KMC000008A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000008A_C01 KMC000008A_c01
ctatcctgactgcgtactgaatcctattcagtgggcgaggtaagacaaagtcaaatAAAG
GAATCAAGAAGCAAATCAATAACGATTTCTGCCTGATGGGAAAATGGAGTACATGATATT
ACAGAGGAAAAACAATAGAGTTGCCATCAACCCTGTGAAGCTTTTATAAGTTAGCCGCCA
ACATGGCTCGAATTTTGGCTCTAAGCTCATCAGAGACATCACTTATTTCTGGCCCATGGT
TTGCATTCGATAAACTGGCAGAAGGCTCTCTGCTAGCACGTTCAACCTCACTTGCTTGTT
GAGACTTATCTGATTTCATTACCTCCCCCTCCTCCAACTCTGATTCTCTTTCAACATGAG
ATCTGCTCTTATGCTTTGTATGTCTGCTTCGGTGTCTACGCTCATCCTCAGATGAGGTCT
CATGTTTATGCCGTCGTGAATGTTTATGCTCATGGTCTGACATGCTGTCTTCTCTTTGTC
GTCGTCTTGAAGATCGGTGCTTTTCATCGGAGGAGCTATCGTATTTATGATGATGACTTG
AGTGTTGATGCTCATCATCAGAGATGCCATGTT


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000008A_C01 KMC000008A_c01
         (573 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB08579.1| gene_id:MCO15.5~ref|NP_004583.1~similar to unkno...    80  1e-14
ref|NP_568820.1| putative protein; protein id: At5g55100.1, supp...    80  1e-14
dbj|BAC10750.1| OJ1116_H09.22 [Oryza sativa (japonica cultivar-g...    60  1e-08
gb|EAA05997.1| ebiP5621 [Anopheles gambiae str. PEST]                  57  2e-07
ref|NP_702892.1| Plasmodium falciparum trophozoite antigen r45-l...    56  4e-07

>dbj|BAB08579.1| gene_id:MCO15.5~ref|NP_004583.1~similar to unknown protein
            [Arabidopsis thaliana]
          Length = 875

 Score = 80.5 bits (197), Expect = 1e-14
 Identities = 57/151 (37%), Positives = 73/151 (47%), Gaps = 16/151 (10%)
 Frame = -3

Query: 571  HGISDDEHQHSS---HHHKYDSSSDE---KHRSSRRRQREDSMSD---HEHKHSRRHKHE 419
            H  S   H+HS     H  YDSS +E   +HRSS+  +  D   D   H H+  +  KH 
Sbjct: 720  HSRSRHRHRHSKSSDRHELYDSSDNEGEHRHRSSKHSKDVDYSKDKRSHHHRSRKHEKHR 779

Query: 418  TSSEDE---RRHRSRHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLS 248
             SS+DE    RHRS   KH+  S VE     +  + +K D+     E    S +     S
Sbjct: 780  DSSDDEHHHHRHRSSRRKHEDSSDVEHGHRHKSSKRIKKDEKTVEEETVSKSDQSDLKAS 839

Query: 247  NANHGP----EISDVSDELRAKIRAMLAANL 167
              ++ P    E S VSDELRAKIRAMLA  L
Sbjct: 840  PGDNIPYLQNEPSQVSDELRAKIRAMLADTL 870

>ref|NP_568820.1| putative protein; protein id: At5g55100.1, supported by cDNA:
            gi_14532719, supported by cDNA: gi_20465890 [Arabidopsis
            thaliana] gi|14532720|gb|AAK64161.1| unknown protein
            [Arabidopsis thaliana] gi|20465891|gb|AAM20098.1| unknown
            protein [Arabidopsis thaliana]
          Length = 844

 Score = 80.5 bits (197), Expect = 1e-14
 Identities = 57/151 (37%), Positives = 73/151 (47%), Gaps = 16/151 (10%)
 Frame = -3

Query: 571  HGISDDEHQHSS---HHHKYDSSSDE---KHRSSRRRQREDSMSD---HEHKHSRRHKHE 419
            H  S   H+HS     H  YDSS +E   +HRSS+  +  D   D   H H+  +  KH 
Sbjct: 689  HSRSRHRHRHSKSSDRHELYDSSDNEGEHRHRSSKHSKDVDYSKDKRSHHHRSRKHEKHR 748

Query: 418  TSSEDE---RRHRSRHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLS 248
             SS+DE    RHRS   KH+  S VE     +  + +K D+     E    S +     S
Sbjct: 749  DSSDDEHHHHRHRSSRRKHEDSSDVEHGHRHKSSKRIKKDEKTVEEETVSKSDQSDLKAS 808

Query: 247  NANHGP----EISDVSDELRAKIRAMLAANL 167
              ++ P    E S VSDELRAKIRAMLA  L
Sbjct: 809  PGDNIPYLQNEPSQVSDELRAKIRAMLADTL 839

>dbj|BAC10750.1| OJ1116_H09.22 [Oryza sativa (japonica cultivar-group)]
          Length = 1004

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 42/140 (30%), Positives = 66/140 (47%), Gaps = 8/140 (5%)
 Frame = -3

Query: 562  SDDEHQHSSHHHKYDSSSDEKHRSSRRRQREDSMSDHEHKH---SRRHKHETS----SED 404
            S+D   H+S  HK+      K    R  +  DS S+ EH+H     RH+H        +D
Sbjct: 872  SEDSRAHTSDVHKHKLKRHSKDLEPRHHRHRDSSSEDEHEHRSSKSRHRHRDDYHYHEDD 931

Query: 403  ERRHRSRHTK-HKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLSNANHGPE 227
            E R   RH + H+S S  +++ + +     KS ++    EV +   +P    + ++    
Sbjct: 932  EHRSSHRHQRDHRSSSKRKKDDDRD-----KSKQTIVLPEVSQNQEKPPGDTAQSSQA-- 984

Query: 226  ISDVSDELRAKIRAMLAANL 167
             ++V  ELRAKIRAML   L
Sbjct: 985  TTEVPSELRAKIRAMLLETL 1004

 Score = 41.2 bits (95), Expect = 0.009
 Identities = 24/110 (21%), Positives = 43/110 (38%)
 Frame = -3

Query: 565  ISDDEHQHSSHHHKYDSSSDEKHRSSRRRQREDSMSDHEHKHSRRHKHETSSEDERRHRS 386
            +S+ + Q S+   +  S   E+  S+  +Q +DS  +       R KH   S++E     
Sbjct: 801  LSESDPQPSAKEREGSSVPFEREGSNLAKQEKDSDDERNRARKYRKKHHPESDEENYDSE 860

Query: 385  RHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLSNANH 236
               KH  + H   +S     +V K    + + ++E        S S   H
Sbjct: 861  ESYKHSRKKHRSEDSRAHTSDVHKHKLKRHSKDLEPRHHRHRDSSSEDEH 910

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 26/97 (26%), Positives = 41/97 (41%), Gaps = 1/97 (1%)
 Frame = -3

Query: 562  SDDEHQHSSHHHKYDSSSDEKHRSSRRRQREDSMSDHEHKHSRRHKHETSSEDERRHRSR 383
            S D+   +      D +  E       ++RE S    E + S   K E  S+DE   R+R
Sbjct: 784  SADQTNEAGRASPGDLNLSESDPQPSAKEREGSSVPFEREGSNLAKQEKDSDDE---RNR 840

Query: 382  HTKHKSRSHVERESE-LEEGEVMKSDKSQQASEVERA 275
              K++ + H E + E  +  E  K  + +  SE  RA
Sbjct: 841  ARKYRKKHHPESDEENYDSEESYKHSRKKHRSEDSRA 877

>gb|EAA05997.1| ebiP5621 [Anopheles gambiae str. PEST]
          Length = 976

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 36/107 (33%), Positives = 50/107 (46%), Gaps = 4/107 (3%)
 Frame = -3

Query: 562 SDDEHQHSS---HHHKYDSSSDEKHRSSRRRQREDSMSDHEHKHSR-RHKHETSSEDERR 395
           S++   HSS   HHH   S +D K  SS R + ++S   H  KHS  R +H +SSE ER 
Sbjct: 183 SEETKHHSSSSKHHHSSTSDADRKKDSSHRNKEKESSRSHSSKHSSDRDRHRSSSEKERS 242

Query: 394 HRSRHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSAS 254
           H S+ +  KS S   + S         S K +  S    +S    +S
Sbjct: 243 H-SKSSSSKSSSSKSKSSTSNSNNSSSSRKKEHHSSTSSSSSSAKSS 288

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 27/111 (24%), Positives = 45/111 (40%)
 Frame = -3

Query: 517 SSSDEKHRSSRRRQREDSMSDHEHKHSRRHKHETSSEDERRHRSRHTKHKSRSHVERESE 338
           SS + KH SS  +    S SD + K    H+++   E  R H S+H+  + R     E E
Sbjct: 182 SSEETKHHSSSSKHHHSSTSDADRKKDSSHRNK-EKESSRSHSSKHSSDRDRHRSSSEKE 240

Query: 337 LEEGEVMKSDKSQQASEVERASREPSASLSNANHGPEISDVSDELRAKIRA 185
               +   S  S   S+   ++   S+S     H    S  S   ++  ++
Sbjct: 241 RSHSKSSSSKSSSSKSKSSTSNSNNSSSSRKKEHHSSTSSSSSSAKSSSKS 291

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 35/113 (30%), Positives = 52/113 (45%), Gaps = 3/113 (2%)
 Frame = -3

Query: 541 SSHHHKYDSSSDEKHRSSRR---RQREDSMSDHEHKHSRRHKHETSSEDERRHRSRHTKH 371
           SS   K+ SSS + H SS     R+++ S  + E + SR H  + SS D  RHRS  +  
Sbjct: 182 SSEETKHHSSSSKHHHSSTSDADRKKDSSHRNKEKESSRSHSSKHSS-DRDRHRS--SSE 238

Query: 370 KSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLSNANHGPEISDVS 212
           K RSH +  S        KS  S   +      +E  +S S+++   + S  S
Sbjct: 239 KERSHSKSSSSKSSSSKSKSSTSNSNNSSSSRKKEHHSSTSSSSSSAKSSSKS 291

>ref|NP_702892.1| Plasmodium falciparum trophozoite antigen r45-like protein
            [Plasmodium falciparum 3D7] gi|23498309|emb|CAD49281.1|
            Plasmodium falciparum trophozoite antigen r45-like
            protein [Plasmodium falciparum 3D7]
          Length = 1222

 Score = 55.8 bits (133), Expect = 4e-07
 Identities = 34/127 (26%), Positives = 58/127 (44%), Gaps = 6/127 (4%)
 Frame = -3

Query: 571  HGISDDEHQHSSHHHKYDSS--SDEKHRSSRRRQREDS-MSDHEHKHSRRHKHETSSEDE 401
            H    D +  S H+HK DS+  SD  H S    + + +  SDH HK    HK +++ + +
Sbjct: 636  HNHKSDNNHKSDHNHKSDSNHMSDHNHMSDHNHKSDHNHKSDHNHKSDNNHKSDSNHKSD 695

Query: 400  RRHRSRHTKHKSRSHVERESELEEGEVMKSD---KSQQASEVERASREPSASLSNANHGP 230
              H+S H      +H+   + + +    KSD   KS    + +   +  S   S+ NH  
Sbjct: 696  SNHKSDHNHKSDSNHMSDHNHMSDHN-HKSDHNHKSDNNHKSDSNHKSDSNHKSDHNHKS 754

Query: 229  EISDVSD 209
            + + +SD
Sbjct: 755  DSNHMSD 761

 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 37/127 (29%), Positives = 59/127 (46%), Gaps = 6/127 (4%)
 Frame = -3

Query: 571  HGISDDEHQHSSHHHKYDSS--SDEKHRSSRRRQREDS-MSDHEHKHSRRHKHETSSEDE 401
            H    D +  S  +HK DS+  SD  H+S    + +   MSD+ HK    HK + + + +
Sbjct: 780  HNHKSDNNHKSDSNHKSDSNHKSDSNHKSDHNHKSDHKHMSDNNHKSDNNHKSDHNHKSD 839

Query: 400  RRHRSRHTKHKSRSHVERESELEEGEVMKSD---KSQQASEVERASREPSASLSNANHGP 230
              H+S H  HKS S+ + +S  +     KSD   KS    + +      S  +S+ NH  
Sbjct: 840  NNHKSDH-NHKSDSNHKSDSNHKSDSNHKSDSNHKSDNNHKSDHNHNSDSNHMSDHNHKS 898

Query: 229  EISDVSD 209
            + +  SD
Sbjct: 899  DHNHKSD 905

 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 34/127 (26%), Positives = 60/127 (46%), Gaps = 6/127 (4%)
 Frame = -3

Query: 571  HGISDDEHQHSSHHHKYDSS--SDEKHRS-SRRRQREDSMSDHEHKHSRRHKHETSSEDE 401
            H    D +  S H+HK D++  SD  H+S S  +   +  SDH HK   +H  + + + +
Sbjct: 768  HNHMSDHNHKSDHNHKSDNNHKSDSNHKSDSNHKSDSNHKSDHNHKSDHKHMSDNNHKSD 827

Query: 400  RRHRSRHTKHKSRSHVERESELEEGEVMKSD---KSQQASEVERASREPSASLSNANHGP 230
              H+S H  HKS ++ + +   +     KSD   KS    + +   +  +   S+ NH  
Sbjct: 828  NNHKSDH-NHKSDNNHKSDHNHKSDSNHKSDSNHKSDSNHKSDSNHKSDNNHKSDHNHNS 886

Query: 229  EISDVSD 209
            + + +SD
Sbjct: 887  DSNHMSD 893

 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 33/122 (27%), Positives = 56/122 (45%), Gaps = 4/122 (3%)
 Frame = -3

Query: 562  SDDEHQHSSHHHKYDSS--SDEKHRSSRRRQREDSMSDHEHKHSRRHKHETSSEDERRHR 389
            SD  H+ S H+HK DS+  SD  H S    +     SDH HK    HK +++ + +  H+
Sbjct: 694  SDSNHK-SDHNHKSDSNHMSDHNHMSDHNHK-----SDHNHKSDNNHKSDSNHKSDSNHK 747

Query: 388  SRHTKHKSRSHVERESELEEGEVMK--SDKSQQASEVERASREPSASLSNANHGPEISDV 215
            S H      +H+   + + +   M   + KS    + +   +  S   S++NH  + +  
Sbjct: 748  SDHNHKSDSNHMSDHNHMSDHNHMSDHNHKSDHNHKSDNNHKSDSNHKSDSNHKSDSNHK 807

Query: 214  SD 209
            SD
Sbjct: 808  SD 809

 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 34/133 (25%), Positives = 60/133 (44%), Gaps = 3/133 (2%)
 Frame = -3

Query: 571  HGISDDEHQHSSHHHKYDSS--SDEKHRS-SRRRQREDSMSDHEHKHSRRHKHETSSEDE 401
            H    D +  S H+HK DS+  SD  H+S S  +   +  SD+ HK    H  +++   +
Sbjct: 834  HNHKSDNNHKSDHNHKSDSNHKSDSNHKSDSNHKSDSNHKSDNNHKSDHNHNSDSNHMSD 893

Query: 400  RRHRSRHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLSNANHGPEIS 221
              H+S H  HKS  + + ++  +     KSD + ++       +  + +  N N   + S
Sbjct: 894  HNHKSDH-NHKSDHNHKSDNNHKSDNNHKSDHNHKSDH----KKNNNNNKDNKNDDNDDS 948

Query: 220  DVSDELRAKIRAM 182
            D SD +   I  +
Sbjct: 949  DASDAVHEDIELL 961

 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 37/140 (26%), Positives = 63/140 (44%), Gaps = 22/140 (15%)
 Frame = -3

Query: 562 SDDEHQHSSHH-----HKYDSS--------SDEKHRS-SRRRQREDSMSDHEHKHSRRHK 425
           SD+ H+  S H     HK DSS        SD  H+S S  +   +  SDH HK    HK
Sbjct: 460 SDNNHKSDSSHKSDSSHKSDSSHKSGSNHKSDNNHKSDSSHKSGSNHKSDHNHKSDSNHK 519

Query: 424 HETSSEDERRHRS-----RHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPS 260
            +++ ++E  H++       + HK+ S+ + ES  +     KSD +  +    ++     
Sbjct: 520 SDSNHKNESNHKNESNHKNESNHKNESNHKNESNHKNDSNHKSDSNHMSDHNHKSDNNHK 579

Query: 259 AS---LSNANHGPEISDVSD 209
           +    +S+ NH  + +  SD
Sbjct: 580 SDHNHMSDHNHKSDNNHKSD 599

 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 36/130 (27%), Positives = 63/130 (47%), Gaps = 11/130 (8%)
 Frame = -3

Query: 565 ISDDEHQHSSHH-----HKYDSS--SDEKHRS-SRRRQREDSMSDHEHKHSRRHKHETSS 410
           +S++ H+  S H     HK DS+  SD  H+S S  +   +  SD  HK    HK +++ 
Sbjct: 387 MSENNHKKDSKHKGDSNHKSDSNHKSDSNHKSDSNHKSGSNHKSDCNHKSGSNHKSDSNH 446

Query: 409 EDERRHRSRHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERAS---REPSASLSNAN 239
           + +  H S H  HKS ++ + +S  +     KSD S ++    ++    +  S+  S +N
Sbjct: 447 QSDCNHMSDH-NHKSDNNHKSDSSHKSDSSHKSDSSHKSGSNHKSDNNHKSDSSHKSGSN 505

Query: 238 HGPEISDVSD 209
           H  + +  SD
Sbjct: 506 HKSDHNHKSD 515

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 33/127 (25%), Positives = 60/127 (46%), Gaps = 6/127 (4%)
 Frame = -3

Query: 571  HGISDDEHQHSSHHHKYDSS--SDEKHRSSRRRQREDS-MSDHEHKHSRRHKHETSSEDE 401
            H    D +  S H+H  D +  SD  H+S    + +++  SD  HK    HK +++ + +
Sbjct: 750  HNHKSDSNHMSDHNHMSDHNHMSDHNHKSDHNHKSDNNHKSDSNHKSDSNHKSDSNHKSD 809

Query: 400  RRHRSRHTKHKSRSHVERESELEEGEVMKSD---KSQQASEVERASREPSASLSNANHGP 230
              H+S H KH S ++ + ++  +     KSD   KS    + +   +  S   S++NH  
Sbjct: 810  HNHKSDH-KHMSDNNHKSDNNHKSDHNHKSDNNHKSDHNHKSDSNHKSDSNHKSDSNHKS 868

Query: 229  EISDVSD 209
            + +  SD
Sbjct: 869  DSNHKSD 875

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 37/128 (28%), Positives = 59/128 (45%), Gaps = 16/128 (12%)
 Frame = -3

Query: 562 SDDEHQHSSHH-----HKYDSS--SDEKHRSSRRRQRE-DSMSDHEHKHSRRHKHETSSE 407
           SD  H+  S+H     HK D +  S   H+S    Q + + MSDH HK    HK ++S +
Sbjct: 412 SDSNHKSDSNHKSGSNHKSDCNHKSGSNHKSDSNHQSDCNHMSDHNHKSDNNHKSDSSHK 471

Query: 406 DERRHRS-----RHTKHKSRSHVERESELEEGEVMKSD---KSQQASEVERASREPSASL 251
            +  H+S       + HKS ++ + +S  + G   KSD   KS    + +   +  S   
Sbjct: 472 SDSSHKSDSSHKSGSNHKSDNNHKSDSSHKSGSNHKSDHNHKSDSNHKSDSNHKNESNHK 531

Query: 250 SNANHGPE 227
           + +NH  E
Sbjct: 532 NESNHKNE 539

 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 34/124 (27%), Positives = 55/124 (43%), Gaps = 3/124 (2%)
 Frame = -3

Query: 571  HGISDDEHQHSSHHHKYDSS--SDEKHRS-SRRRQREDSMSDHEHKHSRRHKHETSSEDE 401
            H    D +  S  +HK DS+  SD  H+S S      + MSDH H     HK + + + +
Sbjct: 726  HNHKSDNNHKSDSNHKSDSNHKSDHNHKSDSNHMSDHNHMSDHNHMSDHNHKSDHNHKSD 785

Query: 400  RRHRSRHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLSNANHGPEIS 221
              H+S  + HKS S+ + +S  +     KSD    +    ++        S+ NH  + +
Sbjct: 786  NNHKS-DSNHKSDSNHKSDSNHKSDHNHKSDHKHMSDNNHKSDNNHK---SDHNHKSDNN 841

Query: 220  DVSD 209
              SD
Sbjct: 842  HKSD 845

 Score = 49.3 bits (116), Expect = 3e-05
 Identities = 36/123 (29%), Positives = 57/123 (46%), Gaps = 5/123 (4%)
 Frame = -3

Query: 562  SDDEHQHSSHHHKYDSS--SDEKHRSSRRRQREDSMSDHEHKHSRRHKHETSSEDERRHR 389
            SD  H+ S H+HK DS+  SD  H S       + MSDH HK    HK + + + +  H+
Sbjct: 742  SDSNHK-SDHNHKSDSNHMSDHNHMSD-----HNHMSDHNHKSDHNHKSDNNHKSDSNHK 795

Query: 388  SRHTKHKSRSHVERESELEEGEVMKSD---KSQQASEVERASREPSASLSNANHGPEISD 218
            S  + HKS S+ + +   +      SD   KS    + +   +  +   S+ NH  + + 
Sbjct: 796  S-DSNHKSDSNHKSDHNHKSDHKHMSDNNHKSDNNHKSDHNHKSDNNHKSDHNHKSDSNH 854

Query: 217  VSD 209
             SD
Sbjct: 855  KSD 857

 Score = 49.3 bits (116), Expect = 3e-05
 Identities = 33/127 (25%), Positives = 56/127 (43%), Gaps = 9/127 (7%)
 Frame = -3

Query: 562 SDDEHQHSSHHHKYDSS--------SDEKHRSSRRRQREDS-MSDHEHKHSRRHKHETSS 410
           SD  H  S H+HK D++        SD  H+S    + +++ MSDH HK    HK + + 
Sbjct: 562 SDSNHM-SDHNHKSDNNHKSDHNHMSDHNHKSDNNHKSDNNHMSDHNHKSDNNHKSDNNH 620

Query: 409 EDERRHRSRHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLSNANHGP 230
           + +  H+S H      +H             KSD + ++   +   +  S  +S+ NH  
Sbjct: 621 KSDNNHKSDHNHMSDHNH-------------KSDNNHKS---DHNHKSDSNHMSDHNHMS 664

Query: 229 EISDVSD 209
           + +  SD
Sbjct: 665 DHNHKSD 671

 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 36/129 (27%), Positives = 62/129 (47%), Gaps = 11/129 (8%)
 Frame = -3

Query: 562 SDDEHQH-----SSHHHKYDSS--SDEKHRSSRRRQREDS-MSDHEHKHSRRHKHETSSE 407
           SD  HQ      S H+HK D++  SD  H+S    + + S  S   HK    HK ++S +
Sbjct: 442 SDSNHQSDCNHMSDHNHKSDNNHKSDSSHKSDSSHKSDSSHKSGSNHKSDNNHKSDSSHK 501

Query: 406 DERRHRSRHTKHKSRSHVERESELEEGEVMKSD---KSQQASEVERASREPSASLSNANH 236
               H+S H  HKS S+ + +S  +     K++   K++   + E   +  S   +++NH
Sbjct: 502 SGSNHKSDH-NHKSDSNHKSDSNHKNESNHKNESNHKNESNHKNESNHKNESNHKNDSNH 560

Query: 235 GPEISDVSD 209
             + + +SD
Sbjct: 561 KSDSNHMSD 569

 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 32/119 (26%), Positives = 58/119 (47%), Gaps = 4/119 (3%)
 Frame = -3

Query: 553  EHQH-SSHHHKYDSS--SDEKHRSSRRRQREDS-MSDHEHKHSRRHKHETSSEDERRHRS 386
            +H H S H+HK D +  SD  H+S    + + +  SD  HK    HK +++   +  H S
Sbjct: 659  DHNHMSDHNHKSDHNHKSDHNHKSDNNHKSDSNHKSDSNHKSDHNHKSDSNHMSDHNHMS 718

Query: 385  RHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLSNANHGPEISDVSD 209
             H  HKS  + + ++  +     KSD + ++   +   +  S  +S+ NH  + + +SD
Sbjct: 719  DH-NHKSDHNHKSDNNHKSDSNHKSDSNHKS---DHNHKSDSNHMSDHNHMSDHNHMSD 773

 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 33/121 (27%), Positives = 56/121 (46%), Gaps = 3/121 (2%)
 Frame = -3

Query: 562 SDDEHQHSSHHHKYDSS--SDEKHRSSRRRQREDS-MSDHEHKHSRRHKHETSSEDERRH 392
           SD+ H+ S H+H  D +  SD  H+S    + + + MSDH H     HK + + + +  H
Sbjct: 622 SDNNHK-SDHNHMSDHNHKSDNNHKSDHNHKSDSNHMSDHNHMSDHNHKSDHNHKSDHNH 680

Query: 391 RSRHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLSNANHGPEISDVS 212
           +S    HKS S+ + +S  +     KSD +  +     +        S+ NH  + +  S
Sbjct: 681 KS-DNNHKSDSNHKSDSNHKSDHNHKSDSNHMSDHNHMSDHNHK---SDHNHKSDNNHKS 736

Query: 211 D 209
           D
Sbjct: 737 D 737

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 31/124 (25%), Positives = 58/124 (46%), Gaps = 3/124 (2%)
 Frame = -3

Query: 571 HGISDDEHQHSSHHHKYDSS--SDEKHRSSRRRQREDS-MSDHEHKHSRRHKHETSSEDE 401
           H    D +  S ++HK D++  SD  H S    + +++  SDH HK    H  + +   +
Sbjct: 606 HNHKSDNNHKSDNNHKSDNNHKSDHNHMSDHNHKSDNNHKSDHNHKSDSNHMSDHNHMSD 665

Query: 400 RRHRSRHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLSNANHGPEIS 221
             H+S H  HKS  + + ++  +     KSD + ++   +   +  S  +S+ NH  + +
Sbjct: 666 HNHKSDH-NHKSDHNHKSDNNHKSDSNHKSDSNHKS---DHNHKSDSNHMSDHNHMSDHN 721

Query: 220 DVSD 209
             SD
Sbjct: 722 HKSD 725

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 31/126 (24%), Positives = 59/126 (46%), Gaps = 8/126 (6%)
 Frame = -3

Query: 562 SDDEHQHSSHH-----HKYDSS--SDEKHRSSRRRQREDS-MSDHEHKHSRRHKHETSSE 407
           ++  H++ S+H     HK DS+  SD  H S    + +++  SDH H     HK + + +
Sbjct: 538 NESNHKNESNHKNESNHKNDSNHKSDSNHMSDHNHKSDNNHKSDHNHMSDHNHKSDNNHK 597

Query: 406 DERRHRSRHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLSNANHGPE 227
            +  H S H  HKS ++ + ++  +     KSD +  +    ++        S+ NH  +
Sbjct: 598 SDNNHMSDH-NHKSDNNHKSDNNHKSDNNHKSDHNHMSDHNHKSDNNHK---SDHNHKSD 653

Query: 226 ISDVSD 209
            + +SD
Sbjct: 654 SNHMSD 659

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 29/123 (23%), Positives = 60/123 (48%), Gaps = 5/123 (4%)
 Frame = -3

Query: 562 SDDEHQHSSHHHK-YDSSSDEKHRS-SRRRQREDSMSDHEHKHSRRHKHETSSEDERRHR 389
           SD  H+  S+H   ++  SD  H+S S  +   +  ++  HK+   HK+E++ ++E  H+
Sbjct: 496 SDSSHKSGSNHKSDHNHKSDSNHKSDSNHKNESNHKNESNHKNESNHKNESNHKNESNHK 555

Query: 388 SRHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERAS---REPSASLSNANHGPEISD 218
           +  + HKS S+   +   +     KSD +  +    ++    +  +  +S+ NH  + + 
Sbjct: 556 N-DSNHKSDSNHMSDHNHKSDNNHKSDHNHMSDHNHKSDNNHKSDNNHMSDHNHKSDNNH 614

Query: 217 VSD 209
            SD
Sbjct: 615 KSD 617

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 33/129 (25%), Positives = 57/129 (43%), Gaps = 8/129 (6%)
 Frame = -3

Query: 571 HGISDDEHQHSSHHHKYDSS--SDEKHRS-SRRRQREDSMSDHEHKHSRRHKHETSSEDE 401
           H    D +  S   HK DSS  SD  H+S S  +   +  SD  HK    HK + + + +
Sbjct: 456 HNHKSDNNHKSDSSHKSDSSHKSDSSHKSGSNHKSDNNHKSDSSHKSGSNHKSDHNHKSD 515

Query: 400 RRHRS-----RHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLSNANH 236
             H+S       + HK+ S+ + ES  +     K++ + +     ++    S  +S+ NH
Sbjct: 516 SNHKSDSNHKNESNHKNESNHKNESNHKNESNHKNESNHKNDSNHKSD---SNHMSDHNH 572

Query: 235 GPEISDVSD 209
             + +  SD
Sbjct: 573 KSDNNHKSD 581

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 25/120 (20%), Positives = 53/120 (43%), Gaps = 2/120 (1%)
 Frame = -3

Query: 562 SDDEHQHSSHHHKYDSSSDEKHRSSRRRQREDS--MSDHEHKHSRRHKHETSSEDERRHR 389
           ++  H++ S+H    +  +E +  +    + DS  MSDH HK    HK + +   +  H+
Sbjct: 532 NESNHKNESNHKNESNHKNESNHKNDSNHKSDSNHMSDHNHKSDNNHKSDHNHMSDHNHK 591

Query: 388 SRHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLSNANHGPEISDVSD 209
           S +      +H+   +   +    KSD + ++    ++       +S+ NH  + +  SD
Sbjct: 592 SDNNHKSDNNHMSDHNHKSDNN-HKSDNNHKSDNNHKSDHN---HMSDHNHKSDNNHKSD 647

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 32/123 (26%), Positives = 54/123 (43%), Gaps = 5/123 (4%)
 Frame = -3

Query: 562 SDDEHQHSSHHHKYDSS--SDEKHRSSRRRQREDSMSDHEHKHSRRHKHETSSEDERRHR 389
           SD+ H  S H+HK D++  SD  H+S    +     SDH H     HK + + + +  H+
Sbjct: 598 SDNNHM-SDHNHKSDNNHKSDNNHKSDNNHK-----SDHNHMSDHNHKSDNNHKSDHNHK 651

Query: 388 SRHTKHKSRSHVERESELEEGEVMKSD---KSQQASEVERASREPSASLSNANHGPEISD 218
           S        +H+   +   +    KSD   KS    + +   +  S   S+ NH  + + 
Sbjct: 652 SDSNHMSDHNHMSDHNHKSDHN-HKSDHNHKSDNNHKSDSNHKSDSNHKSDHNHKSDSNH 710

Query: 217 VSD 209
           +SD
Sbjct: 711 MSD 713

 Score = 38.9 bits (89), Expect = 0.046
 Identities = 27/119 (22%), Positives = 56/119 (46%), Gaps = 4/119 (3%)
 Frame = -3

Query: 553 EHQHSSH-HHKYDSS--SDEKHRSSRRRQREDS-MSDHEHKHSRRHKHETSSEDERRHRS 386
           +H H S  +HK DS+  ++  H++    + E +  ++  HK+   HK++++ + +  H S
Sbjct: 509 DHNHKSDSNHKSDSNHKNESNHKNESNHKNESNHKNESNHKNESNHKNDSNHKSDSNHMS 568

Query: 385 RHTKHKSRSHVERESELEEGEVMKSDKSQQASEVERASREPSASLSNANHGPEISDVSD 209
            H  HKS ++ + +         KSD + ++     +        S+ NH  + +  SD
Sbjct: 569 DH-NHKSDNNHKSDHNHMSDHNHKSDNNHKSDNNHMSDHNHK---SDNNHKSDNNHKSD 623

 Score = 38.5 bits (88), Expect = 0.060
 Identities = 30/126 (23%), Positives = 56/126 (43%), Gaps = 8/126 (6%)
 Frame = -3

Query: 562 SDDEHQHSSHHHKYDSSSDEKHRSSRRRQREDSMSDHEHKHSRRHKHETSSEDERRHRS- 386
           ++++   S ++HK DS    KH+     +     SD  HK    HK +++ +    H+S 
Sbjct: 381 NEEDKNMSENNHKKDS----KHKGDSNHK-----SDSNHKSDSNHKSDSNHKSGSNHKSD 431

Query: 385 ----RHTKHKSRSHVERESELEEGEVMKSD---KSQQASEVERASREPSASLSNANHGPE 227
                 + HKS S+ + +         KSD   KS  + + + + +  S+  S +NH  +
Sbjct: 432 CNHKSGSNHKSDSNHQSDCNHMSDHNHKSDNNHKSDSSHKSDSSHKSDSSHKSGSNHKSD 491

Query: 226 ISDVSD 209
            +  SD
Sbjct: 492 NNHKSD 497

 Score = 35.0 bits (79), Expect = 0.67
 Identities = 23/105 (21%), Positives = 44/105 (41%)
 Frame = -3

Query: 523 YDSSSDEKHRSSRRRQREDSMSDHEHKHSRRHKHETSSEDERRHRSRHTKHKSRSHVERE 344
           Y+      +   +     +   D +HK    HK +++ + +  H+S  + HKS S+ + +
Sbjct: 373 YEPECANCNEEDKNMSENNHKKDSKHKGDSNHKSDSNHKSDSNHKS-DSNHKSGSNHKSD 431

Query: 343 SELEEGEVMKSDKSQQASEVERASREPSASLSNANHGPEISDVSD 209
              + G   KSD + Q+     +        S+ NH  + S  SD
Sbjct: 432 CNHKSGSNHKSDSNHQSDCNHMSDHNHK---SDNNHKSDSSHKSD 473

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 452,695,971
Number of Sequences: 1393205
Number of extensions: 9597579
Number of successful extensions: 73281
Number of sequences better than 10.0: 2795
Number of HSP's better than 10.0 without gapping: 44947
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 62120
length of database: 448,689,247
effective HSP length: 116
effective length of database: 287,077,467
effective search space used: 21243732558
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GNLf003f05 BP074974 1 172
2 GENLf016b04 BP063183 56 546
3 MRL026b02_f BP085033 57 422
4 MPDL070h02_f AV780105 63 575
5 MRL001a11_f BP083704 68 477
6 GENLf037g08 BP064302 70 523
7 MRL026h07_f BP085076 70 516
8 GENLf001c08 BP062417 79 537




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research