KMC000006A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000006A_C02 KMC000006A_c02
GAAGCAAGCAATATTAGTATTAGCATCTCAACAGATAAGCTGATGCAACACAAAATAAAA
GACTACAAGTATTACTGCAATTATTACAAGTCAAGAAAGTTTAATACTCTGTACATCTCT
CCACTCACACAAGAGTAAGGAAGATGGATCACATGTGTACAAAGAGCAAAGACAACCAAG
TCAATTAGGCCACTGTCTACAGTCTACATTGTTCTGTTTCAAAAAAATACAGTGGTAAAA
ATGTGTACCATAAATGCAGTAAACATTTGCTACCCAAGTCCACTGAATCTGAATGCCAAC
AGTCTACCTTTTATACAAAGCTTTTACATCTTCTCCTAACATTGGAGTCTCAAGGAACTC
ATCACCACATTCATTGACACTAACAGTCTCAACTTGGAAGGCTCTATCACCACAGTACTC
ATTCCATTCAAACCACATCTTTGAAATCAATTCCTTCTTGAAACAAGTAATGTGATCGTC
CTCTTCTGGAGAGTCAGCAGCTATCAATCGATACACAAAGACCTTCTTTGTCTGTCCTGG
TCGGAATGCACGGCCAATAGCTTGACGAGTAACTGATGGATTCAGATG


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000006A_C02 KMC000006A_c02
         (588 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_179232.1| hypothetical protein; protein id: At2g16390.1 [...   150  1e-35
gb|AAM15781.1|AC104428_2 Hypothetical protein [Oryza sativa (jap...   130  9e-30
ref|NP_179740.1| hypothetical protein; protein id: At2g21450.1 [...   117  8e-26
ref|NP_197542.1| putative protein; protein id: At5g20420.1 [Arab...    54  1e-06
ref|NP_189853.1| putative protein; protein id: At3g42670.1 [Arab...    54  2e-06

>ref|NP_179232.1| hypothetical protein; protein id: At2g16390.1 [Arabidopsis thaliana]
            gi|25411706|pir||G84539 hypothetical protein At2g16390
            [imported] - Arabidopsis thaliana
            gi|4544390|gb|AAD22300.1| hypothetical protein
            [Arabidopsis thaliana]
          Length = 888

 Score =  150 bits (379), Expect = 1e-35
 Identities = 69/93 (74%), Positives = 78/93 (83%)
 Frame = -1

Query: 585  LNPSVTRQAIGRAFRPGQTKKVFVYRLIAADSPEEDDHITCFKKELISKMWFEWNEYCGD 406
            LNPSVTRQAIGRAFRPGQ K V  YRLIA  SPEE+DH TCFKKE+ISKMWFEWNEYCG 
Sbjct: 796  LNPSVTRQAIGRAFRPGQKKMVHAYRLIAGSSPEEEDHNTCFKKEVISKMWFEWNEYCGY 855

Query: 405  RAFQVETVSVNECGDEFLETPMLGEDVKALYKR 307
            + F+VET+ V+E GD FLE+P L ED++ LYKR
Sbjct: 856  QNFEVETIDVDEAGDTFLESPALREDIRVLYKR 888

>gb|AAM15781.1|AC104428_2 Hypothetical protein [Oryza sativa (japonica cultivar-group)]
          Length = 1197

 Score =  130 bits (328), Expect = 9e-30
 Identities = 60/94 (63%), Positives = 73/94 (76%)
 Frame = -1

Query: 588  HLNPSVTRQAIGRAFRPGQTKKVFVYRLIAADSPEEDDHITCFKKELISKMWFEWNEYCG 409
            H NPSV RQAIGRA+RPGQ+K V+ YRL+AADSPEEDDH T FKKE +SK+WFEWNE C 
Sbjct: 1104 HENPSVMRQAIGRAYRPGQSKMVYCYRLVAADSPEEDDHHTAFKKERVSKLWFEWNELCS 1163

Query: 408  DRAFQVETVSVNECGDEFLETPMLGEDVKALYKR 307
               F++ TV V++  D FLE+  L +D+KAL KR
Sbjct: 1164 SDDFELATVDVSDSEDRFLESSALKQDIKALLKR 1197

>ref|NP_179740.1| hypothetical protein; protein id: At2g21450.1 [Arabidopsis thaliana]
            gi|25412041|pir||D84601 hypothetical protein At2g21450
            [imported] - Arabidopsis thaliana
            gi|4567276|gb|AAD23689.1| hypothetical protein
            [Arabidopsis thaliana]
          Length = 816

 Score =  117 bits (294), Expect = 8e-26
 Identities = 51/94 (54%), Positives = 69/94 (73%)
 Frame = -1

Query: 588  HLNPSVTRQAIGRAFRPGQTKKVFVYRLIAADSPEEDDHITCFKKELISKMWFEWNEYCG 409
            HLNPSVT+QA+ RA+RPGQ +KV+ Y+L+AADSPEE+++ TC +KE++SKMWFEWN   G
Sbjct: 721  HLNPSVTQQAVARAYRPGQKRKVYAYKLVAADSPEEENYETCTRKEMMSKMWFEWNVGSG 780

Query: 408  DRAFQVETVSVNECGDEFLETPMLGEDVKALYKR 307
               F    +  +  GD FLET  + ED+K LY +
Sbjct: 781  REDFGFRAIDADHSGDAFLETTKMKEDIKCLYTK 814

>ref|NP_197542.1| putative protein; protein id: At5g20420.1 [Arabidopsis thaliana]
          Length = 1261

 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 34/85 (40%), Positives = 47/85 (55%)
 Frame = -1

Query: 582  NPSVTRQAIGRAFRPGQTKKVFVYRLIAADSPEEDDHITCFKKELISKMWFEWNEYCGDR 403
            NPS T+QAI RAFRPGQ K V+VY+L++  + EED +     KE +S M F         
Sbjct: 1166 NPSKTKQAIARAFRPGQQKVVYVYQLLSRGTLEEDKYRRTTWKEWVSCMIFSEEFVADPS 1225

Query: 402  AFQVETVSVNECGDEFLETPMLGED 328
             +Q E +      D+ L   ++GED
Sbjct: 1226 LWQAEKIE-----DDILR-EIVGED 1244

>ref|NP_189853.1| putative protein; protein id: At3g42670.1 [Arabidopsis thaliana]
            gi|11357995|pir||T47325 hypothetical protein T12K4.120 -
            Arabidopsis thaliana gi|7523392|emb|CAB86450.1| putative
            protein [Arabidopsis thaliana]
          Length = 1256

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 27/51 (52%), Positives = 35/51 (67%)
 Frame = -1

Query: 582  NPSVTRQAIGRAFRPGQTKKVFVYRLIAADSPEEDDHITCFKKELISKMWF 430
            NPS T+QAI RAFRPGQ K V+VY+L++  + EED +     KE +S M F
Sbjct: 1160 NPSKTKQAIARAFRPGQQKVVYVYQLLSRGTLEEDKYRRTTWKEWVSSMIF 1210

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 467,988,989
Number of Sequences: 1393205
Number of extensions: 9687218
Number of successful extensions: 31273
Number of sequences better than 10.0: 372
Number of HSP's better than 10.0 without gapping: 30121
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31240
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 22283372436
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf001c01 BP062415 1 518
2 MFL004e09_f BP033600 31 588
3 MPDL002f09_f AV776634 58 385
4 GENLf045e10 BP064726 58 457
5 GENLf087h08 BP067117 59 447
6 SPDL091d04_f BP057704 85 458




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research