KMC000004A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000004A_C01 KMC000004A_c01
actgatgaaggtctcaagaaccaatGAAGAAAATCAAAGGAGTGGTAATAAGTTAAGCCT
GATATGGATTACATCTATCTCATCATAATTAAACATCCAACAATGCTAAATTAAGATGAC
AAAATTGCTTCAGCAGAGATCCAATTAATGCTTCTGCTGTGTTAAAAAAACAAAAAACAA
AAAATCCTAAAAGAGTTGATTTACAAATTACAGCCAAAACACATGTACATGTTCCACAAC
AACCTATGTTAATATTAGTCTTCTACTGTCTGGATCTCACCCATCATGATCCGGTTACTT
ACGACATTGAATCCCAAAACTGCAGCACTAACCTTTTTCCCTTTCTTACCCTTCTTTCCA
CCTTTTGACACAGATACCTCAGTGTGTCCCATAGCGCGTAAATCTGCATTTCCAGATATC
ATGCCTCCAGCTACTTCTCCATCATTCTGTGTCTGAAAAGCGATTTTCAAAACATCTGGT
GGTAGTAACTCCATGTAGTTGAGGAATTTTTCAATGAATTCATGATCAGGATCATATGTT
CCGAGGTTTTCTATCAGAAACATCTCCGCTTCAGATCTGGATTGCTTCAAGCAAAACTCA
AGGAAACTTGTATCTTTCGTCCCAATAAGCCTGACACACTCATTCTCACACCAAACTCTG
AAGTCCATGGCTTCAGAATTCTTAGTCATGGCATCTTTTTTTGATTTCAGCAATGATTGA
GAAGAGGCAGGTGATGCTGATAGAGACTGCTCTGTTAGTTTACTACTCCCTGATTTTTGT
CGATTTAGTGGTCCCGGTGAATTACCTTTCACAGGAACATTCTTGGAACCCCAGCTCCCC
TGGCTTGCAAGTTGAGGGAAACCTGACTGCTTATTTTCTAGCTTGGATTGCTCAACTGGA
CCCCAGAATAAGTCATCATCCCCTTTGTGTTTTGATTGAGAAGCTTGGGAGTTTATCTGG
CCAGaaggtgcagctttcgacggagatgaagctgaaactgtccatgaaggaccactactc
cgagcagcttgggcaggctgtatt


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000004A_C01 KMC000004A_c01
         (1044 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_199109.1| putative protein; protein id: At5g42950.1 [Arab...   266  4e-70
pir||F86399 protein F17L21.22 [imported] - Arabidopsis thaliana ...    50  8e-05
ref|NP_174063.1| unknown protein; protein id: At1g27430.1 [Arabi...    50  8e-05
dbj|BAB90655.1| B1033B05.5 [Oryza sativa (japonica cultivar-grou...    44  0.003
ref|NP_173840.1| unknown protein; protein id: At1g24300.1 [Arabi...    44  0.003

>ref|NP_199109.1| putative protein; protein id: At5g42950.1 [Arabidopsis thaliana]
            gi|9758584|dbj|BAB09197.1|
            gb|AAC80623.1~gene_id:MBD2.15~similar to unknown protein
            [Arabidopsis thaliana]
          Length = 1714

 Score =  266 bits (680), Expect = 4e-70
 Identities = 149/262 (56%), Positives = 183/262 (68%), Gaps = 6/262 (2%)
 Frame = -2

Query: 1025 ARSSGPSWTVSASSPSKAAPSGQINSQASQSKHKGDDDLFWGPVEQSKLENKQSGFPQLA 846
            A   G SW+ SASSPS+A     ++  +SQSK KGDDDLFWGPVEQS  + KQ  FP L 
Sbjct: 1462 AHQGGASWSRSASSPSQA-----VSQSSSQSKSKGDDDLFWGPVEQSTQDTKQGDFPHLT 1516

Query: 845  SQGSWGSKNVPVKGNSPGPLNRQKSGSSKLTEQSLSASPASSQSLLKSKKDAMTKNSEAM 666
            SQ SWG+KN P K N+   LNRQKS S    ++ LS SP  +Q+  K KK+A+TK +EA 
Sbjct: 1517 SQNSWGTKNTPGKVNAGTSLNRQKSVSMGSADRVLS-SPVVTQASHKGKKEAVTKLTEAN 1575

Query: 665  DFRVWCENECVRLIGTKDTSFLEFCLKQSRSEAEMFLIENLGTYDPDHEFIEKFLNYMEL 486
             FR WC++EC+RL+G++DTS LEFCLK SRSEAE  LIENLG+ DPDH+FI+KFLNY +L
Sbjct: 1576 GFRDWCKSECLRLLGSEDTSVLEFCLKLSRSEAETLLIENLGSRDPDHKFIDKFLNYKDL 1635

Query: 485  LPPDVLKIAFQTQNDG----EVAGGMISGNADLRAMGHTEVSVSKGGKKGKKGKKV--SA 324
            LP +V++IAFQ++  G       G     N      G ++V    G KK KKGKKV  SA
Sbjct: 1636 LPSEVVEIAFQSKGSGVGTRNNTGEDYYYNTTAANDGFSKVG---GKKKAKKGKKVSLSA 1692

Query: 323  AVLGFNVVSNRIMMGEIQTVED 258
            +VLGFNVVSNRIMMGEIQT+ED
Sbjct: 1693 SVLGFNVVSNRIMMGEIQTIED 1714

>pir||F86399 protein F17L21.22 [imported] - Arabidopsis thaliana
            gi|9802542|gb|AAF99744.1|AC004557_23 F17L21.22
            [Arabidopsis thaliana]
          Length = 1475

 Score = 49.7 bits (117), Expect = 8e-05
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 3/40 (7%)
 Frame = -2

Query: 368  SKGG---KKGKKGKKVSAAVLGFNVVSNRIMMGEIQTVED 258
            SKGG   KKGKKG+++  A+LGF V SNRI+MGEI   +D
Sbjct: 1435 SKGGGGKKKGKKGRQIDPALLGFKVTSNRILMGEIHRADD 1474

>ref|NP_174063.1| unknown protein; protein id: At1g27430.1 [Arabidopsis thaliana]
          Length = 1453

 Score = 49.7 bits (117), Expect = 8e-05
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 3/40 (7%)
 Frame = -2

Query: 368  SKGG---KKGKKGKKVSAAVLGFNVVSNRIMMGEIQTVED 258
            SKGG   KKGKKG+++  A+LGF V SNRI+MGEI   +D
Sbjct: 1413 SKGGGGKKKGKKGRQIDPALLGFKVTSNRILMGEIHRADD 1452

>dbj|BAB90655.1| B1033B05.5 [Oryza sativa (japonica cultivar-group)]
            gi|20161927|dbj|BAB90838.1| P0592G05.24 [Oryza sativa
            (japonica cultivar-group)]
          Length = 1530

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 20/33 (60%), Positives = 26/33 (78%)
 Frame = -2

Query: 356  KKGKKGKKVSAAVLGFNVVSNRIMMGEIQTVED 258
            KK KKGK++  ++LGF V SNRIMMGEI  ++D
Sbjct: 1498 KKTKKGKQIDPSLLGFKVHSNRIMMGEIHRLDD 1530

>ref|NP_173840.1| unknown protein; protein id: At1g24300.1 [Arabidopsis thaliana]
            gi|7486371|pir||T00661 hypothetical protein F3I6.24 -
            Arabidopsis thaliana gi|2829883|gb|AAC00591.1| Unknown
            protein [Arabidopsis thaliana]
          Length = 1417

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 24/40 (60%), Positives = 29/40 (72%), Gaps = 3/40 (7%)
 Frame = -2

Query: 368  SKGG---KKGKKGKKVSAAVLGFNVVSNRIMMGEIQTVED 258
            SKGG   KKGKKG+++  A+LGF V SNRI MGEI   +D
Sbjct: 1378 SKGGGGKKKGKKGRQIDPALLGFKVTSNRI-MGEIHRADD 1416

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 876,042,118
Number of Sequences: 1393205
Number of extensions: 18926277
Number of successful extensions: 54682
Number of sequences better than 10.0: 108
Number of HSP's better than 10.0 without gapping: 51356
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54539
length of database: 448,689,247
effective HSP length: 124
effective length of database: 275,931,827
effective search space used: 61532797421
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MF074g06_f BP032246 1 499
2 GNf028h09 BP069425 20 462
3 SPDL080g06_f BP057003 50 565
4 GENLf083a12 BP066853 65 444
5 SPDL085g05_f BP057355 71 604
6 MRL027d10_f BP085094 73 168
7 GENLf001b05 BP062412 87 620
8 MF062e12_f BP031588 544 1047




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research