KMC000012A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000012A_C01 KMC000012A_c01
ATTTAAACACTGATTAAGTTCATTATTAAGGAACAAGGAATATGCATGCTTCTTTTTTAT
TGGGGAGTACTAGGTGGAGAGTGGAGACCCTTTTTTTCAGCCACTAGTCTTCCACTTCAA
AATACAGATTAAAGAAGCTATTGCTAATATTTTACACTGGTTCCCTATTTCCTGCAAAAT
CTAATTACTTACAAATTACAATCTATAGCTAACTAATGAAGGTGGTGCTTCCCTTGGTGA
TCCAAAATTCATGTTCCAACAACTTATTTTTCCTCTGAACCAATTCTGTTACTCAAATGC
TACTCGGAGAAGTTTTTCTCCAGAATTGATTTAGACTTTTAGAATCAATTGTAGGAACTT
CATTTGTCGTTCAATTCTATTTTCTTTCCACTTCCATCTTTGCTGATAACAATTCCAACC
AATTTACAAGGCTCAGCATCCTCAAGCTGTTGAACCACAGCTCTCATGGTGGGTCTTAAA
GCTGGAAGTGTTGCAGTGCAGAGAACTGCAGTTCTTAACACCATGCAAGCTTCCTCCTTA
TACATCTCTGGGATTCTGCAGTCCAC


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000012A_C01 KMC000012A_c01
         (566 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAL12626.1| leucine-rich repeat receptor-like kinase F21M12.3...    85  5e-16
pir||B86234 hypothetical protein [imported] - Arabidopsis thalia...    85  5e-16
ref|NP_172468.2| leucine-rich repeat transmembrane protein kinas...    85  5e-16
ref|NP_177363.1| leucine-rich repeat transmembrane protein kinas...    50  3e-05
gb|AAC36318.1| leucine-rich receptor-like protein kinase [Malus ...    47  2e-04

>gb|AAL12626.1| leucine-rich repeat receptor-like kinase F21M12.36 [Arabidopsis
            thaliana]
          Length = 977

 Score = 85.1 bits (209), Expect = 5e-16
 Identities = 40/66 (60%), Positives = 53/66 (79%)
 Frame = -1

Query: 566  VDCRIPEMYKEEACMVLRTAVLCTATLPALRPTMRAVVQQLEDAEPCKLVGIVISKDGSG 387
            VD +I EMY+E+A  +LR A++CTA LP LRPTMR+VVQ +EDAEPC+L+GIVISK+   
Sbjct: 912  VDKKIGEMYREDAVKMLRIAIICTARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKESDV 971

Query: 386  KKIELN 369
            K  E++
Sbjct: 972  KVKEIS 977

>pir||B86234 hypothetical protein [imported] - Arabidopsis thaliana
            gi|2160189|gb|AAB60752.1| Similar to A. thaliana
            receptor-like protein kinase (gb|RLK5_ARATH). ESTs
            gb|ATTS0475,gb|ATTS4362 come from this gene. [Arabidopsis
            thaliana]
          Length = 921

 Score = 85.1 bits (209), Expect = 5e-16
 Identities = 40/66 (60%), Positives = 53/66 (79%)
 Frame = -1

Query: 566  VDCRIPEMYKEEACMVLRTAVLCTATLPALRPTMRAVVQQLEDAEPCKLVGIVISKDGSG 387
            VD +I EMY+E+A  +LR A++CTA LP LRPTMR+VVQ +EDAEPC+L+GIVISK+   
Sbjct: 856  VDKKIGEMYREDAVKMLRIAIICTARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKESDV 915

Query: 386  KKIELN 369
            K  E++
Sbjct: 916  KVKEIS 921

>ref|NP_172468.2| leucine-rich repeat transmembrane protein kinase, putative; protein
            id: At1g09970.1, supported by cDNA: gi_17065207
            [Arabidopsis thaliana] gi|17065208|gb|AAL32758.1| Unknown
            protein [Arabidopsis thaliana]
          Length = 976

 Score = 85.1 bits (209), Expect = 5e-16
 Identities = 40/66 (60%), Positives = 53/66 (79%)
 Frame = -1

Query: 566  VDCRIPEMYKEEACMVLRTAVLCTATLPALRPTMRAVVQQLEDAEPCKLVGIVISKDGSG 387
            VD +I EMY+E+A  +LR A++CTA LP LRPTMR+VVQ +EDAEPC+L+GIVISK+   
Sbjct: 911  VDKKIGEMYREDAVKMLRIAIICTARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKESDV 970

Query: 386  KKIELN 369
            K  E++
Sbjct: 971  KVKEIS 976

>ref|NP_177363.1| leucine-rich repeat transmembrane protein kinase, putative; protein
            id: At1g72180.1 [Arabidopsis thaliana]
            gi|25406152|pir||C96745 hypothetical protein T9N14.3
            [imported] - Arabidopsis thaliana
            gi|12323667|gb|AAG51800.1|AC067754_16 leucine-rich
            receptor-like protein kinase, putative; 28019-31149
            [Arabidopsis thaliana]
          Length = 977

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 27/62 (43%), Positives = 42/62 (67%), Gaps = 1/62 (1%)
 Frame = -1

Query: 566  VDCRIPEMYKEEACM-VLRTAVLCTATLPALRPTMRAVVQQLEDAEPCKLVGIVISKDGS 390
            +D ++   Y EE+ + VL+  +LCT  LP LRP+MR VV++L+DA+PC    +  S+D +
Sbjct: 917  LDKQVLSTYIEESMIRVLKMGLLCTTKLPNLRPSMREVVRKLDDADPC----VSNSQDTT 972

Query: 389  GK 384
            GK
Sbjct: 973  GK 974

>gb|AAC36318.1| leucine-rich receptor-like protein kinase [Malus x domestica]
          Length = 999

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 21/43 (48%), Positives = 29/43 (66%)
 Frame = -1

Query: 566  VDCRIPEMYKEEACMVLRTAVLCTATLPALRPTMRAVVQQLED 438
            VD ++   YKEE C VL   +LCT+ LP  RP+MR VV+ L++
Sbjct: 926  VDPKLESCYKEEVCKVLNIGLLCTSPLPINRPSMRRVVKLLQE 968

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 467,592,311
Number of Sequences: 1393205
Number of extensions: 9349417
Number of successful extensions: 21261
Number of sequences better than 10.0: 160
Number of HSP's better than 10.0 without gapping: 20800
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21258
length of database: 448,689,247
effective HSP length: 116
effective length of database: 287,077,467
effective search space used: 20669577624
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MRL031f05_f BP085266 1 506
2 GNLf016a01 BP075716 26 543
3 MF008c01_f BP028630 26 485
4 MRL002c10_f BP083790 26 414
5 MRL001b10_f BP083709 26 505
6 SPDL085h10_f BP057364 28 511
7 MRL027g08_f BP085107 50 268
8 GENLf054f10 BP065240 54 546
9 GNf095h03 BP074440 54 438
10 MF087b04_f BP032858 54 605
11 GENLf001e03 BP062424 54 527
12 GENLf074a05 BP066324 55 470
13 MRL026h10_f BP085077 56 527
14 MR011a06_f BP076753 71 228
15 GNLf002f10 BP074918 104 168




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research