successful extensions: 26780
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 25914
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26749
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 23426109484
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 SPDL017h08_f BP053095 1 483
2 MPDL081h06_f AV780735 32 529
3 SPDL042d05_f BP054644 37 559
4 MPDL002a01_f AV776600 37 537
5 GENLf042a09 BP064539 38 567
6 MPDL031f05_f AV778046 38 599
7 MPDL079a04_f AV780564 57 557
8 GENLf004h06 BP062590 87 591
9 MRL039b07_f BP085625 103 458
10 MWM135e11_f AV766862 193 545




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research