KMC000013A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000013A_C01 KMC000013A_c01
caaacatacattccagaacacactaatcatgccagaacgtaattgacagctcagagggtg
gaagtgTAAGCAAGTCAGTATCAAATTCTAAACAAGAGAGTTTACAGAAAAGAAACAGAT
AAAAGATTACAATAGAAATCTGACAGAAAATGAACATCATATTTCATAAAAATGGTCTAT
GTACAGCATGTGTCAACATTATTGCAGAAGTGAAAACTTATCACAAGATGCTGTAACTAC
TCATCGAGCCAACCCGCTGAATTCCTATGCGCATATGCATGATAAGGACCAGGTGCAAAA
CCCCTACGCACATCACCCCATCCATGTTGGGGCACACTAATACTCAGGTTCACGAGTGCC
ATTTTCCGGAACTCCACGAGAACCACCGAGTTGCCTTATCTTTGATTCTCTCTGGTTCTT
CTCTTCCTCCTGGCTCCTACAGTGACTAACCCCATGTTCAAAAAGTGGCACTTTCTCACG
GGTTCTTCCAATATCTGAAATGGGTTGCAAGCTTTCAACTGAGGATTTCCCATCAATTTG
ACTGGGTTGACAGTGGTCAGGTCCTGCCTCAGGCTTTTCATGTTCAGGAG


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000013A_C01 KMC000013A_c01
         (590 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_703411.1| hypothetical protein [Plasmodium falciparum 3D7...    37  0.19
ref|NP_004547.1| nuclear factor of kappa light polypeptide gene ...    35  0.54
ref|NP_701989.1| hypothetical protein [Plasmodium falciparum 3D7...    35  0.71
ref|XP_237064.1| similar to RIKEN cDNA 2010300C02 gene [Mus musc...    35  0.71
ref|NP_681078.1| ORF_ID:tll0287~unknown protein [Thermosynechoco...    32  7.9

>ref|NP_703411.1| hypothetical protein [Plasmodium falciparum 3D7]
            gi|23504551|emb|CAD51431.1| hypothetical protein
            [Plasmodium falciparum 3D7]
          Length = 3008

 Score = 37.0 bits (84), Expect = 0.19
 Identities = 24/67 (35%), Positives = 34/67 (49%)
 Frame = +2

Query: 62   KCKQVSIKF*TREFTEKKQIKDYNRNLTENEHHIS*KWSMYSMCQHYCRSENLSQDAVTT 241
            KC+ +SIK      TEK +IKD N N   N  H    +  Y++  H    +N+++  VTT
Sbjct: 2224 KCESLSIK---ESHTEKDEIKDDNNNNNNNNKH----YGYYNIDDH----KNINKQEVTT 2272

Query: 242  HRANPLN 262
              AN  N
Sbjct: 2273 QDANSSN 2279

>ref|NP_004547.1| nuclear factor of kappa light polypeptide gene enhancer in B-cells
           inhibitor, epsilon [Homo sapiens]
           gi|1934601|gb|AAC51216.1| I kappa B epsilon [Homo
           sapiens]
          Length = 500

 Score = 35.4 bits (80), Expect = 0.54
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 2/78 (2%)
 Frame = -3

Query: 588 PEHEKPEAGPDHCQPSQIDGKSSVESLQPISDIGRTREKVPLFEHGVSHCRS--QEEEKN 415
           P   +P AG   CQ     GK++  SL+P  D  +T  + P    G+S  R    E E++
Sbjct: 97  PGRRRPRAGRPLCQADPQPGKAARRSLEP--DPAQTGPR-PARAAGMSEARKGPDEAEES 153

Query: 414 QRESKIRQLGGSRGVPEN 361
           Q +S I  L   R +PE+
Sbjct: 154 QYDSGIESLRSLRSLPES 171

>ref|NP_701989.1| hypothetical protein [Plasmodium falciparum 3D7]
            gi|23497165|gb|AAN36713.1|AE014817_36 hypothetical
            protein [Plasmodium falciparum 3D7]
          Length = 4405

 Score = 35.0 bits (79), Expect = 0.71
 Identities = 18/50 (36%), Positives = 27/50 (54%)
 Frame = +2

Query: 122  KDYNRNLTENEHHIS*KWSMYSMCQHYCRSENLSQDAVTTHRANPLNSYA 271
            K+YN ++ EN+ +IS K S Y M   Y  S N S D+  +   N  N ++
Sbjct: 2556 KEYNNSIIENKENISSKSSSYDMYDSYSISSNGSSDSNLSSDMNEFNFFS 2605

>ref|XP_237064.1| similar to RIKEN cDNA 2010300C02 gene [Mus musculus] [Rattus
           norvegicus]
          Length = 1237

 Score = 35.0 bits (79), Expect = 0.71
 Identities = 17/65 (26%), Positives = 31/65 (47%)
 Frame = -3

Query: 561 PDHCQPSQIDGKSSVESLQPISDIGRTREKVPLFEHGVSHCRSQEEEKNQRESKIRQLGG 382
           PDH   + +  ++   SL P+ D     E     ++  +  +   + +NQR SK+R+L  
Sbjct: 283 PDHMSDASVSSRTLDGSLAPVVDFSHPPEFSSCLDNSAAKHKLLVKPRNQRSSKLRRLSS 342

Query: 381 SRGVP 367
             G+P
Sbjct: 343 VIGLP 347

>ref|NP_681078.1| ORF_ID:tll0287~unknown protein [Thermosynechococcus elongatus BP-1]
           gi|22294008|dbj|BAC07840.1| ORF_ID:tll0287~unknown
           protein [Thermosynechococcus elongatus BP-1]
          Length = 191

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 15/65 (23%), Positives = 27/65 (41%)
 Frame = +2

Query: 56  GWKCKQVSIKF*TREFTEKKQIKDYNRNLTENEHHIS*KWSMYSMCQHYCRSENLSQDAV 235
           GW+ +QV++K+       +  +     N  +N HH+   W       HY R  ++    +
Sbjct: 83  GWQVRQVALKYRNPNHAPRTALDVQALNQFDNNHHLQAFWQTDKEGVHYFRRIDVQASCL 142

Query: 236 TTHRA 250
             H A
Sbjct: 143 ACHGA 147

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 525,693,833
Number of Sequences: 1393205
Number of extensions: 11377705
Number of successful extensions: 29280
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 28181
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29258
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 22569056698
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf001e04 BP062425 1 520
2 GENLf015e05 BP063157 50 595
3 MRL014g11_f BP084447 141 465




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research