KMC000015A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000015A_C02 KMC000015A_c02
tttttttAGTTTATAAGCTGCATGCTCTTCTTGGAGCATACTGTCAATCACTCGATTTTC
TTCTTTATTTGCGTGTTGAGACCAAAACGTATACAATACTTATAACTTTAACAAATATTC
CTCATCCTCAAATCTCCGTTCAAAGTGGCAGCACTGGAAGTTAAATGCCAAAAACTGAAT
AACAGAAATGAGAAAAGTTGAATTACATTTCTTTAGCAAGCGATGCAGGCACAACCATTC
ATTGCAGCCACCGAGTTCTTTGCTTGGTTTATTGATACAATAGCTGTGAATAGCATGGAT
TTTCTCCCCACATTGAACTGACCTTTGCTCCCAAACATGAGATTATTTCGACTGTTAAAA
ATCAGAGCCAGTGGGTGCTAGCAACTCACTTTGCAAACTTTTTAAATCTGATTCAATGTT
TAGCATTGATCAAGTTTCTGATGACATATTGCAAAATGCCTCCGTGATTGAAGTAAGCAA
GTTCAACCTCGGTATCAAATCTCAGGGTACATTGGAAAGATTTCCCATTATCTGTCACCA
CTGTGACATCTTGACCAGGTCGAATTTCATTCACACTGCTAGGAAGATCAATGGTGAAAC
GTTCATGGCCAGTCAATCCAAGAGTATCAGCATCCTCACCAGACTTGAAACACAGAGG


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000015A_C02 KMC000015A_c02
         (658 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|Q42669|ACOC_CUCMC Aconitase (Aconitate hydratase) (Citrate hy...   150  2e-35
gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thal...   143  2e-33
ref|NP_178634.1| cytoplasmic aconitate hydratase; protein id: At...   143  2e-33
sp|P49608|ACOC_CUCMA Aconitate hydratase, cytoplasmic (Citrate h...   139  3e-32
emb|CAA58046.1| aconitase [Arabidopsis thaliana]                      138  7e-32

>sp|Q42669|ACOC_CUCMC Aconitase (Aconitate hydratase) (Citrate hydro-lyase)
           gi|1084317|pir||S49849 aconitate hydratase (EC 4.2.1.3)
           - muskmelon (fragment) gi|599723|emb|CAA58047.1|
           aconitase [Cucumis melo]
          Length = 764

 Score =  150 bits (378), Expect = 2e-35
 Identities = 70/81 (86%), Positives = 76/81 (93%)
 Frame = -1

Query: 658 PLCFKSGEDADTLGLTGHERFTIDLPSSVNEIRPGQDVTVVTDNGKSFQCTLRFDTEVEL 479
           PLCFK+GEDAD+LGLTGHERFTIDLPS+V EIRPGQDV VVTD GKSF C LRFDTEVEL
Sbjct: 684 PLCFKAGEDADSLGLTGHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCILRFDTEVEL 743

Query: 478 AYFNHGGILQYVIRNLINAKH 416
           AYF+HGGILQYVIRNLI++KH
Sbjct: 744 AYFDHGGILQYVIRNLIHSKH 764

>gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
          Length = 990

 Score =  143 bits (360), Expect = 2e-33
 Identities = 66/76 (86%), Positives = 71/76 (92%)
 Frame = -1

Query: 658  PLCFKSGEDADTLGLTGHERFTIDLPSSVNEIRPGQDVTVVTDNGKSFQCTLRFDTEVEL 479
            PLCFKSGEDADTLGLTGHER+TI LP+ ++EIRPGQDVTV TDNGKSF CT+RFDTEVEL
Sbjct: 912  PLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVEL 971

Query: 478  AYFNHGGILQYVIRNL 431
            AYFNHGGIL YVIRNL
Sbjct: 972  AYFNHGGILPYVIRNL 987

>ref|NP_178634.1| cytoplasmic aconitate hydratase; protein id: At2g05710.1 [Arabidopsis
            thaliana] gi|25291948|pir||B84471 cytoplasmic aconitate
            hydratase [imported] - Arabidopsis thaliana
            gi|4586021|gb|AAD25640.1| cytoplasmic aconitate hydratase
            [Arabidopsis thaliana]
          Length = 898

 Score =  143 bits (360), Expect = 2e-33
 Identities = 66/76 (86%), Positives = 71/76 (92%)
 Frame = -1

Query: 658  PLCFKSGEDADTLGLTGHERFTIDLPSSVNEIRPGQDVTVVTDNGKSFQCTLRFDTEVEL 479
            PLCFKSGEDADTLGLTGHER+TI LP+ ++EIRPGQDVTV TDNGKSF CT+RFDTEVEL
Sbjct: 820  PLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVEL 879

Query: 478  AYFNHGGILQYVIRNL 431
            AYFNHGGIL YVIRNL
Sbjct: 880  AYFNHGGILPYVIRNL 895

>sp|P49608|ACOC_CUCMA Aconitate hydratase, cytoplasmic (Citrate hydro-lyase) (Aconitase)
            gi|7437043|pir||T10101 aconitate hydratase (EC 4.2.1.3) -
            cucurbit gi|868003|dbj|BAA06108.1| aconitase [Cucurbita
            cv. Kurokawa Amakuri]
          Length = 898

 Score =  139 bits (350), Expect = 3e-32
 Identities = 64/77 (83%), Positives = 72/77 (93%)
 Frame = -1

Query: 658  PLCFKSGEDADTLGLTGHERFTIDLPSSVNEIRPGQDVTVVTDNGKSFQCTLRFDTEVEL 479
            PLCFKSGEDAD+LGLTGHER+TIDLP  +++IRPGQDVTV TD+GKSF CT+RFDTEVEL
Sbjct: 820  PLCFKSGEDADSLGLTGHERYTIDLPDDISKIRPGQDVTVTTDSGKSFTCTVRFDTEVEL 879

Query: 478  AYFNHGGILQYVIRNLI 428
            AYFN+GGIL YVIRNLI
Sbjct: 880  AYFNNGGILPYVIRNLI 896

>emb|CAA58046.1| aconitase [Arabidopsis thaliana]
          Length = 919

 Score =  138 bits (347), Expect = 7e-32
 Identities = 64/77 (83%), Positives = 74/77 (95%)
 Frame = -1

Query: 658  PLCFKSGEDADTLGLTGHERFTIDLPSSVNEIRPGQDVTVVTDNGKSFQCTLRFDTEVEL 479
            PLCFK+GEDA+TLGLTG E +TI+LP++V+EI+PGQDVTVVT+NGKSF CTLRFDTEVEL
Sbjct: 841  PLCFKAGEDAETLGLTGQELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVEL 900

Query: 478  AYFNHGGILQYVIRNLI 428
            AYF+HGGILQYVIRNLI
Sbjct: 901  AYFDHGGILQYVIRNLI 917

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 525,229,945
Number of Sequences: 1393205
Number of extensions: 10711988
Number of successful extensions: 26862
Number of sequences better than 10.0: 157
Number of HSP's better than 10.0 without gapping: 25787
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26786
length of database: 448,689,247
effective HSP length: 119
effective length of database: 282,897,852
effective search space used: 28006887348
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 SPDL041h11_f BP054615 1 324
2 MRL013g10_f BP084400 10 339
3 MPDL029e07_f AV777949 17 409
4 MRL011g08_f BP084282 17 402
5 GENLf055h09 BP065310 17 519
6 GENLf014c09 BP063076 17 517
7 GENLf021e10 BP063464 19 518
8 GENLf001f11 BP062435 21 590
9 SPDL093e05_f BP057844 21 549
10 MPDL075d06_f AV780362 22 506
11 GENLf009e06 BP062827 22 510
12 MFBL049a01_f BP043743 22 500
13 MPDL016a10_f AV777291 22 592
14 MPDL003c10_f AV776668 22 592
15 MWL074g06_f AV769920 22 486
16 GENLf054f05 BP065237 22 516
17 MRL035g04_f BP085458 22 394
18 GENLf076b03 BP066449 22 519
19 MRL041a02_f BP085690 23 519
20 GENLf001e10 BP062427 24 591
21 GENLf075g08 BP066431 24 426
22 GENLf085a06 BP066955 24 518
23 MRL016e05_f BP084534 25 497
24 MRL044g02_f BP085874 25 371
25 SPDL001f05_f BP052059 27 549
26 SPDL067b03_f BP056140 27 519
27 MFL022e09_f BP033913 31 506
28 GENLf028h09 BP063852 35 152
29 MRL003a07_f BP083832 46 429
30 GENLf092b05 BP067356 46 546
31 MRL034a05_f BP085373 52 519
32 MPDL013f12_f AV777195 57 397
33 SPDL063d04_f BP055906 63 672
34 MFBL045d05_f BP043550 71 549
35 MF025g04_f BP029599 71 561
36 MF025h04_f BP029604 71 519
37 GNf012c01 BP068225 79 144
38 SPDL005b02_f BP052265 87 642
39 SPDL063d03_f BP055905 89 633
40 SPDL083a10_f BP057162 90 633
41 MRL020h11_f BP084766 93 552
42 SPDL060g12_f BP055771 95 588
43 SPDL002g08_f BP052132 105 592
44 MFL004a11_f BP033584 105 607
45 MPDL001f08_f AV776584 105 648
46 MFBL028g04_f BP042679 105 256
47 GENLf030b08 BP063908 105 593
48 GENLf079c07 BP066634 105 593
49 SPDL023a04_f BP053406 105 545
50 MPDL013f08_f AV777194 105 547
51 GENLf083d03 BP066870 105 620
52 SPDL011c02_f BP052651 105 620
53 MF042f04_f BP030502 112 645
54 SPDL031a04_f BP053910 115 592
55 GENLf055a09 BP065262 121 426
56 SPDL063d09_f BP055910 122 658
57 MF044a07_f BP030590 123 673
58 SPDL012a07_f BP052702 123 619
59 MF050e04_f BP030935 124 629
60 MWL036d06_f AV769180 124 496
61 SPDL088h10_f BP057559 129 660
62 MWM078b01_f AV765974 152 414
63 MPDL002a03_f AV776601 155 475
64 MPDL012a05_f AV777115 171 530
65 MFL021h07_f BP033904 195 592




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research