KMC000010A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000010A_C02 KMC000010A_c02
gGATAGCAATTAACAATGAACAAATTTTATTAAGGAAAATGTCCGGGAGGGATGCGAACA
TGCCCTGGAGCCTGGAGAACAGAATTTCAAAGGCCAGGTATTTAACGCACAATTCAGATT
TACAATGTTTTAGTTGTCATCTCTAAATTTACTACCTGATTCCTAAAAAAAACCAATATA
CCAGTATGACTCCCAGTGATTCTCAACAGAATCGATTAAAAATCTTGATCATGCCAGATG
AAGATTATGCACACCAGCTAGATATATTCAAAATTTACAGTAACAGCTCTCCACTAAAGA
AAAAAACTATCCAAGCAGGTTTAGAGAATGTTACTAAATTTGGTGATAAATAAGAGCTCA
GAATTTACAAAATTCTTACGATGCCACCAACCAATGCACGCAACAAAAGAAGAACCGGTG
CTTGGGGGTATTTTACACAAGCATAGAAAACCTCTGATGCATATGCAATTTGTGATCACC
TGGCTTGAGCCACTCTGTAATTTAGGACCAGGTCATCTGATTTCTTCCATATATAAGCTC
GTACTGTG


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000010A_C02 KMC000010A_c02
         (548 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAF27015.1|AC009177_5 hypothetical protein [Arabidopsis thali...    43  0.003
ref|NP_566246.1| expressed protein; protein id: At3g05090.1, sup...    43  0.003
ref|NP_085499.1| orf154 [Arabidopsis thaliana] gi|1785701|emb|CA...    31  8.6

>gb|AAF27015.1|AC009177_5 hypothetical protein [Arabidopsis thaliana]
          Length = 743

 Score = 42.7 bits (99), Expect = 0.003
 Identities = 18/23 (78%), Positives = 21/23 (91%)
 Frame = -2

Query: 547 TVRAYIWKKSDDLVLNYRVAQAR 479
           TVRAY+WKK +DL+LNYRVA AR
Sbjct: 721 TVRAYVWKKPEDLILNYRVAIAR 743

>ref|NP_566246.1| expressed protein; protein id: At3g05090.1, supported by cDNA:
           gi_15810506 [Arabidopsis thaliana]
           gi|15810507|gb|AAL07141.1| unknown protein [Arabidopsis
           thaliana] gi|22022579|gb|AAM83246.1| AT3g05090/T12H1_5
           [Arabidopsis thaliana] gi|23296966|gb|AAN13212.1|
           unknown protein [Arabidopsis thaliana]
           gi|23308455|gb|AAN18197.1| At3g05090/T12H1_5
           [Arabidopsis thaliana]
          Length = 753

 Score = 42.7 bits (99), Expect = 0.003
 Identities = 18/23 (78%), Positives = 21/23 (91%)
 Frame = -2

Query: 547 TVRAYIWKKSDDLVLNYRVAQAR 479
           TVRAY+WKK +DL+LNYRVA AR
Sbjct: 731 TVRAYVWKKPEDLILNYRVAIAR 753

>ref|NP_085499.1| orf154 [Arabidopsis thaliana] gi|1785701|emb|CAA69775.1| orf154
           [Arabidopsis thaliana]
          Length = 154

 Score = 31.2 bits (69), Expect = 8.6
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +3

Query: 21  QILLRKMSGRDANMPWSLENRISKARYLTHNSDLQC 128
           Q LL K S R  + P +L +R+ ++RY  H+S ++C
Sbjct: 67  QALLAKQSFRIIHQPHTLLSRLLRSRYFPHSSMMEC 102

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 464,601,964
Number of Sequences: 1393205
Number of extensions: 9497690
Number of successful extensions: 20091
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 19414
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20090
length of database: 448,689,247
effective HSP length: 116
effective length of database: 287,077,467
effective search space used: 18947112822
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MFBL013e09_f BP041918 1 386
2 GENLf062f12 BP065685 2 338
3 MPDL020g11_f AV777529 2 499
4 GENLf064b06 BP065770 2 561
5 MFBL048h02_f BP043736 3 582
6 MPDL039f11_f AV778488 5 527
7 GENLf089c12 BP067202 7 554
8 GENLf001d06 BP062421 7 577
9 MPDL069c02_f AV780017 9 568
10 MPDL034g02_f AV778201 10 574
11 GENLf086h09 BP067062 12 567
12 GENLf062g01 BP065686 12 477
13 GENLf060d11 BP065561 12 574
14 SPDL016g12_f BP053018 21 478




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research