KMC000005A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000005A_C01 KMC000005A_c01
cccTTCTCTCTCTCTCCACATCCATTTTTCATTCGTTGACATCTTCTTCTTCCTGGCGCG
GTTACACAGGTTGGTTGGGGAGTGAAAGGTGGCAACAATGGCAAACAGGAATTTGGAAAA
GATGGCATCCATTGATGCCCAGCTTAGGCAATTGGCTCCTGCAAAAGTCAGTGAGGATGA
TAAATTGATTGAGTATGATGCTCTGCTTCTGGATCGCTTCCTTGATATTCTCCAGGATTT
ACATGGAGAGGATCTTAAGGAAACTGTTCAAGAAGTGTATGAGCTTTCTGCTGAGTATGA
AAGAAAGCATGATCATGAGAAACTGGAAGAACTTGGAAAAGTGATAACCAGTTTGGATGC
TGGGGACTCTATTGTGGTTGCTAAGTCGTTTTCCCACATGCTTAACTTGGCCAACTTAGC
TGAAGAGGTCCAGATTTCTCGCCGCCGAAGGAACAAGCTGAAAAAAGGGGATTTTGCTGA
TGAGAACAATGCAACTACTGAGTCAGATATTGAAGAAACTCTCAAGAAGCTTGTGTTTAA
ATTAAAGAAATCTCCTCAGGAAGTTTTTGATTGCCTGAAGAACCAGACAGTAGACCTGGT
TCTAAC


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000005A_C01 KMC000005A_c01
         (606 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAC20364.1| phosphoenolpyruvate carboxylase [Lotus japonicus]     323  8e-88
gb|AAD31452.1|AF135371_1 phosphoenol pyruvate carboxylase [Lotus...   323  8e-88
sp|Q9AU12|CAPP_PHAVU Phosphoenolpyruvate carboxylase (PEPCase) g...   309  2e-83
dbj|BAA23419.1| phosphoenolpyruvate carboxylase [Glycine max]         308  3e-83
dbj|BAC41249.1| phosphoenolpyruvate carboxylase [Glycine max]         308  3e-83

>dbj|BAC20364.1| phosphoenolpyruvate carboxylase [Lotus japonicus]
          Length = 961

 Score =  323 bits (829), Expect = 8e-88
 Identities = 168/169 (99%), Positives = 168/169 (99%)
 Frame = +2

Query: 98  MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV 277
           MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV
Sbjct: 1   MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV 60

Query: 278 YELSAEYERKHDHEKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK 457
           YELSAEYERKHDHEKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK
Sbjct: 61  YELSAEYERKHDHEKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK 120

Query: 458 LKKGDFADENNATTESDIEETLKKLVFKLKKSPQEVFDCLKNQTVDLVL 604
           LKKGDFADENNATTESDIEETLKKLVFKLKKSPQEVFD LKNQTVDLVL
Sbjct: 121 LKKGDFADENNATTESDIEETLKKLVFKLKKSPQEVFDALKNQTVDLVL 169

>gb|AAD31452.1|AF135371_1 phosphoenol pyruvate carboxylase [Lotus corniculatus]
          Length = 957

 Score =  323 bits (829), Expect = 8e-88
 Identities = 168/169 (99%), Positives = 168/169 (99%)
 Frame = +2

Query: 98  MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV 277
           MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV
Sbjct: 1   MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV 60

Query: 278 YELSAEYERKHDHEKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK 457
           YELSAEYERKHDHEKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK
Sbjct: 61  YELSAEYERKHDHEKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK 120

Query: 458 LKKGDFADENNATTESDIEETLKKLVFKLKKSPQEVFDCLKNQTVDLVL 604
           LKKGDFADENNATTESDIEETLKKLVFKLKKSPQEVFD LKNQTVDLVL
Sbjct: 121 LKKGDFADENNATTESDIEETLKKLVFKLKKSPQEVFDALKNQTVDLVL 169

>sp|Q9AU12|CAPP_PHAVU Phosphoenolpyruvate carboxylase (PEPCase)
           gi|13507108|gb|AAK28444.1|AF288382_1 phosphoenolpyruvate
           carboxylase [Phaseolus vulgaris]
          Length = 968

 Score =  309 bits (791), Expect = 2e-83
 Identities = 161/169 (95%), Positives = 165/169 (97%)
 Frame = +2

Query: 98  MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV 277
           MANRNLEKMASIDAQLRQLAP+KVSEDDKLIEYDALLLDRFLDILQ+LHGEDLKETVQEV
Sbjct: 1   MANRNLEKMASIDAQLRQLAPSKVSEDDKLIEYDALLLDRFLDILQNLHGEDLKETVQEV 60

Query: 278 YELSAEYERKHDHEKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK 457
           YELSAEYE KHD +KLEELG VITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK
Sbjct: 61  YELSAEYEGKHDPKKLEELGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK 120

Query: 458 LKKGDFADENNATTESDIEETLKKLVFKLKKSPQEVFDCLKNQTVDLVL 604
           LKKGDFADENNATTESDIEETLKKLVF+LKKSPQEVFD LKNQTVDLVL
Sbjct: 121 LKKGDFADENNATTESDIEETLKKLVFELKKSPQEVFDALKNQTVDLVL 169

>dbj|BAA23419.1| phosphoenolpyruvate carboxylase [Glycine max]
          Length = 967

 Score =  308 bits (790), Expect = 3e-83
 Identities = 161/169 (95%), Positives = 164/169 (96%)
 Frame = +2

Query: 98  MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV 277
           MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV
Sbjct: 1   MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV 60

Query: 278 YELSAEYERKHDHEKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK 457
           YELSAEYE KHD +KLEELG +ITSLDAGDSI+VAKSFSHMLNLANLAEEVQISRRRRNK
Sbjct: 61  YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK 120

Query: 458 LKKGDFADENNATTESDIEETLKKLVFKLKKSPQEVFDCLKNQTVDLVL 604
           LKKGDFADENNATTESDIEETLKKLVF LKKSPQEVFD LKNQTVDLVL
Sbjct: 121 LKKGDFADENNATTESDIEETLKKLVFGLKKSPQEVFDALKNQTVDLVL 169

>dbj|BAC41249.1| phosphoenolpyruvate carboxylase [Glycine max]
          Length = 967

 Score =  308 bits (790), Expect = 3e-83
 Identities = 161/169 (95%), Positives = 164/169 (96%)
 Frame = +2

Query: 98  MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV 277
           MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV
Sbjct: 1   MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV 60

Query: 278 YELSAEYERKHDHEKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK 457
           YELSAEYE KHD +KLEELG +ITSLDAGDSI+VAKSFSHMLNLANLAEEVQISRRRRNK
Sbjct: 61  YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK 120

Query: 458 LKKGDFADENNATTESDIEETLKKLVFKLKKSPQEVFDCLKNQTVDLVL 604
           LKKGDFADENNATTESDIEETLKKLVF LKKSPQEVFD LKNQTVDLVL
Sbjct: 121 LKKGDFADENNATTESDIEETLKKLVFGLKKSPQEVFDALKNQTVDLVL 169

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 534,676,503
Number of Sequences: 1393205
Number of extensions: 11613225
Number of successful extensions: 44175
Number of sequences better than 10.0: 272
Number of HSP's better than 10.0 without gapping: 41662
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43970
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 23997478008
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf050a08 BP064997 1 564
2 GENLf003c06 BP062505 3 473
3 GENLf016d10 BP063205 12 458
4 GENLf001b08 BP062413 23 560
5 GENLf019a10 BP063358 25 560
6 GENLf087e09 BP067096 33 531
7 GENLf012a06 BP062955 34 571
8 GENLf092d06 BP067374 41 430
9 GENLf017h01 BP063292 42 588
10 GENLf025e12 BP063659 43 512
11 GENLf067a12 BP065945 55 540
12 GENLf016c08 BP063194 57 569
13 GENLf060h10 BP065586 58 609
14 GENLf061g09 BP065634 62 569




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research