KMC000011A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000011A_C01 KMC000011A_c01
aacgaacaagtactgttCTCTTCAAAACAAATAAACAAAAGAACCAGGCCTCCAGGACAA
TCATGAACCCAAATCATAGTTCTAACTATTCACATGACAAAAAATTGCCACCGGATTCTC
ATGGATAAAGAAAACGGGGGTTTATCCAAATAACTAATTGAATCTAGAAGGAATACAGAC
CGAAAAGTTTATAAATATTATGCAGCCATGTTAAGCTTCAGGGTGAAGACATACCCAGGG
GCAGTGATAAAAAACATCAGTTCAGCATAAAAGGTGGAACATACAACAGTCACCAGTTCA
TGATTTGGACCTCAAAGCAAGCCCGGTCTCTACCCTTTTTATTTCAAAGATAAGCATCCT
CCACATCTTGAGAACGAACATTTCAGCTTCCTCATCTAAAATGATCTGAAGACGCTCAAG
CATTGGGGACGCTTTCACATGTTCTTGTGTACTGGAAACAATATAATCGATCAATGTATT
TTCTTCTTCCCCCAAAAACTCTTGGATTTTCTTAGAAATCCACGGTCTCATTCTTTCATG
CAACTGATGCTTGTCATACACTGTCCAGTCTATCTCATATGAAAACAACTCCTCCTTGGT
CTTTGGTATCATATCAATTAACTGTTTTGCATCCAAAAGCCTCCTGTTATCATGAGTTTT
AGATTTCTCA


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000011A_C01 KMC000011A_c01
         (670 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAL66981.1| unknown protein [Arabidopsis thaliana] gi|2505501...   189  4e-47
ref|NP_176226.2| RRM-containing protein; protein id: At1g60200.1...   189  4e-47
gb|AAM22757.1| unknown [Deschampsia antarctica]                       183  2e-45
pir||T02272 hypothetical protein T13D8.9 - Arabidopsis thaliana ...   175  6e-43
dbj|BAC40049.1| unnamed protein product [Mus musculus]                112  6e-24

>gb|AAL66981.1| unknown protein [Arabidopsis thaliana] gi|25055015|gb|AAN71971.1|
            unknown protein [Arabidopsis thaliana]
          Length = 899

 Score =  189 bits (479), Expect = 4e-47
 Identities = 93/122 (76%), Positives = 108/122 (88%)
 Frame = -2

Query: 666  KSKTHDNRRLLDAKQLIDMIPKTKEELFSYEIDWTVYDKHQLHERMRPWISKKIQEFLGE 487
            K+K  D +  LDAKQLID IPKTKE+LFSYEI+W +YDKHQ+HERMRPWISKKI EFLGE
Sbjct: 779  KAKIIDTK-FLDAKQLIDTIPKTKEDLFSYEINWAMYDKHQVHERMRPWISKKIMEFLGE 837

Query: 486  EENTLIDYIVSSTQEHVKASPMLERLQIILDEEAEMFVLKMWRMLIFEIKRVETGLALRS 307
            EE TL+D+IVS+TQ+HV+AS MLE LQ ILDEEAEMFVLKMWRMLIFEIKRVE G+ ++S
Sbjct: 838  EEATLVDFIVSNTQQHVQASQMLELLQSILDEEAEMFVLKMWRMLIFEIKRVEAGVPVKS 897

Query: 306  KS 301
            K+
Sbjct: 898  KA 899

>ref|NP_176226.2| RRM-containing protein; protein id: At1g60200.1 [Arabidopsis
           thaliana]
          Length = 750

 Score =  189 bits (479), Expect = 4e-47
 Identities = 93/122 (76%), Positives = 108/122 (88%)
 Frame = -2

Query: 666 KSKTHDNRRLLDAKQLIDMIPKTKEELFSYEIDWTVYDKHQLHERMRPWISKKIQEFLGE 487
           K+K  D +  LDAKQLID IPKTKE+LFSYEI+W +YDKHQ+HERMRPWISKKI EFLGE
Sbjct: 630 KAKIIDTK-FLDAKQLIDTIPKTKEDLFSYEINWAMYDKHQVHERMRPWISKKIMEFLGE 688

Query: 486 EENTLIDYIVSSTQEHVKASPMLERLQIILDEEAEMFVLKMWRMLIFEIKRVETGLALRS 307
           EE TL+D+IVS+TQ+HV+AS MLE LQ ILDEEAEMFVLKMWRMLIFEIKRVE G+ ++S
Sbjct: 689 EEATLVDFIVSNTQQHVQASQMLELLQSILDEEAEMFVLKMWRMLIFEIKRVEAGVPVKS 748

Query: 306 KS 301
           K+
Sbjct: 749 KA 750

>gb|AAM22757.1| unknown [Deschampsia antarctica]
          Length = 192

 Score =  183 bits (464), Expect = 2e-45
 Identities = 86/117 (73%), Positives = 105/117 (89%)
 Frame = -2

Query: 651 DNRRLLDAKQLIDMIPKTKEELFSYEIDWTVYDKHQLHERMRPWISKKIQEFLGEEENTL 472
           +N+++ DAKQLIDMIP+TKE+LFSY+I+W +Y+KH+LHERMRPWISKKI EFLGEEE+TL
Sbjct: 76  ENKKIADAKQLIDMIPRTKEDLFSYDINWAIYEKHELHERMRPWISKKIIEFLGEEESTL 135

Query: 471 IDYIVSSTQEHVKASPMLERLQIILDEEAEMFVLKMWRMLIFEIKRVETGLALRSKS 301
           ++YIVS T++HV AS MLE LQ ILD EAEMFVLKMWRMLIFEIK+VE GL+ R K+
Sbjct: 136 VEYIVSCTKDHVHASKMLELLQSILDVEAEMFVLKMWRMLIFEIKKVEAGLSGRGKA 192

>pir||T02272 hypothetical protein T13D8.9 - Arabidopsis thaliana
            gi|3249070|gb|AAC24054.1| Contains similarity to siah
            binding protein 1 (SiahBP1)  gb|U51586 from Homo sapiens.
             ESTs gb|T43314, gb|T43315 and gb|R90521, gb|T75905
            [Arabidopsis thaliana]
          Length = 781

 Score =  175 bits (443), Expect = 6e-43
 Identities = 93/147 (63%), Positives = 108/147 (73%), Gaps = 25/147 (17%)
 Frame = -2

Query: 666  KSKTHDNRRLLDAKQLIDMIPKTKEELFSYEIDWTVYDK--------------------- 550
            K+K  D +  LDAKQLID IPKTKE+LFSYEI+W +YDK                     
Sbjct: 636  KAKIIDTK-FLDAKQLIDTIPKTKEDLFSYEINWAMYDKINVFFYLDCEFVLVLTCFTFF 694

Query: 549  ----HQLHERMRPWISKKIQEFLGEEENTLIDYIVSSTQEHVKASPMLERLQIILDEEAE 382
                HQ+HERMRPWISKKI EFLGEEE TL+D+IVS+TQ+HV+AS MLE LQ ILDEEAE
Sbjct: 695  NIEKHQVHERMRPWISKKIMEFLGEEEATLVDFIVSNTQQHVQASQMLELLQSILDEEAE 754

Query: 381  MFVLKMWRMLIFEIKRVETGLALRSKS 301
            MFVLKMWRMLIFEIKRVE G+ ++SK+
Sbjct: 755  MFVLKMWRMLIFEIKRVEAGVPVKSKA 781

>dbj|BAC40049.1| unnamed protein product [Mus musculus]
          Length = 315

 Score =  112 bits (279), Expect = 6e-24
 Identities = 48/103 (46%), Positives = 73/103 (70%)
 Frame = -2

Query: 627 KQLIDMIPKTKEELFSYEIDWTVYDKHQLHERMRPWISKKIQEFLGEEENTLIDYIVSST 448
           K LI+ IP  K ELF+Y +DW++ D   +  R+RPWI+KKI E++GEEE TL+D++ S  
Sbjct: 211 KSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKV 270

Query: 447 QEHVKASPMLERLQIILDEEAEMFVLKMWRMLIFEIKRVETGL 319
             H     +L+ + ++LDEEAE+F++KMWR+LI+E +  + GL
Sbjct: 271 MAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGL 313

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 587,042,719
Number of Sequences: 1393205
Number of extensions: 12559250
Number of successful extensions: 25832
Number of sequences better than 10.0: 48
Number of HSP's better than 10.0 without gapping: 24964
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25820
length of database: 448,689,247
effective HSP length: 119
effective length of database: 282,897,852
effective search space used: 29138478756
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MRL013a06_f BP084351 1 433
2 MRL011b05_f BP084242 18 300
3 MRL022a06_f BP084828 59 187
4 GENLf001d09 BP062422 62 592
5 MRL028b01_f BP085121 65 454
6 MRL039e11_f BP085639 67 359
7 GNLf001c10 BP074841 77 595
8 GENLf054a08 BP065210 118 633
9 SPDL005a06_f BP052260 144 617
10 SPDL052d05_f BP055283 169 681
11 MPDL002h05_f AV776647 254 561




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research