KMC000009A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000009A_C01 KMC000009A_c01
cacCATAACATATCCATTTATTCCATAACAAGTACCAAGAGTAATTGCATACATAACATA
AGATAGTGTGAGTGCGCCTACAACATTAATACAAATTCGCAACTTTATTATTCAGAAGTG
GGGATTTCTGGGCAGGAAATTTGAATCATTAGTAGAAACGTAACATGTTGTTTAATGCTG
AAAGATAAGCATCAACACTAGAAAACAACCCACCATCTGTTCCAGGGACCAGTCCCACAT
CACAAAAACACAAATTTCACATGTTGTCATCAAGCTCAGCCACAAGTGCAACAAATTCAT
AACCACTCAAAGCCAACATCAGCTGTTGGCATTCCAACACATCACCTCAAATCACTGGCA
TGCCATCTCGTCATCCTCCCACGGGCAACATTTCCAACCACTTTGCTCAGTGGCCAGTGT
GCCATCCACATGCCCTTCTGGTGCATTGCCACCCTAGAnTGTGTCACTTGCACCACAGTT
TTGCCCGGATTCCCTTGCACACATGTAGCATTAATCAGCCCTTCATAAGCGTGAATCCCA
CTGGCTCCCTGTACCCAATGGCAACAAGCAAACATGCATGCTTCCATCAATTGAAAAAAG
TTTGACAGTGGCAGTTGAAAAA


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000009A_C01 KMC000009A_c01
         (622 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_155589.1| hypothetical protein XP_155589 [Mus musculus]         37  0.21
emb|CAC83675.1| mucin 5 [Homo sapiens]                                 35  0.79
gb|EAA13230.1| ebiP3675 [Anopheles gambiae str. PEST]                  35  1.0
gb|AAF35856.1| transitional protein 2 [Pan paniscus]                   34  1.3
ref|NP_596957.1| similarity to HYPOTHETICAL ZINC FINGER PROTEIN ...    34  1.8

>ref|XP_155589.1| hypothetical protein XP_155589 [Mus musculus]
          Length = 135

 Score = 37.0 bits (84), Expect = 0.21
 Identities = 18/48 (37%), Positives = 24/48 (49%), Gaps = 3/48 (6%)
 Frame = +3

Query: 333 SNTSPQITGMPSRH---PPTGNISNHFAQWPVCHPHALLVHCHPRXCH 467
           +NT P +T +PS H   PPT ++  +      C P  L VH HP   H
Sbjct: 8   NNTPPSLTLLPSLHAQCPPTPSVHPYLVSTHTCCPLTLSVHLHPVSVH 55

>emb|CAC83675.1| mucin 5 [Homo sapiens]
          Length = 1349

 Score = 35.0 bits (79), Expect = 0.79
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 7/96 (7%)
 Frame = +3

Query: 192  STLENNPPSVPGTSPTSQKHKFHMLSSSSA-TSATNS*PLKANISCWHSNTSPQITGMPS 368
            S+  + P +   ++PT+    FH  S++S  TS+T+S P  +  S   S+T+      PS
Sbjct: 837  SSTTSAPTASTISAPTTSTTSFHTTSTTSPPTSSTSSTPQTSKTSAATSSTTSGSGTTPS 896

Query: 369  RHPPTGNIS------NHFAQWPVCHPHALLVHCHPR 458
              P T   S      +H +     H   +   CHPR
Sbjct: 897  PVPTTSTASVSKTSTSHVSVSKTTHSQPVTRDCHPR 932

>gb|EAA13230.1| ebiP3675 [Anopheles gambiae str. PEST]
          Length = 840

 Score = 34.7 bits (78), Expect = 1.0
 Identities = 21/73 (28%), Positives = 27/73 (36%)
 Frame = +1

Query: 235 PHHKNTNFTCCHQAQPQVQQIHNHSKPTSAVGIPTHHLKSLACHLVILPRATFPTTLLSG 414
           PHH +   T   Q Q Q    HNH +  S    P HH  S   +    P    PT ++  
Sbjct: 232 PHHTHQQQT---QQQQQQHSPHNHQQQQS----PQHHPSSSGSNASQTPARMTPTVIMGE 284

Query: 415 QCAIHMPFWCIAT 453
            C +    W   T
Sbjct: 285 SCGVRTMVWSYDT 297

>gb|AAF35856.1| transitional protein 2 [Pan paniscus]
          Length = 133

 Score = 34.3 bits (77), Expect = 1.3
 Identities = 21/61 (34%), Positives = 29/61 (47%)
 Frame = +3

Query: 243 QKHKFHMLSSSSATSATNS*PLKANISCWHSNTSPQITGMPSRHPPTGNISNHFAQWPVC 422
           Q H+     SSS + A++  P  A+ S  H + SP  +  P RH  T N S+H    P  
Sbjct: 39  QSHRGSRSRSSSQSPASHRNPTGAHSSSGHQSQSPNTSPPPKRHKKTMN-SHHSPMRPTL 97

Query: 423 H 425
           H
Sbjct: 98  H 98

>ref|NP_596957.1| similarity to HYPOTHETICAL ZINC FINGER PROTEIN YKF9_YEAST
           [Encephalitozoon cuniculi] gi|19171280|emb|CAD27005.1|
           similarity to HYPOTHETICAL ZINC FINGER PROTEIN
           YKF9_YEAST [Encephalitozoon cuniculi]
          Length = 260

 Score = 33.9 bits (76), Expect = 1.8
 Identities = 27/75 (36%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +1

Query: 271 QAQPQVQQIHNHSKPTSAVGIPTHHLKSLACH-LVILPRATFPTTLLSGQCAIHMPFWCI 447
           +AQPQVQ+   + + T AV      LK  +CH L+I P  T     L  QC I M     
Sbjct: 175 KAQPQVQEWKKYKQRTKAVAEIPDQLKCPSCHCLLINPMKTSCGHTLCDQC-IGM----- 228

Query: 448 ATLXCVTCTTVLPGF 492
               C  C+ V+ GF
Sbjct: 229 -DKKCYVCSRVIEGF 242

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 590,779,120
Number of Sequences: 1393205
Number of extensions: 13945936
Number of successful extensions: 38425
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 36379
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38306
length of database: 448,689,247
effective HSP length: 118
effective length of database: 284,291,057
effective search space used: 25017613016
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf001d03 BP062419 1 622
2 GENf063e08 BP061047 63 297
3 GENf035c05 BP059837 86 332




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research