KMC000014A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000014A_C01 KMC000014A_c01
ggtaacatgttcaagtgtaaaattctctggaagactgaaggtaaaactgcaggtattaga
cccctacctggacttcacaaAAGCTTTACAGTACCAGATTTATCCTTTTTTATTCAGCAT
GGTTTATTCTTAACCGTACCCCTATATGATAAATATnGGCCCAAAACTTGAACGAAAACA
AGACATTAGAAGAACTACTGCCCTGCATATCTAACACAATCACATTAAACATATACATAA
CTGCATAAGCTTCCATGAAGCTCCTCTAGTTCGGCAGAACAATATTTTACAACACAAGCA
GACTTTTATACACAAAGAAAACTACTCTTTATnGTCTGCTGTGGTTCCTTGGTGAAAATA
CATGGCCAGAGACACCAGCTGGTTAACTTGCATCATCCTTTGCAAGTGGAACAGAATTTG
CCAAATCACGAAACTTAAGGATATAGAACATCTCAAGATATCGTCGAGTTTCACGCCTCT
CTAATTCGGAAACATGTTTCCAGAAGCCATAAACTCCCGCCAAAGTCATAAGCCTTTCAG
AATATATCTTCCATGTATACCTTTCATAAATTCTTTGAAGACCGnCATCAGATATTTTAT
TCCAATGGCTTGGATCCTCCTTGCATCGTTGGAAGAATTCAAnCAATAGGTTTGAAGCTT
GGTCAGGGTGATAAGGATCAATATGGAA


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000014A_C01 KMC000014A_c01
         (688 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|O24301|SUS2_PEA Sucrose synthase 2 (Sucrose-UDP glucosyltrans...   192  5e-48
dbj|BAB20799.1| sucrose synthase 1 [Pyrus pyrifolia]                  184  1e-45
ref|NP_192137.1| sucrose synthase, putative; protein id: At4g022...   183  2e-45
dbj|BAA88904.1| sucrose synthase [Citrus unshiu]                      181  1e-44
gb|AAM22755.1| sucrose synthase [Deschampsia antarctica]              180  1e-44

>sp|O24301|SUS2_PEA Sucrose synthase 2 (Sucrose-UDP glucosyltransferase 2)
            gi|7433834|pir||T06497 probable sucrose synthase (EC
            2.4.1.13) 2 - garden pea gi|2570067|emb|CAA04512.1|
            second sucrose synthase [Pisum sativum]
          Length = 809

 Score =  192 bits (487), Expect = 5e-48
 Identities = 87/97 (89%), Positives = 93/97 (95%)
 Frame = -1

Query: 688  FHIDPYHPDQASNLLXEFFQRCKEDPSHWNKISDXGLQRIYERYTWKIYSERLMTLAGVY 509
            FHIDPYHPDQAS LL +FFQRCKEDP+HWNK+SD GLQRIYERYTWKIYSERLMTLAGVY
Sbjct: 712  FHIDPYHPDQASELLVDFFQRCKEDPNHWNKVSDGGLQRIYERYTWKIYSERLMTLAGVY 771

Query: 508  GFWKHVSELERRETRRYLEMFYILKFRDLANSVPLAK 398
             FWK+VS+LERRETRRYLEMFYILKFRDLANSVP+AK
Sbjct: 772  SFWKYVSKLERRETRRYLEMFYILKFRDLANSVPIAK 808

>dbj|BAB20799.1| sucrose synthase 1 [Pyrus pyrifolia]
          Length = 812

 Score =  184 bits (466), Expect = 1e-45
 Identities = 84/100 (84%), Positives = 93/100 (93%)
 Frame = -1

Query: 688  FHIDPYHPDQASNLLXEFFQRCKEDPSHWNKISDXGLQRIYERYTWKIYSERLMTLAGVY 509
            FHIDPYHP++A+ L+ +FFQRCKEDPS+WN ISD GLQRIYE+YTWKIYSERLMTLAGVY
Sbjct: 712  FHIDPYHPEKAAALMADFFQRCKEDPSYWNTISDAGLQRIYEKYTWKIYSERLMTLAGVY 771

Query: 508  GFWKHVSELERRETRRYLEMFYILKFRDLANSVPLAKDDA 389
            GFWK+VS+LERRETRRYLEMFYILKFRDLA SVP A DDA
Sbjct: 772  GFWKYVSKLERRETRRYLEMFYILKFRDLAKSVPEAIDDA 811

>ref|NP_192137.1| sucrose synthase, putative; protein id: At4g02280.1, supported by
            cDNA: gi_15293134, supported by cDNA: gi_15982720
            [Arabidopsis thaliana] gi|25286731|pir||B85029 probable
            sucrose synthetase [imported] - Arabidopsis thaliana
            gi|7268988|emb|CAB80721.1| putative sucrose synthetase
            [Arabidopsis thaliana] gi|15293135|gb|AAK93678.1|
            putative sucrose synthetase [Arabidopsis thaliana]
            gi|15982721|gb|AAL09730.1| AT4g02280/T2H3_8 [Arabidopsis
            thaliana] gi|23296413|gb|AAN13112.1| putative sucrose
            synthetase [Arabidopsis thaliana]
          Length = 809

 Score =  183 bits (465), Expect = 2e-45
 Identities = 80/99 (80%), Positives = 90/99 (90%)
 Frame = -1

Query: 688  FHIDPYHPDQASNLLXEFFQRCKEDPSHWNKISDXGLQRIYERYTWKIYSERLMTLAGVY 509
            FHIDPYHP+QA N++ +FF+RCKEDP+HW K+SD GLQRIYERYTWKIYSERLMTLAGVY
Sbjct: 711  FHIDPYHPEQAGNIMADFFERCKEDPNHWKKVSDAGLQRIYERYTWKIYSERLMTLAGVY 770

Query: 508  GFWKHVSELERRETRRYLEMFYILKFRDLANSVPLAKDD 392
            GFWK+VS+LERRETRRYLEMFYILKFRDL  +VP   DD
Sbjct: 771  GFWKYVSKLERRETRRYLEMFYILKFRDLVKTVPSTADD 809

>dbj|BAA88904.1| sucrose synthase [Citrus unshiu]
          Length = 811

 Score =  181 bits (458), Expect = 1e-44
 Identities = 81/99 (81%), Positives = 91/99 (91%)
 Frame = -1

Query: 688  FHIDPYHPDQASNLLXEFFQRCKEDPSHWNKISDXGLQRIYERYTWKIYSERLMTLAGVY 509
            FHIDPYHPDQA+ L+ +FF +CKE+PSHW KISD GL+RIYERYTWKIYSERLMTLAGVY
Sbjct: 711  FHIDPYHPDQAAELMADFFGKCKENPSHWKKISDGGLKRIYERYTWKIYSERLMTLAGVY 770

Query: 508  GFWKHVSELERRETRRYLEMFYILKFRDLANSVPLAKDD 392
            GFWK+VS+LERRETRRYLEMFYILKFRDL  SVPLA ++
Sbjct: 771  GFWKYVSKLERRETRRYLEMFYILKFRDLVKSVPLASEN 809

>gb|AAM22755.1| sucrose synthase [Deschampsia antarctica]
          Length = 159

 Score =  180 bits (457), Expect = 1e-44
 Identities = 80/100 (80%), Positives = 93/100 (93%)
 Frame = -1

Query: 688 FHIDPYHPDQASNLLXEFFQRCKEDPSHWNKISDXGLQRIYERYTWKIYSERLMTLAGVY 509
           FHIDPYHPDQA+ L+ +FF++CK+DP+HW KISD GLQRIY++YTWKIYSERLMTLAGVY
Sbjct: 59  FHIDPYHPDQAATLMVDFFEQCKQDPNHWVKISDRGLQRIYDKYTWKIYSERLMTLAGVY 118

Query: 508 GFWKHVSELERRETRRYLEMFYILKFRDLANSVPLAKDDA 389
           GFWK+VS+LERRETRRYLEMFYILKFR+L  SVPLA D+A
Sbjct: 119 GFWKYVSKLERRETRRYLEMFYILKFRELVKSVPLALDEA 158

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 569,301,845
Number of Sequences: 1393205
Number of extensions: 11910511
Number of successful extensions: 27197
Number of sequences better than 10.0: 107
Number of HSP's better than 10.0 without gapping: 26482
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27165
length of database: 448,689,247
effective HSP length: 119
effective length of database: 282,897,852
effective search space used: 30835865868
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf037a10 BP064260 1 512
2 GENLf001e09 BP062426 128 688




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research